F453392

General Info

Members Datasets Scaffolds Average Seq Length
487 266 974 149

Family's Representative Sequence

Representative Sequence 3300005327|Ga0070658_10019432|Ga0070658_100194325
Length 164
Sequence MTVQTSPLRPGQGYARSVAKILVLHGPNLNLLGDREPEVYGRTTLADIDTALARQAEAAGHTLTSYRSNAEHELIERVQAAKRDATAFILINPAAFTHTSVALRDALAAVAIPFIEVHLSNPHRREPFRRQSYFSDLALGVISGFGADSYRYALDAAIKRLATH

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
6 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
7 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
8 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
9 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
10 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
11 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
12 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
13 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
14 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
15 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
16 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
17 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
18 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
61 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
62 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
63 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
77 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
78 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
82 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
83 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
84 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
85 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
86 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
87 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
90 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
91 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
92 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
93 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
94 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
95 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
98 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
99 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
100 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
101 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
102 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
103 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
104 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
106 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
107 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
108 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
110 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
159 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
160 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
161 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
162 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
163 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
164 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
165 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
166 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
167 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
168 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
169 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
170 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
171 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
172 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
173 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
174 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
175 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
176 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
177 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
178 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
179 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
180 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
181 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
182 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
183 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
184 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
185 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
186 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
187 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
188 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
189 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
190 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
191 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
192 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
193 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
194 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
195 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
196 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
197 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
198 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
199 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
200 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
201 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
202 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
203 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
204 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
205 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
206 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
207 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
208 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
209 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
210 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
211 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
212 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
213 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
223 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
224 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
225 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
226 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
227 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
228 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
229 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
230 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
231 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
232 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
233 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
235 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
236 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
237 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
238 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
239 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
240 2571042365 Lysobacter oryzae DSM 21044 Isolate Rhizosphere
241 2643221559 Lysobacter sp. Root559 Isolate Unclassified
242 2643221573 Lysobacter sp. Root604 Isolate Unclassified
243 2643221586 Lysobacter sp. Root667 Isolate Unclassified
244 2643221612 Lysobacter sp. Root76 Isolate Unclassified
245 2643221720 Lysobacter sp. Root916 Isolate Unclassified
246 2643221727 Lysobacter sp. Root96 Isolate Unclassified
247 2643221728 Lysobacter sp. Root983 Isolate Unclassified
248 2842698319 Methylobacterium sp. R-72139 Isolate Unclassified
249 2842757796 Stenotrophomonas sp. R-72406 Isolate Unclassified
250 2846033681 Chromobacterium sinusclupearum MWU13-2610 Isolate Rhizosphere
251 2846037992 Chromobacterium alticapitis MWU14-2602 Isolate Rhizosphere
252 2874220319 Stenotrophomonas maltophilia PS5 Isolate Unclassified
253 2894414249 Luteimonas sp. LNNU 24178 Isolate Rhizosphere
254 2919089067 Stenotrophomonas sp. 1337 Isolate Rhizosphere
255 2919513703 Luteimonas sp. 3794 Isolate Unclassified
256 2919675420 Luteimonas terrae 4099 Isolate Unclassified
257 2928496128 Stenotrophomonas indicatrix 1163 Isolate Unclassified
258 2931380184 Stenotrophomonas sp. DR822 Isolate Rhizosphere
259 2937610967 Stenotrophomonas maltophilia EP20 Isolate Unclassified
260 2939589442 Stenotrophomonas rhizophila 716 Isolate Rhizosphere
261 2939626828 Stenotrophomonas sp. 2694 Isolate Rhizosphere
262 2961047084 Stenotrophomonas maltophilia EP5 Isolate Unclassified
263 2974307012 Stenotrophomonas sp. SORGH_AS_0282 Isolate Unclassified
264 2977247770 Stenotrophomonas rhizophila SORGH_AS 457 Isolate Unclassified
265 2984514374 Stenotrophomonas sp. SORGH_AS282 Isolate Aerial Root
266 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.99
Metatranscriptomes 2.46
Isolates 5.54

Biome Distribution

Category Percentage (%)
Aerial Root 0.21
Bulb 0
Endosphere 9.45
Nodule 0
Rhizoplane 0.41
Rhizosphere 80.29
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10019432 3300005327 Bacteria 5441
2 JGI24736J21556_1003779 3300001904 Bacteria 2610
3 JGI24741J21665_1005023 3300001915 Bacteria 2831
4 JGI24741J21665_1010251 3300001915 Bacteria 1686
5 JGI24740J21852_10003213 3300001979 Bacteria 7210
6 JGI24740J21852_10006928 3300001979 Bacteria 4653
7 JGI24740J21852_10026128 3300001979 Bacteria 1959
8 JGI24738J21930_10062799 3300002075 Bacteria 764
9 JGI25151J46595_10061121 3300003187 Bacteria 1201
10 Ga0055526_1001338 3300003771 Bacteria 17649
11 Ga0055526_1012004 3300003771 Bacteria 3829
12 Ga0055537_1000591 3300003773 Bacteria 20176
13 Ga0055524_1048325 3300003775 Bacteria 993
14 Ga0055536_1003946 3300003781 Bacteria 7777
15 Ga0055534_1000129 3300003784 Bacteria 56688
16 Ga0055528_1000546 3300003790 Bacteria 28715
17 Ga0055530_10002711 3300003791 Bacteria 11004
18 Ga0055531_10002719 3300003794 Bacteria 11641
19 Ga0055531_10015638 3300003794 Bacteria 3329
20 Ga0058692_1000004 3300003856 Bacteria 431119
21 Ga0065165_1072491 3300005262 Bacteria 912
22 Ga0065704_10108539 3300005289 Bacteria 2023
23 Ga0070658_10217756 3300005327 Bacteria 1614
24 Ga0070658_10397021 3300005327 Bacteria 1184
25 Ga0070658_10588464 3300005327 Bacteria 964
26 Ga0070683_100000447 3300005329 Bacteria 28768
27 Ga0070683_100013005 3300005329 Bacteria 7245
28 Ga0070683_100096783 3300005329 Bacteria 2776
29 Ga0070670_100008296 3300005331 Bacteria 8848
30 Ga0070677_10502094 3300005333 Bacteria 657
31 Ga0070680_100002191 3300005336 Bacteria 14403
32 Ga0070680_100139769 3300005336 Bacteria 2030
33 Ga0070680_100167725 3300005336 Bacteria 1847
34 Ga0070682_100037103 3300005337 Bacteria 2982
35 Ga0068868_100002433 3300005338 Bacteria 12898
36 Ga0070660_100010477 3300005339 Bacteria 6552
37 Ga0070660_100072869 3300005339 Bacteria 2685
38 Ga0070660_100166330 3300005339 Bacteria 1779
39 Ga0070660_100196724 3300005339 Bacteria 1634
40 Ga0070691_10032611 3300005341 Bacteria 2448
41 Ga0070661_100000366 3300005344 Bacteria 35667
42 Ga0070661_100008068 3300005344 Bacteria 7267
43 Ga0070661_100030464 3300005344 Bacteria 3898
44 Ga0070661_100181088 3300005344 Bacteria 1603
45 Ga0070692_10002472 3300005345 Bacteria 7184
46 Ga0070692_10007563 3300005345 Bacteria 4791
47 Ga0070692_10217497 3300005345 Bacteria 1127
48 Ga0070668_100003066 3300005347 Bacteria 12354
49 Ga0070668_100028349 3300005347 Bacteria 4252
50 Ga0070668_100101944 3300005347 Bacteria 2275
51 Ga0070668_101120991 3300005347 Bacteria 711
52 Ga0070669_100104624 3300005353 Bacteria 2140
53 Ga0070669_100422262 3300005353 Bacteria 1095
54 Ga0070675_100000296 3300005354 Bacteria 33297
55 Ga0070675_100391975 3300005354 Bacteria 1238
56 Ga0070671_100001203 3300005355 Bacteria 19368
57 Ga0070673_100000095 3300005364 Bacteria 39351
58 Ga0070659_100010483 3300005366 Bacteria 6819
59 Ga0070659_100053452 3300005366 Bacteria 3179
60 Ga0070659_100421509 3300005366 Bacteria 1129
61 Ga0070714_100085197 3300005435 Bacteria 2759
62 Ga0070713_100007831 3300005436 Bacteria 7531
63 Ga0070663_100109626 3300005455 Bacteria 2073
64 Ga0070663_100310832 3300005455 Bacteria 1264
65 Ga0070678_100000184 3300005456 Bacteria 27334
66 Ga0070681_10005704 3300005458 Bacteria 12034
67 Ga0070681_10168065 3300005458 Bacteria 2115
68 Ga0068867_100013649 3300005459 Bacteria 5753
69 Ga0070699_101594203 3300005518 Bacteria 598
70 Ga0070679_100004755 3300005530 Bacteria 12524
71 Ga0070679_100007142 3300005530 Bacteria 10426
72 Ga0070679_100561128 3300005530 Bacteria 1085
73 Ga0070684_100004685 3300005535 Bacteria 10442
74 Ga0070684_100144415 3300005535 Bacteria 2153
75 Ga0068853_100008762 3300005539 Bacteria 8137
76 Ga0068853_100039972 3300005539 Bacteria 4001
77 Ga0068853_100060357 3300005539 Bacteria 3276
78 Ga0070672_100000230 3300005543 Bacteria 31233
79 Ga0070672_101201502 3300005543 Bacteria 676
80 Ga0070686_100481111 3300005544 Bacteria 960
81 Ga0070696_100013057 3300005546 Bacteria 5574
82 Ga0070696_100051108 3300005546 Bacteria 2874
83 Ga0070696_100179544 3300005546 Bacteria 1570
84 Ga0070665_100074612 3300005548 Bacteria 3398
85 Ga0070665_100087256 3300005548 Bacteria 3125
86 Ga0068855_100021665 3300005563 Bacteria 7709
87 Ga0068855_100067768 3300005563 Bacteria 4156
88 Ga0068855_100829378 3300005563 Bacteria 981
89 Ga0070664_100000172 3300005564 Bacteria 45323
90 Ga0070664_100189628 3300005564 Bacteria 1831
91 Ga0070664_100602895 3300005564 Bacteria 1018
92 Ga0068857_100012963 3300005577 Bacteria 7266
93 Ga0068854_100004703 3300005578 Bacteria 8606
94 Ga0068854_100021150 3300005578 Bacteria 4412
95 Ga0068854_100121410 3300005578 Bacteria 1984
96 Ga0068856_100030739 3300005614 Bacteria 5251
97 Ga0068856_100479762 3300005614 Bacteria 1264
98 Ga0068852_100002217 3300005616 Bacteria 13331
99 Ga0068852_100008865 3300005616 Bacteria 7440
100 Ga0068852_100048052 3300005616 Bacteria 3645
101 Ga0068852_100233485 3300005616 Bacteria 1754
102 Ga0068859_100026355 3300005617 Bacteria 5828
103 Ga0068864_100001436 3300005618 Bacteria 19650
104 Ga0068864_100198479 3300005618 Bacteria 1842
105 Ga0068851_10005640 3300005834 Bacteria 5688
106 Ga0068870_10066793 3300005840 Bacteria 1949
107 Ga0068863_100106337 3300005841 Bacteria 2670
108 Ga0068863_100734675 3300005841 Bacteria 982
109 Ga0068858_100088410 3300005842 Bacteria 2883
110 Ga0075365_10177865 3300006038 Bacteria 1487
111 Ga0075364_10073465 3300006051 Bacteria 2254
112 Ga0075364_10565038 3300006051 Bacteria 777
113 Ga0070712_100091268 3300006175 Bacteria 2232
114 Ga0075367_10041675 3300006178 Bacteria 2685
115 Ga0097621_100000958 3300006237 Bacteria 20242
116 Ga0097621_100042326 3300006237 Bacteria 3668
117 Ga0097621_100095891 3300006237 Bacteria 2489
118 Ga0068871_100000297 3300006358 Bacteria 34596
119 Ga0068871_100009734 3300006358 Bacteria 6976
120 Ga0068871_100466398 3300006358 Bacteria 1134
121 Ga0068865_100015750 3300006881 Bacteria 4825
122 Ga0097620_100026354 3300006931 Bacteria 5828
123 Ga0105240_10068782 3300009093 Bacteria 4385
124 Ga0105240_10073058 3300009093 Bacteria 4236
125 Ga0105240_10076712 3300009093 Bacteria 4120
126 Ga0105240_10474020 3300009093 Bacteria 1396
127 Ga0111539_11855543 3300009094 Bacteria 699
128 Ga0105245_10393078 3300009098 Bacteria 1384
129 Ga0105241_10146107 3300009174 Bacteria 1930
130 Ga0105248_10668253 3300009177 Bacteria 1172
131 Ga0105237_11064867 3300009545 Bacteria 815
132 Ga0105238_10008324 3300009551 Bacteria 10374
133 Ga0105239_10193735 3300010375 Bacteria 2276
134 Ga0157373_10005528 3300013100 Bacteria 9474
135 Ga0157373_10043904 3300013100 Bacteria 3192
136 Ga0157373_10054274 3300013100 Bacteria 2848
137 Ga0157373_10115067 3300013100 Bacteria 1891
138 Ga0157371_10001335 3300013102 Bacteria 25935
139 Ga0157371_10006073 3300013102 Bacteria 10048
140 Ga0157371_10007736 3300013102 Bacteria 8643
141 Ga0157371_10160560 3300013102 Bacteria 1605
142 Ga0157370_10003234 3300013104 Bacteria 19235
143 Ga0157370_10034419 3300013104 Bacteria 4934
144 Ga0157370_10077619 3300013104 Bacteria 3129
145 Ga0157370_10285139 3300013104 Bacteria 1526
146 Ga0157370_10300841 3300013104 Bacteria 1481
147 Ga0157370_10363703 3300013104 Bacteria 1333
148 Ga0157369_10012473 3300013105 Bacteria 9643
149 Ga0157369_10052925 3300013105 Bacteria 4390
150 Ga0157369_10099010 3300013105 Bacteria 3108
151 Ga0157369_10376146 3300013105 Bacteria 1474
152 Ga0157369_10512925 3300013105 Bacteria 1240
153 Ga0157369_10715810 3300013105 Bacteria 1031
154 Ga0157378_10002075 3300013297 Bacteria 17926
155 Ga0157378_10047168 3300013297 Bacteria 3829
156 Ga0157372_10004432 3300013307 Bacteria 14975
157 Ga0157372_10020308 3300013307 Bacteria 7165
158 Ga0157372_10072977 3300013307 Bacteria 3868
159 Ga0157372_10231643 3300013307 Bacteria 2142
160 Ga0157380_10359854 3300014326 Bacteria 1365
161 Ga0182008_10019478 3300014497 Bacteria 3502
162 Ga0182008_10023661 3300014497 Bacteria 3134
163 Ga0182008_10120177 3300014497 Bacteria 1306
164 Ga0157376_10031878 3300014969 Bacteria 4226
165 Ga0182006_1007174 3300015261 Bacteria 5123
166 Ga0182006_1013849 3300015261 Bacteria 3488
167 Ga0163161_10071406 3300017792 Bacteria 2540
168 Ga0197907_11176716 3300020069 Bacteria 3951
169 Ga0197907_11267774 3300020069 Bacteria 871
170 Ga0206356_10025320 3300020070 Bacteria 5620
171 Ga0206351_10301263 3300020077 Bacteria 4801
172 Ga0206350_11393987 3300020080 Bacteria 2324
173 Ga0206354_11195817 3300020081 Bacteria 6031
174 Ga0206354_11460538 3300020081 Bacteria 1347
175 Ga0206353_10171492 3300020082 Bacteria 1056
176 Ga0206353_10637626 3300020082 Bacteria 3701
177 Ga0154015_1336253 3300020610 Bacteria 5244
178 Ga0154015_1592849 3300020610 Bacteria 972
179 Ga0224712_10658690 3300022467 Bacteria 513
180 Ga0209674_102776 3300025226 Bacteria 3542
181 Ga0209258_109656 3300025242 Bacteria 1285
182 Ga0207425_1026714 3300025245 Bacteria 1182
183 Ga0209026_1000119 3300025250 Bacteria 130220
184 Ga0209759_1012236 3300025256 Bacteria 2388
185 Ga0209565_1000050 3300025263 Bacteria 213856
186 Ga0209673_1000859 3300025273 Bacteria 39489
187 Ga0209130_1005741 3300025284 Bacteria 4208
188 Ga0209130_1031348 3300025284 Bacteria 1090
189 Ga0209675_1000007 3300025291 Bacteria 683430
190 Ga0209675_1030555 3300025291 Bacteria 1283
191 Ga0209676_1000716 3300025292 Bacteria 45721
192 Ga0209676_1001358 3300025292 Bacteria 24174
193 Ga0209676_1001818 3300025292 Bacteria 17787
194 Ga0209025_1007519 3300025294 Bacteria 8095
195 Ga0209025_1007858 3300025294 Bacteria 7828
196 Ga0209564_1000061 3300025295 Bacteria 322795
197 Ga0209758_1079250 3300025297 Bacteria 1000
198 Ga0209050_1002271 3300025298 Bacteria 17016
199 Ga0209256_1002701 3300025299 Bacteria 13838
200 Ga0209256_1006682 3300025299 Bacteria 5992
201 Ga0209256_1010363 3300025299 Bacteria 3919
202 Ga0209051_1007649 3300025303 Bacteria 5874
203 Ga0209257_1001439 3300025304 Bacteria 28102
204 Ga0209257_1002553 3300025304 Bacteria 17757
205 Ga0209257_1002612 3300025304 Bacteria 17423
206 Ga0209257_1006821 3300025304 Bacteria 7175
207 Ga0209257_1065784 3300025304 Bacteria 971
208 Ga0207656_10015257 3300025321 Bacteria 2971
209 Ga0207656_10110937 3300025321 Bacteria 1267
210 Ga0207682_10290812 3300025893 Bacteria 765
211 Ga0207642_10037808 3300025899 Bacteria 2083
212 Ga0207680_10114120 3300025903 Bacteria 1757
213 Ga0207647_10000959 3300025904 Bacteria 22333
214 Ga0207647_10025888 3300025904 Bacteria 3846
215 Ga0207699_10297225 3300025906 Bacteria 1127
216 Ga0207705_10000880 3300025909 Bacteria 24615
217 Ga0207705_10012214 3300025909 Bacteria 6207
218 Ga0207705_10084016 3300025909 Bacteria 2324
219 Ga0207705_10140323 3300025909 Bacteria 1804
220 Ga0207705_10185199 3300025909 Bacteria 1573
221 Ga0207705_10410404 3300025909 Bacteria 1048
222 Ga0207654_10136848 3300025911 Bacteria 1557
223 Ga0207707_10000020 3300025912 Bacteria 205480
224 Ga0207707_10000191 3300025912 Bacteria 64552
225 Ga0207707_10000825 3300025912 Bacteria 30398
226 Ga0207707_10006645 3300025912 Bacteria 10087
227 Ga0207707_10007901 3300025912 Bacteria 9251
228 Ga0207707_11035102 3300025912 Bacteria 672
229 Ga0207695_10002326 3300025913 Bacteria 28340
230 Ga0207695_10006631 3300025913 Bacteria 14954
231 Ga0207695_10139417 3300025913 Bacteria 2375
232 Ga0207671_10533626 3300025914 Bacteria 935
233 Ga0207660_10003575 3300025917 Bacteria 10122
234 Ga0207660_10008572 3300025917 Bacteria 6617
235 Ga0207660_10445357 3300025917 Bacteria 1047
236 Ga0207660_10736813 3300025917 Bacteria 804
237 Ga0207657_10008506 3300025919 Bacteria 10408
238 Ga0207657_10008627 3300025919 Bacteria 10318
239 Ga0207657_10056375 3300025919 Bacteria 3391
240 Ga0207657_10104347 3300025919 Bacteria 2348
241 Ga0207649_10003408 3300025920 Bacteria 8691
242 Ga0207649_10018940 3300025920 Bacteria 3927
243 Ga0207649_10819424 3300025920 Bacteria 727
244 Ga0207649_11123631 3300025920 Bacteria 620
245 Ga0207652_10002578 3300025921 Bacteria 15217
246 Ga0207652_10008414 3300025921 Bacteria 8303
247 Ga0207652_10011302 3300025921 Bacteria 7193
248 Ga0207652_10059065 3300025921 Bacteria 3305
249 Ga0207681_10091289 3300025923 Bacteria 2175
250 Ga0207694_10139694 3300025924 Bacteria 1947
251 Ga0207650_10006057 3300025925 Bacteria 8249
252 Ga0207659_10004591 3300025926 Bacteria 8356
253 Ga0207700_10005288 3300025928 Bacteria 7696
254 Ga0207664_10340738 3300025929 Bacteria 1325
255 Ga0207644_10009466 3300025931 Bacteria 6398
256 Ga0207690_10011084 3300025932 Bacteria 5377
257 Ga0207690_10042844 3300025932 Bacteria 2976
258 Ga0207686_10514670 3300025934 Bacteria 930
259 Ga0207669_10366447 3300025937 Bacteria 1118
260 Ga0207704_10116301 3300025938 Bacteria 1819
261 Ga0207691_10000530 3300025940 Bacteria 38079
262 Ga0207711_10063080 3300025941 Bacteria 3198
263 Ga0207711_10457722 3300025941 Bacteria 1188
264 Ga0207661_10000573 3300025944 Bacteria 23479
265 Ga0207661_10008249 3300025944 Bacteria 7439
266 Ga0207661_10014749 3300025944 Bacteria 5732
267 Ga0207679_10001697 3300025945 Bacteria 13724
268 Ga0207679_10085149 3300025945 Bacteria 2427
269 Ga0207667_10003891 3300025949 Bacteria 18369
270 Ga0207667_10005472 3300025949 Bacteria 15482
271 Ga0207667_10014771 3300025949 Bacteria 8885
272 Ga0207667_11042089 3300025949 Bacteria 804
273 Ga0207651_10073067 3300025960 Bacteria 2437
274 Ga0207668_10001055 3300025972 Bacteria 16435
275 Ga0207668_10040638 3300025972 Bacteria 3139
276 Ga0207668_10090382 3300025972 Bacteria 2247
277 Ga0207640_10000741 3300025981 Bacteria 18760
278 Ga0207640_10014609 3300025981 Bacteria 4524
279 Ga0207640_10062925 3300025981 Bacteria 2464
280 Ga0207640_10087969 3300025981 Bacteria 2143
281 Ga0207640_10108664 3300025981 Bacteria 1961
282 Ga0207677_10002691 3300026023 Bacteria 9372
283 Ga0207703_11110045 3300026035 Bacteria 760
284 Ga0207639_10128322 3300026041 Bacteria 2095
285 Ga0207678_10006449 3300026067 Bacteria 10409
286 Ga0207678_10025405 3300026067 Bacteria 5171
287 Ga0207678_10147846 3300026067 Bacteria 2005
288 Ga0207702_10001189 3300026078 Bacteria 26417
289 Ga0207702_10102835 3300026078 Bacteria 2526
290 Ga0207702_10402548 3300026078 Bacteria 1320
291 Ga0207641_10033066 3300026088 Bacteria 4297
292 Ga0207641_10084767 3300026088 Bacteria 2759
293 Ga0207676_10003045 3300026095 Bacteria 11965
294 Ga0207676_10296592 3300026095 Bacteria 1474
295 Ga0207674_10011086 3300026116 Bacteria 10134
296 Ga0207674_10013850 3300026116 Bacteria 8922
297 Ga0207683_10001233 3300026121 Bacteria 23243
298 Ga0207698_10000632 3300026142 Bacteria 20423
299 Ga0207698_10038156 3300026142 Bacteria 3546
300 Ga0207698_10041097 3300026142 Bacteria 3442
301 Ga0207698_10701232 3300026142 Bacteria 1007
302 Ga0209371_1000018 3300027312 Bacteria 614700
303 Ga0268266_10069270 3300028379 Bacteria 3056
304 Ga0268266_11819904 3300028379 Bacteria 583
305 Ga0268256_1000016 3300030500 Bacteria 614700
306 Ga0307516_10088353 3300031730 Bacteria 2932
307 Ga0307405_10038131 3300031731 Bacteria 2894
308 Ga0307412_10000871 3300031911 Bacteria 17357
309 Ga0307412_10251930 3300031911 Bacteria 1371
310 Ga0307416_100683971 3300032002 Bacteria 1114
311 Ga0307414_10036984 3300032004 Bacteria 3265
312 Ga0307414_11157145 3300032004 Bacteria 715
313 Ga0307411_10363018 3300032005 Bacteria 1185
314 Ga0316574_0508200 3300035398 Bacteria 751
315 Ga0395899_0037307 3300037312 Bacteria 3643
316 Ga0395899_0182163 3300037312 Bacteria 1474
317 Ga0395900_0030379 3300037418 Bacteria 5548
318 Ga0395898_0022315 3300037466 Bacteria 6411
319 Ga0395898_0044697 3300037466 Bacteria 4357
320 Ga0395898_0259058 3300037466 Bacteria 1659
321 Ga0395905_1529694 3300037471 Bacteria 572
322 Ga0395901_0162602 3300038443 Bacteria 2344
323 Ga0395901_0289435 3300038443 Bacteria 1700
324 Ga0237819_12743 3300038705 Bacteria 1031
325 Ga0439436_0019541 3300041404 Bacteria 2022
326 Ga0439436_0027121 3300041404 Bacteria 1677
327 Ga0439436_0119051 3300041404 Bacteria 738
328 Ga0439439_0016664 3300041406 Bacteria 1801
329 Ga0439466_0169549 3300041411 Bacteria 667
330 Ga0439465_0001175 3300041413 Bacteria 8415
331 Ga0451807_1395036 3300041486 Bacteria 998
332 Ga0451837_1128287 3300041494 Bacteria 1656
333 Ga0451837_1766088 3300041494 Bacteria 1059
334 Ga0451849_0530073 3300041505 Bacteria 903
335 Ga0451843_0149717 3300041509 Bacteria 846
336 Ga0451855_1470718 3300041511 Bacteria 519
337 Ga0439445_0042212 3300042004 Bacteria 1214
338 Ga0439445_0072139 3300042004 Bacteria 956
339 Ga0439432_008628 3300042006 Bacteria 3577
340 Ga0439432_028625 3300042006 Bacteria 1813
341 Ga0439449_0037279 3300042007 Bacteria 1808
342 Ga0439449_0054416 3300042007 Bacteria 1478
343 Ga0439457_054010 3300042014 Bacteria 904
344 Ga0450911_000323 3300042115 Bacteria 17148
345 Ga0451577_0744441 3300042876 Bacteria 887
346 Ga0466959_0072920 3300045049 Bacteria 2484
347 Ga0495638_0015487 3300046460 Bacteria 5118
348 Ga0495638_0670713 3300046460 Bacteria 502
349 Ga0495605_0079992 3300046474 Bacteria 1530
350 Ga0495583_0018125 3300046506 Bacteria 3715
351 Ga0495616_0000127 3300046513 Bacteria 66628
352 Ga0495632_0001000 3300046519 Bacteria 24627
353 Ga0495643_0001020 3300046522 Bacteria 28577
354 Ga0495663_0012352 3300046525 Bacteria 2379
355 Ga0495633_0000792 3300046558 Bacteria 28178
356 Ga0495633_0001337 3300046558 Bacteria 19332
357 Ga0495656_0001608 3300046615 Bacteria 7395
358 Ga0495656_0525918 3300046615 Bacteria 629
359 Ga0495625_0137343 3300046660 Bacteria 1651
360 Ga0495659_0026671 3300046664 Bacteria 1988
361 Ga0495660_0047242 3300046810 Bacteria 2358
362 Ga0495636_0002607 3300047318 Bacteria 6936
363 Ga0495636_0070025 3300047318 Bacteria 1495
364 Ga0495636_0131980 3300047318 Bacteria 1111
365 Ga0495636_0140457 3300047318 Bacteria 1078
366 Ga0495685_227499 3300047447 Bacteria 594
367 Ga0495686_0006682 3300047472 Bacteria 8777
368 Ga0496104_0783391 3300048907 Bacteria 860
369 Ga0496116_0002271 3300048919 Bacteria 20377
370 Ga0496116_0163856 3300048919 Bacteria 1215
371 Ga0496117_0000041 3300048920 Bacteria 317207
372 Ga0496117_0001679 3300048920 Bacteria 30883
373 Ga0496117_0010461 3300048920 Bacteria 8453
374 Ga0496117_0078801 3300048920 Bacteria 2173
375 Ga0496118_0001516 3300048921 Bacteria 34577
376 Ga0496118_0001806 3300048921 Bacteria 30829
377 Ga0496118_0021408 3300048921 Bacteria 5691
378 Ga0496119_0144688 3300048922 Bacteria 1280
379 Ga0496122_0039441 3300048925 Bacteria 3766
380 Ga0496122_0046492 3300048925 Bacteria 3360
381 Ga0496123_0020103 3300048926 Bacteria 5237
382 Ga0496123_0034837 3300048926 Bacteria 3598
383 Ga0496123_0163925 3300048926 Bacteria 1181
384 Ga0496124_0002738 3300048927 Bacteria 22476
385 Ga0496124_0015008 3300048927 Bacteria 7456
386 Ga0496124_0088791 3300048927 Bacteria 2525
387 Ga0496125_0072887 3300048928 Bacteria 2673
388 Ga0496125_0161017 3300048928 Bacteria 1524
389 Ga0496126_0298330 3300048929 Bacteria 1330
390 Ga0501032_0009554 3300049569 Bacteria 7033
391 Ga0501032_0276739 3300049569 Bacteria 1087
392 Ga0501033_0003317 3300049570 Bacteria 13292
393 Ga0501033_0313203 3300049570 Bacteria 1103
394 Ga0501033_0766957 3300049570 Bacteria 653
395 Ga0501034_0010062 3300049571 Bacteria 9871
396 Ga0501034_0011973 3300049571 Bacteria 8965
397 Ga0501034_0045979 3300049571 Bacteria 4410
398 Ga0501034_0319060 3300049571 Bacteria 1487
399 Ga0501034_0381564 3300049571 Bacteria 1334
400 Ga0501036_0050634 3300049572 Bacteria 3517
401 Ga0501036_0220973 3300049572 Bacteria 1591
402 Ga0501036_0300820 3300049572 Bacteria 1342
403 Ga0501037_0016862 3300049573 Bacteria 5375
404 Ga0501037_0108644 3300049573 Bacteria 1999
405 Ga0501037_0298977 3300049573 Bacteria 1118
406 Ga0501038_0009799 3300049574 Bacteria 8772
407 Ga0501038_0121775 3300049574 Bacteria 2150
408 Ga0501043_0016335 3300049579 Bacteria 5823
409 Ga0501043_0067591 3300049579 Bacteria 2806
410 Ga0501043_0126198 3300049579 Bacteria 2007
411 Ga0501046_0221397 3300049580 Bacteria 1401
412 Ga0501047_0006728 3300049581 Bacteria 10806
413 Ga0501047_0007451 3300049581 Bacteria 10300
414 Ga0501047_0024505 3300049581 Bacteria 5790
415 Ga0501047_0032235 3300049581 Bacteria 5058
416 Ga0501067_0000133 3300049583 Bacteria 40645
417 Ga0501068_0007092 3300049584 Bacteria 6203
418 Ga0501069_0002946 3300049585 Bacteria 8748
419 Ga0501069_0014979 3300049585 Bacteria 4154
420 Ga0501069_0151627 3300049585 Bacteria 1332
421 Ga0501070_0000067 3300049586 Bacteria 87334
422 Ga0501070_0001471 3300049586 Bacteria 21106
423 Ga0501070_0007327 3300049586 Bacteria 9366
424 Ga0501070_0016884 3300049586 Bacteria 6125
425 Ga0501070_0027166 3300049586 Bacteria 4801
426 Ga0501070_0175687 3300049586 Bacteria 1763
427 Ga0501071_0199281 3300049587 Bacteria 1503
428 Ga0501071_0322042 3300049587 Bacteria 1174
429 Ga0501072_0000442 3300049588 Bacteria 29685
430 Ga0501073_0000107 3300049589 Bacteria 53317
431 Ga0501073_0006423 3300049589 Bacteria 8752
432 Ga0501073_0028738 3300049589 Bacteria 3973
433 Ga0501073_0406650 3300049589 Bacteria 940
434 Ga0501074_0002669 3300049590 Bacteria 12486
435 Ga0501074_0041061 3300049590 Bacteria 3349
436 Ga0501074_0050296 3300049590 Bacteria 3009
437 Ga0501079_0026314 3300049741 Bacteria 4461
438 Ga0501079_0135897 3300049741 Bacteria 1914
439 Ga0501079_1087966 3300049741 Bacteria 630
440 Ga0501080_0007243 3300049742 Bacteria 10011
441 Ga0501080_0016215 3300049742 Bacteria 6878
442 Ga0501080_0131579 3300049742 Bacteria 2316
443 Ga0501083_0343107 3300049744 Bacteria 971
444 Ga0501035_0008493 3300049822 Bacteria 9564
445 Ga0501035_0024982 3300049822 Bacteria 5479
446 Ga0501035_0025508 3300049822 Bacteria 5418
447 Ga0501035_0464962 3300049822 Bacteria 1045
448 Ga0501035_0539467 3300049822 Bacteria 956
449 Ga0501044_0018036 3300049823 Bacteria 7569
450 Ga0501044_0029514 3300049823 Bacteria 5782
451 Ga0501044_0039149 3300049823 Bacteria 4946
452 Ga0501044_0097012 3300049823 Bacteria 2969
453 Ga0501044_0443366 3300049823 Bacteria 1206
454 Ga0501044_0514903 3300049823 Bacteria 1096
455 nmdc:mga00v17_468213_c1 3300050491 Bacteria 818
456 nmdc:mga00v17_77754_c1 3300050491 Bacteria 2067
457 nmdc:mga0yw44_307878_c1 3300050492 Bacteria 1062
458 Ga0500616_0010859 3300053153 Bacteria 5427
459 Ga0501084_0032683 3300054114 Bacteria 4353
460 Ga0501082_0060950 3300060353 Bacteria 3248
461 2572255839 2571042365 Bacteria 3289345
462 2643816823 2643221559 Bacteria 4424915
463 2643881110 2643221573 Bacteria 4784121
464 2643939241 2643221586 Bacteria 4446529
465 2644077919 2643221612 Bacteria 4361984
466 2644661880 2643221720 Bacteria 4694283
467 2644696220 2643221727 Bacteria 4415595
468 2644700021 2643221728 Bacteria 4797149
469 2842698757 2842698319 Bacteria 5190321
470 2842760764 2842757796 Bacteria 3981385
471 2846035005 2846033681 Bacteria 4377894
472 2846040683 2846037992 Bacteria 4526407
473 2874223409 2874220319 Bacteria 4594709
474 2894416549 2894414249 Bacteria 4405451
475 2919092172 2919089067 Bacteria 4560942
476 2919516820 2919513703 Bacteria 3844312
477 2919676486 2919675420 Bacteria 3969095
478 2928497208 2928496128 Bacteria 4631123
479 2931383177 2931380184 Bacteria 4455911
480 2937614110 2937610967 Bacteria 4618818
481 2939590043 2939589442 Bacteria 4214238
482 2939630420 2939626828 Bacteria 4695272
483 2961050173 2961047084 Bacteria 4594415
484 2974307357 2974307012 Bacteria 4172388
485 2977248103 2977247770 Bacteria 4160543
486 2984517440 2984514374 Bacteria 4172479
487 8003017455 8003014200 Bacteria 4059994
488 Ga0070658_10019432
489 JGI24736J21556_1003779
490 JGI24741J21665_1005023
491 JGI24741J21665_1010251
492 JGI24740J21852_10003213
493 JGI24740J21852_10006928
494 JGI24740J21852_10026128
495 JGI24738J21930_10062799
496 JGI25151J46595_10061121
497 Ga0055526_1001338
498 Ga0055526_1012004
499 Ga0055537_1000591
500 Ga0055524_1048325
501 Ga0055536_1003946
502 Ga0055534_1000129
503 Ga0055528_1000546
504 Ga0055530_10002711
505 Ga0055531_10002719
506 Ga0055531_10015638
507 Ga0058692_1000004
508 Ga0065165_1072491
509 Ga0065704_10108539
510 Ga0070658_10217756
511 Ga0070658_10397021
512 Ga0070658_10588464
513 Ga0070683_100000447
514 Ga0070683_100013005
515 Ga0070683_100096783
516 Ga0070670_100008296
517 Ga0070677_10502094
518 Ga0070680_100002191
519 Ga0070680_100139769
520 Ga0070680_100167725
521 Ga0070682_100037103
522 Ga0068868_100002433
523 Ga0070660_100010477
524 Ga0070660_100072869
525 Ga0070660_100166330
526 Ga0070660_100196724
527 Ga0070691_10032611
528 Ga0070661_100000366
529 Ga0070661_100008068
530 Ga0070661_100030464
531 Ga0070661_100181088
532 Ga0070692_10002472
533 Ga0070692_10007563
534 Ga0070692_10217497
535 Ga0070668_100003066
536 Ga0070668_100028349
537 Ga0070668_100101944
538 Ga0070668_101120991
539 Ga0070669_100104624
540 Ga0070669_100422262
541 Ga0070675_100000296
542 Ga0070675_100391975
543 Ga0070671_100001203
544 Ga0070673_100000095
545 Ga0070659_100010483
546 Ga0070659_100053452
547 Ga0070659_100421509
548 Ga0070714_100085197
549 Ga0070713_100007831
550 Ga0070663_100109626
551 Ga0070663_100310832
552 Ga0070678_100000184
553 Ga0070681_10005704
554 Ga0070681_10168065
555 Ga0068867_100013649
556 Ga0070699_101594203
557 Ga0070679_100004755
558 Ga0070679_100007142
559 Ga0070679_100561128
560 Ga0070684_100004685
561 Ga0070684_100144415
562 Ga0068853_100008762
563 Ga0068853_100039972
564 Ga0068853_100060357
565 Ga0070672_100000230
566 Ga0070672_101201502
567 Ga0070686_100481111
568 Ga0070696_100013057
569 Ga0070696_100051108
570 Ga0070696_100179544
571 Ga0070665_100074612
572 Ga0070665_100087256
573 Ga0068855_100021665
574 Ga0068855_100067768
575 Ga0068855_100829378
576 Ga0070664_100000172
577 Ga0070664_100189628
578 Ga0070664_100602895
579 Ga0068857_100012963
580 Ga0068854_100004703
581 Ga0068854_100021150
582 Ga0068854_100121410
583 Ga0068856_100030739
584 Ga0068856_100479762
585 Ga0068852_100002217
586 Ga0068852_100008865
587 Ga0068852_100048052
588 Ga0068852_100233485
589 Ga0068859_100026355
590 Ga0068864_100001436
591 Ga0068864_100198479
592 Ga0068851_10005640
593 Ga0068870_10066793
594 Ga0068863_100106337
595 Ga0068863_100734675
596 Ga0068858_100088410
597 Ga0075365_10177865
598 Ga0075364_10073465
599 Ga0075364_10565038
600 Ga0070712_100091268
601 Ga0075367_10041675
602 Ga0097621_100000958
603 Ga0097621_100042326
604 Ga0097621_100095891
605 Ga0068871_100000297
606 Ga0068871_100009734
607 Ga0068871_100466398
608 Ga0068865_100015750
609 Ga0097620_100026354
610 Ga0105240_10068782
611 Ga0105240_10073058
612 Ga0105240_10076712
613 Ga0105240_10474020
614 Ga0111539_11855543
615 Ga0105245_10393078
616 Ga0105241_10146107
617 Ga0105248_10668253
618 Ga0105237_11064867
619 Ga0105238_10008324
620 Ga0105239_10193735
621 Ga0157373_10005528
622 Ga0157373_10043904
623 Ga0157373_10054274
624 Ga0157373_10115067
625 Ga0157371_10001335
626 Ga0157371_10006073
627 Ga0157371_10007736
628 Ga0157371_10160560
629 Ga0157370_10003234
630 Ga0157370_10034419
631 Ga0157370_10077619
632 Ga0157370_10285139
633 Ga0157370_10300841
634 Ga0157370_10363703
635 Ga0157369_10012473
636 Ga0157369_10052925
637 Ga0157369_10099010
638 Ga0157369_10376146
639 Ga0157369_10512925
640 Ga0157369_10715810
641 Ga0157378_10002075
642 Ga0157378_10047168
643 Ga0157372_10004432
644 Ga0157372_10020308
645 Ga0157372_10072977
646 Ga0157372_10231643
647 Ga0157380_10359854
648 Ga0182008_10019478
649 Ga0182008_10023661
650 Ga0182008_10120177
651 Ga0157376_10031878
652 Ga0182006_1007174
653 Ga0182006_1013849
654 Ga0163161_10071406
655 Ga0197907_11176716
656 Ga0197907_11267774
657 Ga0206356_10025320
658 Ga0206351_10301263
659 Ga0206350_11393987
660 Ga0206354_11195817
661 Ga0206354_11460538
662 Ga0206353_10171492
663 Ga0206353_10637626
664 Ga0154015_1336253
665 Ga0154015_1592849
666 Ga0224712_10658690
667 Ga0209674_102776
668 Ga0209258_109656
669 Ga0207425_1026714
670 Ga0209026_1000119
671 Ga0209759_1012236
672 Ga0209565_1000050
673 Ga0209673_1000859
674 Ga0209130_1005741
675 Ga0209130_1031348
676 Ga0209675_1000007
677 Ga0209675_1030555
678 Ga0209676_1000716
679 Ga0209676_1001358
680 Ga0209676_1001818
681 Ga0209025_1007519
682 Ga0209025_1007858
683 Ga0209564_1000061
684 Ga0209758_1079250
685 Ga0209050_1002271
686 Ga0209256_1002701
687 Ga0209256_1006682
688 Ga0209256_1010363
689 Ga0209051_1007649
690 Ga0209257_1001439
691 Ga0209257_1002553
692 Ga0209257_1002612
693 Ga0209257_1006821
694 Ga0209257_1065784
695 Ga0207656_10015257
696 Ga0207656_10110937
697 Ga0207682_10290812
698 Ga0207642_10037808
699 Ga0207680_10114120
700 Ga0207647_10000959
701 Ga0207647_10025888
702 Ga0207699_10297225
703 Ga0207705_10000880
704 Ga0207705_10012214
705 Ga0207705_10084016
706 Ga0207705_10140323
707 Ga0207705_10185199
708 Ga0207705_10410404
709 Ga0207654_10136848
710 Ga0207707_10000020
711 Ga0207707_10000191
712 Ga0207707_10000825
713 Ga0207707_10006645
714 Ga0207707_10007901
715 Ga0207707_11035102
716 Ga0207695_10002326
717 Ga0207695_10006631
718 Ga0207695_10139417
719 Ga0207671_10533626
720 Ga0207660_10003575
721 Ga0207660_10008572
722 Ga0207660_10445357
723 Ga0207660_10736813
724 Ga0207657_10008506
725 Ga0207657_10008627
726 Ga0207657_10056375
727 Ga0207657_10104347
728 Ga0207649_10003408
729 Ga0207649_10018940
730 Ga0207649_10819424
731 Ga0207649_11123631
732 Ga0207652_10002578
733 Ga0207652_10008414
734 Ga0207652_10011302
735 Ga0207652_10059065
736 Ga0207681_10091289
737 Ga0207694_10139694
738 Ga0207650_10006057
739 Ga0207659_10004591
740 Ga0207700_10005288
741 Ga0207664_10340738
742 Ga0207644_10009466
743 Ga0207690_10011084
744 Ga0207690_10042844
745 Ga0207686_10514670
746 Ga0207669_10366447
747 Ga0207704_10116301
748 Ga0207691_10000530
749 Ga0207711_10063080
750 Ga0207711_10457722
751 Ga0207661_10000573
752 Ga0207661_10008249
753 Ga0207661_10014749
754 Ga0207679_10001697
755 Ga0207679_10085149
756 Ga0207667_10003891
757 Ga0207667_10005472
758 Ga0207667_10014771
759 Ga0207667_11042089
760 Ga0207651_10073067
761 Ga0207668_10001055
762 Ga0207668_10040638
763 Ga0207668_10090382
764 Ga0207640_10000741
765 Ga0207640_10014609
766 Ga0207640_10062925
767 Ga0207640_10087969
768 Ga0207640_10108664
769 Ga0207677_10002691
770 Ga0207703_11110045
771 Ga0207639_10128322
772 Ga0207678_10006449
773 Ga0207678_10025405
774 Ga0207678_10147846
775 Ga0207702_10001189
776 Ga0207702_10102835
777 Ga0207702_10402548
778 Ga0207641_10033066
779 Ga0207641_10084767
780 Ga0207676_10003045
781 Ga0207676_10296592
782 Ga0207674_10011086
783 Ga0207674_10013850
784 Ga0207683_10001233
785 Ga0207698_10000632
786 Ga0207698_10038156
787 Ga0207698_10041097
788 Ga0207698_10701232
789 Ga0209371_1000018
790 Ga0268266_10069270
791 Ga0268266_11819904
792 Ga0268256_1000016
793 Ga0307516_10088353
794 Ga0307405_10038131
795 Ga0307412_10000871
796 Ga0307412_10251930
797 Ga0307416_100683971
798 Ga0307414_10036984
799 Ga0307414_11157145
800 Ga0307411_10363018
801 Ga0316574_0508200
802 Ga0395899_0037307
803 Ga0395899_0182163
804 Ga0395900_0030379
805 Ga0395898_0022315
806 Ga0395898_0044697
807 Ga0395898_0259058
808 Ga0395905_1529694
809 Ga0395901_0162602
810 Ga0395901_0289435
811 Ga0237819_12743
812 Ga0439436_0019541
813 Ga0439436_0027121
814 Ga0439436_0119051
815 Ga0439439_0016664
816 Ga0439466_0169549
817 Ga0439465_0001175
818 Ga0451807_1395036
819 Ga0451837_1128287
820 Ga0451837_1766088
821 Ga0451849_0530073
822 Ga0451843_0149717
823 Ga0451855_1470718
824 Ga0439445_0042212
825 Ga0439445_0072139
826 Ga0439432_008628
827 Ga0439432_028625
828 Ga0439449_0037279
829 Ga0439449_0054416
830 Ga0439457_054010
831 Ga0450911_000323
832 Ga0451577_0744441
833 Ga0466959_0072920
834 Ga0495638_0015487
835 Ga0495638_0670713
836 Ga0495605_0079992
837 Ga0495583_0018125
838 Ga0495616_0000127
839 Ga0495632_0001000
840 Ga0495643_0001020
841 Ga0495663_0012352
842 Ga0495633_0000792
843 Ga0495633_0001337
844 Ga0495656_0001608
845 Ga0495656_0525918
846 Ga0495625_0137343
847 Ga0495659_0026671
848 Ga0495660_0047242
849 Ga0495636_0002607
850 Ga0495636_0070025
851 Ga0495636_0131980
852 Ga0495636_0140457
853 Ga0495685_227499
854 Ga0495686_0006682
855 Ga0496104_0783391
856 Ga0496116_0002271
857 Ga0496116_0163856
858 Ga0496117_0000041
859 Ga0496117_0001679
860 Ga0496117_0010461
861 Ga0496117_0078801
862 Ga0496118_0001516
863 Ga0496118_0001806
864 Ga0496118_0021408
865 Ga0496119_0144688
866 Ga0496122_0039441
867 Ga0496122_0046492
868 Ga0496123_0020103
869 Ga0496123_0034837
870 Ga0496123_0163925
871 Ga0496124_0002738
872 Ga0496124_0015008
873 Ga0496124_0088791
874 Ga0496125_0072887
875 Ga0496125_0161017
876 Ga0496126_0298330
877 Ga0501032_0009554
878 Ga0501032_0276739
879 Ga0501033_0003317
880 Ga0501033_0313203
881 Ga0501033_0766957
882 Ga0501034_0010062
883 Ga0501034_0011973
884 Ga0501034_0045979
885 Ga0501034_0319060
886 Ga0501034_0381564
887 Ga0501036_0050634
888 Ga0501036_0220973
889 Ga0501036_0300820
890 Ga0501037_0016862
891 Ga0501037_0108644
892 Ga0501037_0298977
893 Ga0501038_0009799
894 Ga0501038_0121775
895 Ga0501043_0016335
896 Ga0501043_0067591
897 Ga0501043_0126198
898 Ga0501046_0221397
899 Ga0501047_0006728
900 Ga0501047_0007451
901 Ga0501047_0024505
902 Ga0501047_0032235
903 Ga0501067_0000133
904 Ga0501068_0007092
905 Ga0501069_0002946
906 Ga0501069_0014979
907 Ga0501069_0151627
908 Ga0501070_0000067
909 Ga0501070_0001471
910 Ga0501070_0007327
911 Ga0501070_0016884
912 Ga0501070_0027166
913 Ga0501070_0175687
914 Ga0501071_0199281
915 Ga0501071_0322042
916 Ga0501072_0000442
917 Ga0501073_0000107
918 Ga0501073_0006423
919 Ga0501073_0028738
920 Ga0501073_0406650
921 Ga0501074_0002669
922 Ga0501074_0041061
923 Ga0501074_0050296
924 Ga0501079_0026314
925 Ga0501079_0135897
926 Ga0501079_1087966
927 Ga0501080_0007243
928 Ga0501080_0016215
929 Ga0501080_0131579
930 Ga0501083_0343107
931 Ga0501035_0008493
932 Ga0501035_0024982
933 Ga0501035_0025508
934 Ga0501035_0464962
935 Ga0501035_0539467
936 Ga0501044_0018036
937 Ga0501044_0029514
938 Ga0501044_0039149
939 Ga0501044_0097012
940 Ga0501044_0443366
941 Ga0501044_0514903
942 nmdc:mga00v17_468213_c1
943 nmdc:mga00v17_77754_c1
944 nmdc:mga0yw44_307878_c1
945 Ga0500616_0010859
946 Ga0501084_0032683
947 Ga0501082_0060950
948 2572255839
949 2643816823
950 2643881110
951 2643939241
952 2644077919
953 2644661880
954 2644696220
955 2644700021
956 2842698757
957 2842760764
958 2846035005
959 2846040683
960 2874223409
961 2894416549
962 2919092172
963 2919516820
964 2919676486
965 2928497208
966 2931383177
967 2937614110
968 2939590043
969 2939630420
970 2961050173
971 2974307357
972 2977248103
973 2984517440
974 8003017455

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01220

DHquinase_II

Dehydroquinase class II

20

158

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4l8l-assembly1.cif.gz_A crystal structure of the type ii dehydroquinase from pseudomonas aeruginosa 0.9824 1 143
6hsb-assembly1.cif.gz_A the crystal structure of type ii dehydroquinase from acidithiobacillus caldus sm-1 0.976 2 142
1uqr-assembly1.cif.gz_I type ii 3-dehydroquinate dehydratase (dhqase) from actinobacillus pleuropneumoniae 0.9757 1 146
1uqr-assembly1.cif.gz_E type ii 3-dehydroquinate dehydratase (dhqase) from actinobacillus pleuropneumoniae 0.975 1 146
1uqr-assembly1.cif.gz_L type ii 3-dehydroquinate dehydratase (dhqase) from actinobacillus pleuropneumoniae 0.9731 1 146
ID Description Score Start End Superfamily
3kipN00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Dehydroquinase, class II 0.9533 1 141 3.40.50.9100
4kiuM00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Dehydroquinase, class II 0.9326 3 141 3.40.50.9100
1d0iH00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Dehydroquinase, class II 0.9308 2 146 3.40.50.9100
2c57B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Dehydroquinase, class II 0.9274 3 145 3.40.50.9100
3kipN00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Dehydroquinase, class II 0.9209 1 141 3.40.50.9100
ID Description Score Start End GO Terms
AF-A0A2E9R9R0-F1-model_v4 3-dehydroquinate dehydratase (3-dehydroquinase) (EC 4.2.1.10) (Type II DHQase) 0.9992 1 145 GO:0003855
GO:0008652
GO:0009073
GO:0009423
GO:0019631
AF-A0A2E0MY48-F1-model_v4 3-dehydroquinate dehydratase (EC 4.2.1.10) 0.9991 1 88 GO:0003855
GO:0009423
GO:0019631
AF-A0A1A6C505-F1-model_v4 3-dehydroquinate dehydratase (3-dehydroquinase) (EC 4.2.1.10) (Type II DHQase) 0.9984 1 143 GO:0003855
GO:0008652
GO:0009073
GO:0009423
GO:0019631
AF-A0A3M0Z885-F1-model_v4 3-dehydroquinate dehydratase (3-dehydroquinase) (EC 4.2.1.10) (Type II DHQase) 0.9983 1 145 GO:0003855
GO:0008652
GO:0009073
GO:0009423
GO:0019631
AF-A0A0R2Z0J1-F1-model_v4 deleted 0.9982 1 145

Map