F453399

General Info

Members Datasets Scaffolds Average Seq Length
487 301 974 169

Family's Representative Sequence

Representative Sequence 3300005331|Ga0070670_100259805|Ga0070670_1002598051
Length 198
Sequence MASEGPLEYPPSPQAPAAVALHQEPGMASTQDARNDRPPLVGIVMGSRSDWETMQHAAQKLEALGVPHEVRIVSAHRTPDVLFDYAATAESRGLRAIIAGAGGAAHLPGMLAAKTAVPVLGVPVQSKALNGMDSLLSIVQMPAGIPVATFAIGNAGASNAALFAAALLAPYDSAIAEALAAFRQRQTDDVAKNDDPRK

Samples

Sample ID Description Type Environment
1 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
4 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
5 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
8 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
9 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
10 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
11 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
12 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
13 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
14 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
15 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
16 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
17 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
18 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
43 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
44 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
45 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
46 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
47 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
48 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
49 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
50 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
51 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
54 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
55 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
62 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300012482 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 Metagenome Rhizosphere
65 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
66 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
67 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
68 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
69 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
75 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
78 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
79 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
80 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
81 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
82 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
83 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
84 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
85 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
86 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
87 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
89 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
90 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
91 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
93 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
129 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
130 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
131 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
132 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
133 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
134 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
135 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
136 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
137 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
138 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
139 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
140 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
141 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
142 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
143 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
144 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
145 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
146 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
147 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
148 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
149 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
150 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
151 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
152 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
153 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
154 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
155 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
156 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
157 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
158 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
159 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
160 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
161 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
162 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
163 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
164 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
165 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
166 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
167 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
168 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
169 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
170 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
171 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
172 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
173 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
174 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
175 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
176 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
177 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
178 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
179 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
180 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
181 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
182 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
183 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
184 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
185 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
186 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
187 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
188 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
189 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
190 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
191 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
192 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
193 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
194 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
195 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
196 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
197 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
198 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
199 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
200 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
201 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
202 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
203 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
204 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
205 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
206 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
207 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
208 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
209 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
210 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
211 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
212 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
213 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
214 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
215 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
216 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
217 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
218 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
219 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
220 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
221 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
222 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
223 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
224 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
225 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
226 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
227 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
228 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
229 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
237 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
238 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
239 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
240 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
241 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
242 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
243 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
244 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
247 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
248 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
249 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
250 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
251 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
252 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
253 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
254 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
255 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
256 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
257 2547132130 Stenotrophomonas maltophilia RR-10 Isolate Unclassified
258 2571042365 Lysobacter oryzae DSM 21044 Isolate Rhizosphere
259 2576861471 Stenotrophomonas rhizophila DSM 14405 Isolate Rhizosphere
260 2643221559 Lysobacter sp. Root559 Isolate Unclassified
261 2643221573 Lysobacter sp. Root604 Isolate Unclassified
262 2643221586 Lysobacter sp. Root667 Isolate Unclassified
263 2643221593 Lysobacter sp. Root690 Isolate Unclassified
264 2643221612 Lysobacter sp. Root76 Isolate Unclassified
265 2643221695 Lysobacter sp. Root494 Isolate Unclassified
266 2643221720 Lysobacter sp. Root916 Isolate Unclassified
267 2643221727 Lysobacter sp. Root96 Isolate Unclassified
268 2643221728 Lysobacter sp. Root983 Isolate Unclassified
269 2747842428 Stenotrophomonas sp. WCS2014-113 Isolate Unclassified
270 2747842501 Xanthomonas sp. WCS2014-23 Isolate Unclassified
271 2765235840 Stenotrophomonas maltophilia AA1 Isolate Unclassified
272 2816332141 Stenotrophomonas muris 1190 (v2) (version 2) Isolate Unclassified
273 2818991457 Xanthomonas translucens 569 Isolate Unclassified
274 2842391507 Stenotrophomonas maltophilia SEMIA 4027 Isolate Nodule
275 2842780639 Pseudoxanthomonas sp. R-71986 Isolate Unclassified
276 2852649853 Stenotrophomonas sp. JAI102 Isolate Rhizosphere
277 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
278 2874220319 Stenotrophomonas maltophilia PS5 Isolate Unclassified
279 2919089067 Stenotrophomonas sp. 1337 Isolate Rhizosphere
280 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
281 2919134579 Stenotrophomonas geniculata 1733 Isolate Rhizosphere
282 2928496128 Stenotrophomonas indicatrix 1163 Isolate Unclassified
283 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
284 2931380184 Stenotrophomonas sp. DR822 Isolate Rhizosphere
285 2937610967 Stenotrophomonas maltophilia EP20 Isolate Unclassified
286 2939589442 Stenotrophomonas rhizophila 716 Isolate Rhizosphere
287 2939622612 Stenotrophomonas sp. 2619 Isolate Rhizosphere
288 2939626828 Stenotrophomonas sp. 2694 Isolate Rhizosphere
289 2941475908 Stenotrophomonas rhizophila 2680 Isolate Rhizosphere
290 2941489479 Lysobacter enzymogenes 2943 Isolate Rhizosphere
291 2961047084 Stenotrophomonas maltophilia EP5 Isolate Unclassified
292 2961064222 Stenotrophomonas maltophilia EP13 Isolate Unclassified
293 2974307012 Stenotrophomonas sp. SORGH_AS_0282 Isolate Unclassified
294 2977247770 Stenotrophomonas rhizophila SORGH_AS 457 Isolate Unclassified
295 2984514374 Stenotrophomonas sp. SORGH_AS282 Isolate Aerial Root
296 2987605356 Stenotrophomonas sp. ATCM1_4 Isolate Unclassified
297 2995948881 Lysobacter enzymogenes B25 Isolate Unclassified
298 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere
299 8021622325 Xanthomonas sp. LMG12462 Isolate Rhizosphere
300 8021626552 Xanthomonas sp. LMG12460 Isolate Rhizosphere
301 8021648035 Xanthomonas sp. LMG 12461 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.76
Metatranscriptomes 0
Isolates 9.24

Biome Distribution

Category Percentage (%)
Aerial Root 0.21
Bulb 0
Endosphere 18.48
Nodule 0.21
Rhizoplane 3.9
Rhizosphere 63.24
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070670_100259805 3300005331 Bacteria 1514
2 SwRhRL2b_contig_2802288 2162886007 Bacteria 1523
3 JGI25152J39213_1000106 3300002773 Bacteria 58139
4 JGI25150J39212_1000127 3300002774 Bacteria 42935
5 JGI25151J46595_10000196 3300003187 Bacteria 74530
6 JGI25151J46595_10000363 3300003187 Bacteria 47709
7 JGI25153J46596_10000089 3300003215 Bacteria 106651
8 Ga0055526_1001472 3300003771 Bacteria 16701
9 Ga0055526_1007545 3300003771 Bacteria 5624
10 Ga0055526_1023493 3300003771 Bacteria 2055
11 Ga0055526_1033820 3300003771 Bacteria 1410
12 Ga0055537_1000401 3300003773 Bacteria 28940
13 Ga0055537_1001051 3300003773 Bacteria 12381
14 Ga0055524_1000447 3300003775 Bacteria 34134
15 Ga0055524_1012430 3300003775 Bacteria 3268
16 Ga0055524_1017363 3300003775 Bacteria 2541
17 Ga0055536_1002133 3300003781 Bacteria 11260
18 Ga0055536_1004205 3300003781 Bacteria 7435
19 Ga0055536_1008695 3300003781 Bacteria 4316
20 Ga0055536_1009947 3300003781 Bacteria 3851
21 Ga0055536_1016869 3300003781 Bacteria 2418
22 Ga0055534_1000003 3300003784 Bacteria 300063
23 Ga0055534_1000155 3300003784 Bacteria 51103
24 Ga0055534_1000717 3300003784 Bacteria 16215
25 Ga0055528_1000004 3300003790 Bacteria 285772
26 Ga0055528_1004159 3300003790 Bacteria 7043
27 Ga0055530_10001056 3300003791 Bacteria 21844
28 Ga0055530_10003046 3300003791 Bacteria 10003
29 Ga0055531_10013086 3300003794 Bacteria 3851
30 Ga0055531_10024173 3300003794 Bacteria 2251
31 Ga0055531_10039620 3300003794 Bacteria 1396
32 Ga0055531_10073677 3300003794 Bacteria 777
33 Ga0058692_1000002 3300003856 Bacteria 508401
34 Ga0058692_1000018 3300003856 Bacteria 264544
35 Ga0065704_10071976 3300005289 Bacteria 9473
36 Ga0070658_10414199 3300005327 Bacteria 1158
37 Ga0070658_11355809 3300005327 Bacteria 617
38 Ga0070676_10153594 3300005328 Bacteria 1476
39 Ga0070660_100072787 3300005339 Bacteria 2686
40 Ga0070668_100025792 3300005347 Bacteria 4459
41 Ga0070668_100206437 3300005347 Bacteria 1614
42 Ga0070669_100019164 3300005353 Bacteria 4889
43 Ga0070669_100876586 3300005353 Bacteria 766
44 Ga0070671_100175434 3300005355 Bacteria 1813
45 Ga0070659_100398869 3300005366 Bacteria 1161
46 Ga0070713_100113761 3300005436 Bacteria 2363
47 Ga0070694_100264798 3300005444 Bacteria 1305
48 Ga0070678_100177118 3300005456 Bacteria 1742
49 Ga0070662_100297967 3300005457 Bacteria 1309
50 Ga0070681_10484442 3300005458 Bacteria 1150
51 Ga0070706_100258081 3300005467 Bacteria 1627
52 Ga0070679_100042128 3300005530 Bacteria 4546
53 Ga0070679_100157453 3300005530 Bacteria 2246
54 Ga0070679_100191553 3300005530 Bacteria 2013
55 Ga0068853_100121906 3300005539 Bacteria 2326
56 Ga0070672_100013221 3300005543 Bacteria 5823
57 Ga0070665_100181235 3300005548 Bacteria 2107
58 Ga0070665_100349213 3300005548 Bacteria 1484
59 Ga0070665_100633773 3300005548 Bacteria 1082
60 Ga0070665_101537629 3300005548 Bacteria 674
61 Ga0068855_100780131 3300005563 Bacteria 1017
62 Ga0070664_100247463 3300005564 Bacteria 1602
63 Ga0070664_100346254 3300005564 Bacteria 1351
64 Ga0068852_100021581 3300005616 Bacteria 5146
65 Ga0068852_100078963 3300005616 Bacteria 2913
66 Ga0068859_101253635 3300005617 Bacteria 817
67 Ga0068864_100005870 3300005618 Bacteria 10060
68 Ga0068864_100269358 3300005618 Bacteria 1586
69 Ga0068863_100080207 3300005841 Bacteria 3091
70 Ga0068860_100023574 3300005843 Bacteria 5948
71 Ga0068860_100068292 3300005843 Bacteria 3377
72 Ga0068862_100370079 3300005844 Bacteria 1334
73 Ga0081539_10020508 3300005985 Bacteria 4463
74 Ga0075365_10126458 3300006038 Bacteria 1766
75 Ga0075364_10002393 3300006051 Bacteria 10519
76 Ga0075364_10059108 3300006051 Bacteria 2513
77 Ga0075364_10174462 3300006051 Bacteria 1454
78 Ga0075364_10211754 3300006051 Bacteria 1314
79 Ga0075364_10442948 3300006051 Bacteria 887
80 Ga0070716_100049287 3300006173 Bacteria 2385
81 Ga0070716_100251608 3300006173 Bacteria 1204
82 Ga0075367_10122644 3300006178 Bacteria 1602
83 Ga0075369_10213677 3300006186 Bacteria 892
84 Ga0075433_10012239 3300006852 Bacteria 6918
85 Ga0075434_100049122 3300006871 Bacteria 4188
86 Ga0068865_100191176 3300006881 Bacteria 1583
87 Ga0075436_100001504 3300006914 Bacteria 15905
88 Ga0097620_101253676 3300006931 Bacteria 817
89 Ga0075435_100020597 3300007076 Bacteria 5058
90 Ga0105251_10000473 3300009011 Bacteria 38223
91 Ga0105251_10030266 3300009011 Bacteria 2720
92 Ga0105244_10026759 3300009036 Bacteria 3118
93 Ga0105240_11092957 3300009093 Bacteria 849
94 Ga0111539_10115362 3300009094 Bacteria 3150
95 Ga0105243_10843292 3300009148 Bacteria 907
96 Ga0105241_10432975 3300009174 Bacteria 1160
97 Ga0105249_10055264 3300009553 Bacteria 3631
98 Ga0105148_103727 3300009978 Bacteria 1083
99 Ga0105032_103938 3300009979 Bacteria 1277
100 Ga0105239_10517062 3300010375 Bacteria 1358
101 Ga0157318_1002580 3300012482 Bacteria 998
102 Ga0157342_1018815 3300012507 Bacteria 786
103 Ga0157315_1006611 3300012508 Bacteria 913
104 Ga0157327_1011430 3300012512 Bacteria 857
105 Ga0157373_10059188 3300013100 Bacteria 2714
106 Ga0157373_10097327 3300013100 Bacteria 2071
107 Ga0157373_10529090 3300013100 Bacteria 853
108 Ga0157371_10000314 3300013102 Bacteria 63006
109 Ga0157371_10038774 3300013102 Bacteria 3408
110 Ga0157371_10719111 3300013102 Bacteria 748
111 Ga0157369_10181102 3300013105 Bacteria 2217
112 Ga0157378_10001533 3300013297 Bacteria 20885
113 Ga0157372_10292764 3300013307 Bacteria 1893
114 Ga0157372_12148324 3300013307 Bacteria 641
115 Ga0163163_10025833 3300014325 Bacteria 5603
116 Ga0157380_10294417 3300014326 Bacteria 1492
117 Ga0157380_10640883 3300014326 Bacteria 1058
118 Ga0182008_10000269 3300014497 Bacteria 40734
119 Ga0182008_10144032 3300014497 Bacteria 1193
120 Ga0157379_10012683 3300014968 Bacteria 7366
121 Ga0182006_1013353 3300015261 Bacteria 3566
122 Ga0182005_1000168 3300015265 Bacteria 45063
123 Ga0183360_10001 3300015689 Bacteria 3943671
124 Ga0163161_10200157 3300017792 Bacteria 1539
125 Ga0207425_1000030 3300025245 Bacteria 268200
126 Ga0209129_1000063 3300025258 Bacteria 240205
127 Ga0209565_1000001 3300025263 Bacteria 2950419
128 Ga0209565_1000014 3300025263 Bacteria 530302
129 Ga0209673_1000001 3300025273 Bacteria 3176258
130 Ga0209673_1000570 3300025273 Bacteria 58750
131 Ga0209673_1012309 3300025273 Bacteria 3454
132 Ga0209130_1004885 3300025284 Bacteria 4880
133 Ga0209675_1000001 3300025291 Bacteria 2950293
134 Ga0209675_1000021 3300025291 Bacteria 334833
135 Ga0209676_1000027 3300025292 Bacteria 560222
136 Ga0209676_1000047 3300025292 Bacteria 408645
137 Ga0209676_1000079 3300025292 Bacteria 290447
138 Ga0209676_1004494 3300025292 Bacteria 7748
139 Ga0209676_1006710 3300025292 Bacteria 5605
140 Ga0209676_1024017 3300025292 Bacteria 1983
141 Ga0209676_1024390 3300025292 Bacteria 1960
142 Ga0209025_1000013 3300025294 Bacteria 871757
143 Ga0209025_1000102 3300025294 Bacteria 228393
144 Ga0209025_1008994 3300025294 Bacteria 7056
145 Ga0209025_1024990 3300025294 Bacteria 3059
146 Ga0209025_1034946 3300025294 Bacteria 2281
147 Ga0209564_1000001 3300025295 Bacteria 3176258
148 Ga0209564_1000263 3300025295 Bacteria 112148
149 Ga0209564_1020630 3300025295 Bacteria 2405
150 Ga0209758_1000014 3300025297 Bacteria 871757
151 Ga0209758_1006900 3300025297 Bacteria 7930
152 Ga0209758_1061319 3300025297 Bacteria 1240
153 Ga0209758_1065882 3300025297 Bacteria 1167
154 Ga0209050_1000153 3300025298 Bacteria 160851
155 Ga0209050_1000311 3300025298 Bacteria 98948
156 Ga0209050_1001466 3300025298 Bacteria 25237
157 Ga0209050_1009954 3300025298 Bacteria 4768
158 Ga0209050_1025263 3300025298 Bacteria 2025
159 Ga0209256_1000002 3300025299 Bacteria 1906740
160 Ga0209256_1003979 3300025299 Bacteria 9703
161 Ga0209256_1009438 3300025299 Bacteria 4279
162 Ga0209256_1010213 3300025299 Bacteria 3966
163 Ga0209256_1024944 3300025299 Bacteria 1751
164 Ga0209051_1005263 3300025303 Bacteria 7622
165 Ga0209051_1009855 3300025303 Bacteria 4886
166 Ga0209257_1000081 3300025304 Bacteria 306577
167 Ga0209257_1002586 3300025304 Bacteria 17596
168 Ga0209257_1010696 3300025304 Bacteria 4584
169 Ga0209257_1011801 3300025304 Bacteria 4144
170 Ga0209257_1011826 3300025304 Bacteria 4133
171 Ga0207713_1000534 3300025735 Bacteria 38233
172 Ga0207713_1025593 3300025735 Bacteria 2720
173 Ga0207705_10493067 3300025909 Bacteria 951
174 Ga0207684_10658814 3300025910 Bacteria 892
175 Ga0207695_10277106 3300025913 Bacteria 1571
176 Ga0207695_10555419 3300025913 Bacteria 1030
177 Ga0207695_10760075 3300025913 Bacteria 849
178 Ga0207660_10010000 3300025917 Bacteria 6145
179 Ga0207657_10022384 3300025919 Bacteria 5914
180 Ga0207652_10127937 3300025921 Bacteria 2264
181 Ga0207652_10326455 3300025921 Bacteria 1385
182 Ga0207681_10022404 3300025923 Bacteria 4029
183 Ga0207681_10077882 3300025923 Bacteria 2332
184 Ga0207650_10473453 3300025925 Bacteria 1044
185 Ga0207700_10188062 3300025928 Bacteria 1734
186 Ga0207644_10149441 3300025931 Bacteria 1806
187 Ga0207644_10209279 3300025931 Bacteria 1541
188 Ga0207690_10641485 3300025932 Bacteria 870
189 Ga0207706_10636092 3300025933 Bacteria 915
190 Ga0207709_10007372 3300025935 Bacteria 6128
191 Ga0207709_10267166 3300025935 Bacteria 1257
192 Ga0207669_10924892 3300025937 Bacteria 730
193 Ga0207665_10113277 3300025939 Bacteria 1908
194 Ga0207665_10278122 3300025939 Bacteria 1245
195 Ga0207691_10013383 3300025940 Bacteria 7855
196 Ga0207711_10402555 3300025941 Bacteria 1272
197 Ga0207679_10461748 3300025945 Bacteria 1128
198 Ga0207679_10767520 3300025945 Bacteria 878
199 Ga0207667_11334563 3300025949 Bacteria 693
200 Ga0207712_10199376 3300025961 Bacteria 1586
201 Ga0207668_10414051 3300025972 Bacteria 1142
202 Ga0207677_10123975 3300026023 Bacteria 1949
203 Ga0207639_10014456 3300026041 Bacteria 5554
204 Ga0207639_11128836 3300026041 Bacteria 735
205 Ga0207641_10019365 3300026088 Bacteria 5585
206 Ga0207641_10292845 3300026088 Bacteria 1535
207 Ga0207676_10011821 3300026095 Bacteria 6245
208 Ga0207676_10159790 3300026095 Bacteria 1951
209 Ga0207675_100516247 3300026118 Bacteria 1191
210 Ga0207675_101056086 3300026118 Bacteria 831
211 Ga0207683_10106007 3300026121 Bacteria 2513
212 Ga0207698_10005789 3300026142 Bacteria 7671
213 Ga0207698_10058158 3300026142 Bacteria 2995
214 Ga0209371_1000004 3300027312 Bacteria 1098197
215 Ga0209371_1000011 3300027312 Bacteria 848456
216 Ga0209967_1002702 3300027364 Bacteria 2309
217 Ga0268266_10255621 3300028379 Bacteria 1622
218 Ga0268266_10468910 3300028379 Bacteria 1199
219 Ga0268264_10010146 3300028381 Bacteria 7795
220 Ga0268264_10064001 3300028381 Bacteria 3094
221 Ga0265323_10000121 3300028653 Bacteria 44525
222 Ga0265323_10030064 3300028653 Bacteria 2026
223 Ga0265322_10000456 3300028654 Bacteria 16379
224 Ga0307515_10152575 3300028794 Bacteria 2406
225 Ga0307515_10276719 3300028794 Bacteria 1391
226 Ga0268256_1000005 3300030500 Bacteria 1082342
227 Ga0268256_1000011 3300030500 Bacteria 848625
228 Ga0316176_1115957 3300030732 Bacteria 1523
229 Ga0314311_1239643 3300030733 Bacteria 3558
230 Ga0316180_1116347 3300030736 Bacteria 1263
231 Ga0316183_1125611 3300030742 Bacteria 7258
232 Ga0316181_1108000 3300030744 Bacteria 2662
233 Ga0265330_10029242 3300031235 Bacteria 2479
234 Ga0265331_10216339 3300031250 Bacteria 862
235 Ga0265327_10073316 3300031251 Bacteria 1708
236 Ga0265316_10078372 3300031344 Bacteria 2536
237 Ga0265316_10422253 3300031344 Bacteria 958
238 Ga0265316_10430979 3300031344 Bacteria 947
239 Ga0265316_10736594 3300031344 Bacteria 693
240 Ga0265316_10892861 3300031344 Bacteria 621
241 Ga0307513_10004594 3300031456 Bacteria 18392
242 Ga0307408_100064306 3300031548 Bacteria 2686
243 Ga0307408_100334748 3300031548 Bacteria 1279
244 Ga0307408_100444470 3300031548 Bacteria 1123
245 Ga0307516_10096882 3300031730 Bacteria 2770
246 Ga0307405_10055034 3300031731 Bacteria 2488
247 Ga0307405_10261489 3300031731 Bacteria 1293
248 Ga0307413_10019405 3300031824 Bacteria 3592
249 Ga0307413_10041607 3300031824 Bacteria 2692
250 Ga0307410_10575440 3300031852 Bacteria 936
251 Ga0307410_10834816 3300031852 Bacteria 786
252 Ga0307406_10004519 3300031901 Bacteria 7579
253 Ga0307406_10123422 3300031901 Bacteria 1805
254 Ga0307406_10263437 3300031901 Bacteria 1305
255 Ga0307406_10294936 3300031901 Bacteria 1243
256 Ga0307406_10400995 3300031901 Bacteria 1087
257 Ga0307406_10474472 3300031901 Bacteria 1009
258 Ga0307407_10035356 3300031903 Bacteria 2744
259 Ga0307407_10093927 3300031903 Bacteria 1845
260 Ga0307412_10293620 3300031911 Bacteria 1281
261 Ga0307412_10422005 3300031911 Bacteria 1091
262 Ga0307412_10438464 3300031911 Bacteria 1073
263 Ga0307412_10500129 3300031911 Bacteria 1012
264 Ga0307412_10753052 3300031911 Bacteria 841
265 Ga0307409_100925666 3300031995 Bacteria 886
266 Ga0307416_100212493 3300032002 Bacteria 1847
267 Ga0307414_10001542 3300032004 Bacteria 11978
268 Ga0307414_10005468 3300032004 Bacteria 6999
269 Ga0307414_10033993 3300032004 Bacteria 3375
270 Ga0307414_10036259 3300032004 Bacteria 3291
271 Ga0307414_10064172 3300032004 Bacteria 2613
272 Ga0307414_10085480 3300032004 Bacteria 2324
273 Ga0307414_10241179 3300032004 Bacteria 1496
274 Ga0307414_10311926 3300032004 Bacteria 1335
275 Ga0307414_10466296 3300032004 Bacteria 1111
276 Ga0307414_10673319 3300032004 Bacteria 934
277 Ga0307414_10685416 3300032004 Bacteria 926
278 Ga0307411_10003100 3300032005 Bacteria 7607
279 Ga0307411_10384323 3300032005 Bacteria 1155
280 Ga0307415_100287281 3300032126 Bacteria 1356
281 Ga0373941_0000601 3300035115 Bacteria 7284
282 Ga0373927_0050836 3300035695 Bacteria 2681
283 Ga0395900_0099624 3300037418 Bacteria 2985
284 Ga0395900_0139802 3300037418 Bacteria 2480
285 Ga0395898_1288895 3300037466 Bacteria 660
286 Ga0395905_0000030 3300037471 Bacteria 289430
287 Ga0395905_0044110 3300037471 Bacteria 4184
288 Ga0395905_0931062 3300037471 Bacteria 772
289 Ga0436364_1498783 3300037853 Bacteria 3711
290 Ga0395901_0610461 3300038443 Bacteria 1099
291 Ga0237819_03470 3300038705 Bacteria 2784
292 Ga0439436_0026710 3300041404 Bacteria 1691
293 Ga0439436_0038012 3300041404 Bacteria 1385
294 Ga0439436_0089832 3300041404 Bacteria 855
295 Ga0439465_0001393 3300041413 Bacteria 7807
296 Ga0451791_0009035 3300041451 Bacteria 1607
297 Ga0451797_0896119 3300041453 Bacteria 1775
298 Ga0451795_0013074 3300041456 Bacteria 1195
299 Ga0451837_1091997 3300041494 Bacteria 719
300 Ga0451839_0957326 3300041496 Bacteria 643
301 Ga0451841_0512690 3300041498 Bacteria 858
302 Ga0451841_1233105 3300041498 Bacteria 1412
303 Ga0451843_0084997 3300041509 Bacteria 1359
304 Ga0451843_0483042 3300041509 Bacteria 865
305 Ga0439445_0003339 3300042004 Bacteria 3604
306 Ga0439432_005316 3300042006 Bacteria 4648
307 Ga0439432_028187 3300042006 Bacteria 1830
308 Ga0439432_060972 3300042006 Bacteria 1163
309 Ga0439449_0000083 3300042007 Bacteria 30479
310 Ga0439449_0017319 3300042007 Bacteria 2705
311 Ga0439449_0028158 3300042007 Bacteria 2094
312 Ga0439449_0032348 3300042007 Bacteria 1950
313 Ga0439449_0033606 3300042007 Bacteria 1910
314 Ga0439457_042294 3300042014 Bacteria 1016
315 Ga0439462_0015190 3300042015 Bacteria 1984
316 Ga0439462_0016841 3300042015 Bacteria 1892
317 Ga0439462_0018728 3300042015 Bacteria 1799
318 Ga0451577_0003130 3300042876 Bacteria 18664
319 Ga0451577_0006884 3300042876 Bacteria 11241
320 Ga0451577_0197159 3300042876 Bacteria 1817
321 Ga0451577_1644011 3300042876 Bacteria 566
322 Ga0466972_0000617 3300044658 Bacteria 17384
323 Ga0466965_0000826 3300044683 Bacteria 11707
324 Ga0453684_0001232 3300044712 Bacteria 78122
325 Ga0453684_0031975 3300044712 Bacteria 7378
326 Ga0453684_0093011 3300044712 Bacteria 3715
327 Ga0453684_0260564 3300044712 Bacteria 1986
328 Ga0453684_0533832 3300044712 Bacteria 1294
329 Ga0466968_0008224 3300044735 Bacteria 3990
330 Ga0466960_0067585 3300044901 Bacteria 1770
331 Ga0466959_0024322 3300045049 Bacteria 4486
332 Ga0451576_0741422 3300045051 Bacteria 1032
333 Ga0495627_147497 3300046453 Bacteria 657
334 Ga0495638_0007840 3300046460 Bacteria 7621
335 Ga0495605_0044396 3300046474 Bacteria 2198
336 Ga0495607_0095658 3300046501 Bacteria 1600
337 Ga0495606_0024532 3300046507 Bacteria 4342
338 Ga0495610_0001232 3300046512 Bacteria 22998
339 Ga0495632_0118344 3300046519 Bacteria 1239
340 Ga0495643_0000925 3300046522 Bacteria 30684
341 Ga0495663_0003675 3300046525 Bacteria 4392
342 Ga0495663_0096329 3300046525 Bacteria 970
343 Ga0495663_0099187 3300046525 Bacteria 957
344 Ga0495633_0004179 3300046558 Bacteria 9270
345 Ga0495633_0004483 3300046558 Bacteria 8859
346 Ga0495656_0007956 3300046615 Bacteria 3769
347 Ga0495656_0009357 3300046615 Bacteria 3521
348 Ga0495668_0019371 3300046616 Bacteria 3924
349 Ga0495659_0015053 3300046664 Bacteria 2539
350 Ga0495661_0251393 3300046665 Bacteria 902
351 Ga0495588_0226644 3300046674 Bacteria 986
352 Ga0495670_0057630 3300046691 Bacteria 1950
353 Ga0495671_0040666 3300046692 Bacteria 2344
354 Ga0495636_0003821 3300047318 Bacteria 5867
355 Ga0495636_0049139 3300047318 Bacteria 1763
356 Ga0495636_0109406 3300047318 Bacteria 1215
357 Ga0495672_0000134 3300047320 Bacteria 110142
358 Ga0495685_005048 3300047447 Bacteria 4296
359 Ga0495686_0010849 3300047472 Bacteria 6456
360 Ga0495615_0192383 3300048090 Bacteria 626
361 Ga0496100_0347717 3300048903 Bacteria 1119
362 Ga0496101_0557832 3300048904 Bacteria 906
363 Ga0496102_0287304 3300048905 Bacteria 1550
364 Ga0496105_0052872 3300048908 Bacteria 3355
365 Ga0496107_0210351 3300048910 Bacteria 1446
366 Ga0496108_0184477 3300048911 Bacteria 1807
367 Ga0496108_1465921 3300048911 Bacteria 569
368 Ga0496109_0225324 3300048912 Bacteria 1763
369 Ga0496109_0578170 3300048912 Bacteria 1059
370 Ga0496112_0006646 3300048915 Bacteria 10181
371 Ga0496112_0911622 3300048915 Bacteria 800
372 Ga0496113_0222451 3300048916 Bacteria 1504
373 Ga0496113_0276122 3300048916 Bacteria 1343
374 Ga0496114_0005495 3300048917 Bacteria 9922
375 Ga0496114_0052341 3300048917 Bacteria 3402
376 Ga0496114_0859544 3300048917 Bacteria 787
377 Ga0496116_0039960 3300048919 Bacteria 3235
378 Ga0496116_0290121 3300048919 Bacteria 786
379 Ga0496117_0002078 3300048920 Bacteria 26449
380 Ga0496117_0021211 3300048920 Bacteria 5265
381 Ga0496117_0026488 3300048920 Bacteria 4537
382 Ga0496118_0000145 3300048921 Bacteria 123886
383 Ga0496118_0000573 3300048921 Bacteria 60932
384 Ga0496118_0010191 3300048921 Bacteria 9333
385 Ga0496118_0097096 3300048921 Bacteria 2006
386 Ga0496119_0000211 3300048922 Bacteria 83064
387 Ga0496119_0009334 3300048922 Bacteria 8438
388 Ga0496120_0000525 3300048923 Bacteria 59273
389 Ga0496120_0001043 3300048923 Bacteria 37032
390 Ga0496122_0000220 3300048925 Bacteria 127065
391 Ga0496122_0000976 3300048925 Bacteria 51333
392 Ga0496122_0017868 3300048925 Bacteria 6591
393 Ga0496123_0000151 3300048926 Bacteria 141062
394 Ga0496123_0000359 3300048926 Bacteria 85669
395 Ga0496123_0084991 3300048926 Bacteria 1905
396 Ga0496124_0000018 3300048927 Bacteria 442940
397 Ga0496124_0000255 3300048927 Bacteria 102645
398 Ga0496124_0000437 3300048927 Bacteria 73878
399 Ga0496124_0033787 3300048927 Bacteria 4496
400 Ga0496124_0047915 3300048927 Bacteria 3653
401 Ga0496124_0079473 3300048927 Bacteria 2700
402 Ga0496124_0156921 3300048927 Bacteria 1778
403 Ga0496125_0013202 3300048928 Bacteria 8136
404 Ga0496126_0000806 3300048929 Bacteria 56104
405 Ga0496126_0010633 3300048929 Bacteria 9624
406 Ga0496126_0451160 3300048929 Bacteria 1035
407 Ga0501290_002504 3300049513 Bacteria 2367
408 Ga0501303_014635 3300049526 Bacteria 778
409 Ga0501033_0001911 3300049570 Bacteria 18129
410 Ga0501034_0000571 3300049571 Bacteria 58421
411 Ga0501034_0012086 3300049571 Bacteria 8926
412 Ga0501034_0031589 3300049571 Bacteria 5379
413 Ga0501034_0756117 3300049571 Bacteria 867
414 Ga0501036_0496865 3300049572 Bacteria 1015
415 Ga0501038_0482189 3300049574 Bacteria 950
416 Ga0501043_0014316 3300049579 Bacteria 6207
417 Ga0501043_0049940 3300049579 Bacteria 3289
418 Ga0501046_0385680 3300049580 Bacteria 1013
419 Ga0501047_0006534 3300049581 Bacteria 10975
420 Ga0501202_056384 3300049652 Bacteria 880
421 Ga0501223_023442 3300049663 Bacteria 1204
422 Ga0501257_122864 3300049686 Bacteria 697
423 Ga0501241_048841 3300049758 Bacteria 833
424 Ga0501265_010636 3300049762 Bacteria 1126
425 Ga0501266_017291 3300049763 Bacteria 963
426 Ga0501268_020442 3300049765 Bacteria 1128
427 Ga0501275_000463 3300049772 Bacteria 4563
428 Ga0501035_0000744 3300049822 Bacteria 35093
429 Ga0501044_0000049 3300049823 Bacteria 145043
430 Ga0501044_0304824 3300049823 Bacteria 1521
431 Ga0501045_0933335 3300049824 Bacteria 637
432 nmdc:mga00v17_236530_c1 3300050491 Bacteria 1184
433 nmdc:mga00v17_401_c1 3300050491 Bacteria 24490
434 nmdc:mga05p37_543487_c1 3300050507 Bacteria 1324
435 nmdc:mga0n895_12163_c1 3300050512 Bacteria 7705
436 nmdc:mga0rr50_130865_c1 3300050513 Bacteria 2009
437 nmdc:mga08x19_2257_c1 3300050514 Bacteria 11736
438 nmdc:mga0a205_12466_c1 3300050515 Bacteria 7866
439 Ga0500646_0026450 3300053090 Bacteria 1573
440 Ga0500616_0000642 3300053153 Bacteria 42060
441 Ga0500634_0000083 3300053161 Bacteria 37070
442 Ga0500645_007498 3300053730 Bacteria 3793
443 2547500895 2547132130 Bacteria 4660562
444 2572255397 2571042365 Bacteria 3289345
445 2578458911 2576861471 Bacteria 4648976
446 2643816346 2643221559 Bacteria 4424915
447 2643881531 2643221573 Bacteria 4784121
448 2643938967 2643221586 Bacteria 4446529
449 2643977735 2643221593 Bacteria 6296053
450 2644077290 2643221612 Bacteria 4361984
451 2644529818 2643221695 Bacteria 3441323
452 2644662667 2643221720 Bacteria 4694283
453 2644694400 2643221727 Bacteria 4415595
454 2644698379 2643221728 Bacteria 4797149
455 2747948755 2747842428 Bacteria 4689383
456 2748018252 2747842501 Bacteria 5293829
457 2765578455 2765235840 Bacteria 4663337
458 2816516472 2816332141 Bacteria 4436036
459 2819662802 2818991457 Bacteria 5323295
460 2842392814 2842391507 Bacteria 4486072
461 2842781533 2842780639 Bacteria 4337790
462 2852651262 2852649853 Bacteria 4036942
463 2852686205 2852684882 Bacteria 5463342
464 2874221078 2874220319 Bacteria 4594709
465 2919091288 2919089067 Bacteria 4560942
466 2919132333 2919130084 Bacteria 5301837
467 2919136372 2919134579 Bacteria 4480386
468 2928497920 2928496128 Bacteria 4631123
469 2929197202 2929195423 Bacteria 5325372
470 2931381276 2931380184 Bacteria 4455911
471 2937611900 2937610967 Bacteria 4618818
472 2939590579 2939589442 Bacteria 4214238
473 2939622747 2939622612 Bacteria 4698046
474 2939629632 2939626828 Bacteria 4695272
475 2941477793 2941475908 Bacteria 4145589
476 2941489889 2941489479 Bacteria 6313767
477 2961047843 2961047084 Bacteria 4594415
478 2961067182 2961064222 Bacteria 4749990
479 2974309374 2974307012 Bacteria 4172388
480 2977250094 2977247770 Bacteria 4160543
481 2984515416 2984514374 Bacteria 4172479
482 2987605868 2987605356 Bacteria 4187822
483 2995950577 2995948881 Bacteria 6358104
484 8003016631 8003014200 Bacteria 4059994
485 8021623063 8021622325 Bacteria 4844743
486 8021627303 8021626552 Bacteria 4665214
487 8021649787 8021648035 Bacteria 4772378
488 Ga0070670_100259805
489 SwRhRL2b_contig_2802288
490 JGI25152J39213_1000106
491 JGI25150J39212_1000127
492 JGI25151J46595_10000196
493 JGI25151J46595_10000363
494 JGI25153J46596_10000089
495 Ga0055526_1001472
496 Ga0055526_1007545
497 Ga0055526_1023493
498 Ga0055526_1033820
499 Ga0055537_1000401
500 Ga0055537_1001051
501 Ga0055524_1000447
502 Ga0055524_1012430
503 Ga0055524_1017363
504 Ga0055536_1002133
505 Ga0055536_1004205
506 Ga0055536_1008695
507 Ga0055536_1009947
508 Ga0055536_1016869
509 Ga0055534_1000003
510 Ga0055534_1000155
511 Ga0055534_1000717
512 Ga0055528_1000004
513 Ga0055528_1004159
514 Ga0055530_10001056
515 Ga0055530_10003046
516 Ga0055531_10013086
517 Ga0055531_10024173
518 Ga0055531_10039620
519 Ga0055531_10073677
520 Ga0058692_1000002
521 Ga0058692_1000018
522 Ga0065704_10071976
523 Ga0070658_10414199
524 Ga0070658_11355809
525 Ga0070676_10153594
526 Ga0070660_100072787
527 Ga0070668_100025792
528 Ga0070668_100206437
529 Ga0070669_100019164
530 Ga0070669_100876586
531 Ga0070671_100175434
532 Ga0070659_100398869
533 Ga0070713_100113761
534 Ga0070694_100264798
535 Ga0070678_100177118
536 Ga0070662_100297967
537 Ga0070681_10484442
538 Ga0070706_100258081
539 Ga0070679_100042128
540 Ga0070679_100157453
541 Ga0070679_100191553
542 Ga0068853_100121906
543 Ga0070672_100013221
544 Ga0070665_100181235
545 Ga0070665_100349213
546 Ga0070665_100633773
547 Ga0070665_101537629
548 Ga0068855_100780131
549 Ga0070664_100247463
550 Ga0070664_100346254
551 Ga0068852_100021581
552 Ga0068852_100078963
553 Ga0068859_101253635
554 Ga0068864_100005870
555 Ga0068864_100269358
556 Ga0068863_100080207
557 Ga0068860_100023574
558 Ga0068860_100068292
559 Ga0068862_100370079
560 Ga0081539_10020508
561 Ga0075365_10126458
562 Ga0075364_10002393
563 Ga0075364_10059108
564 Ga0075364_10174462
565 Ga0075364_10211754
566 Ga0075364_10442948
567 Ga0070716_100049287
568 Ga0070716_100251608
569 Ga0075367_10122644
570 Ga0075369_10213677
571 Ga0075433_10012239
572 Ga0075434_100049122
573 Ga0068865_100191176
574 Ga0075436_100001504
575 Ga0097620_101253676
576 Ga0075435_100020597
577 Ga0105251_10000473
578 Ga0105251_10030266
579 Ga0105244_10026759
580 Ga0105240_11092957
581 Ga0111539_10115362
582 Ga0105243_10843292
583 Ga0105241_10432975
584 Ga0105249_10055264
585 Ga0105148_103727
586 Ga0105032_103938
587 Ga0105239_10517062
588 Ga0157318_1002580
589 Ga0157342_1018815
590 Ga0157315_1006611
591 Ga0157327_1011430
592 Ga0157373_10059188
593 Ga0157373_10097327
594 Ga0157373_10529090
595 Ga0157371_10000314
596 Ga0157371_10038774
597 Ga0157371_10719111
598 Ga0157369_10181102
599 Ga0157378_10001533
600 Ga0157372_10292764
601 Ga0157372_12148324
602 Ga0163163_10025833
603 Ga0157380_10294417
604 Ga0157380_10640883
605 Ga0182008_10000269
606 Ga0182008_10144032
607 Ga0157379_10012683
608 Ga0182006_1013353
609 Ga0182005_1000168
610 Ga0183360_10001
611 Ga0163161_10200157
612 Ga0207425_1000030
613 Ga0209129_1000063
614 Ga0209565_1000001
615 Ga0209565_1000014
616 Ga0209673_1000001
617 Ga0209673_1000570
618 Ga0209673_1012309
619 Ga0209130_1004885
620 Ga0209675_1000001
621 Ga0209675_1000021
622 Ga0209676_1000027
623 Ga0209676_1000047
624 Ga0209676_1000079
625 Ga0209676_1004494
626 Ga0209676_1006710
627 Ga0209676_1024017
628 Ga0209676_1024390
629 Ga0209025_1000013
630 Ga0209025_1000102
631 Ga0209025_1008994
632 Ga0209025_1024990
633 Ga0209025_1034946
634 Ga0209564_1000001
635 Ga0209564_1000263
636 Ga0209564_1020630
637 Ga0209758_1000014
638 Ga0209758_1006900
639 Ga0209758_1061319
640 Ga0209758_1065882
641 Ga0209050_1000153
642 Ga0209050_1000311
643 Ga0209050_1001466
644 Ga0209050_1009954
645 Ga0209050_1025263
646 Ga0209256_1000002
647 Ga0209256_1003979
648 Ga0209256_1009438
649 Ga0209256_1010213
650 Ga0209256_1024944
651 Ga0209051_1005263
652 Ga0209051_1009855
653 Ga0209257_1000081
654 Ga0209257_1002586
655 Ga0209257_1010696
656 Ga0209257_1011801
657 Ga0209257_1011826
658 Ga0207713_1000534
659 Ga0207713_1025593
660 Ga0207705_10493067
661 Ga0207684_10658814
662 Ga0207695_10277106
663 Ga0207695_10555419
664 Ga0207695_10760075
665 Ga0207660_10010000
666 Ga0207657_10022384
667 Ga0207652_10127937
668 Ga0207652_10326455
669 Ga0207681_10022404
670 Ga0207681_10077882
671 Ga0207650_10473453
672 Ga0207700_10188062
673 Ga0207644_10149441
674 Ga0207644_10209279
675 Ga0207690_10641485
676 Ga0207706_10636092
677 Ga0207709_10007372
678 Ga0207709_10267166
679 Ga0207669_10924892
680 Ga0207665_10113277
681 Ga0207665_10278122
682 Ga0207691_10013383
683 Ga0207711_10402555
684 Ga0207679_10461748
685 Ga0207679_10767520
686 Ga0207667_11334563
687 Ga0207712_10199376
688 Ga0207668_10414051
689 Ga0207677_10123975
690 Ga0207639_10014456
691 Ga0207639_11128836
692 Ga0207641_10019365
693 Ga0207641_10292845
694 Ga0207676_10011821
695 Ga0207676_10159790
696 Ga0207675_100516247
697 Ga0207675_101056086
698 Ga0207683_10106007
699 Ga0207698_10005789
700 Ga0207698_10058158
701 Ga0209371_1000004
702 Ga0209371_1000011
703 Ga0209967_1002702
704 Ga0268266_10255621
705 Ga0268266_10468910
706 Ga0268264_10010146
707 Ga0268264_10064001
708 Ga0265323_10000121
709 Ga0265323_10030064
710 Ga0265322_10000456
711 Ga0307515_10152575
712 Ga0307515_10276719
713 Ga0268256_1000005
714 Ga0268256_1000011
715 Ga0316176_1115957
716 Ga0314311_1239643
717 Ga0316180_1116347
718 Ga0316183_1125611
719 Ga0316181_1108000
720 Ga0265330_10029242
721 Ga0265331_10216339
722 Ga0265327_10073316
723 Ga0265316_10078372
724 Ga0265316_10422253
725 Ga0265316_10430979
726 Ga0265316_10736594
727 Ga0265316_10892861
728 Ga0307513_10004594
729 Ga0307408_100064306
730 Ga0307408_100334748
731 Ga0307408_100444470
732 Ga0307516_10096882
733 Ga0307405_10055034
734 Ga0307405_10261489
735 Ga0307413_10019405
736 Ga0307413_10041607
737 Ga0307410_10575440
738 Ga0307410_10834816
739 Ga0307406_10004519
740 Ga0307406_10123422
741 Ga0307406_10263437
742 Ga0307406_10294936
743 Ga0307406_10400995
744 Ga0307406_10474472
745 Ga0307407_10035356
746 Ga0307407_10093927
747 Ga0307412_10293620
748 Ga0307412_10422005
749 Ga0307412_10438464
750 Ga0307412_10500129
751 Ga0307412_10753052
752 Ga0307409_100925666
753 Ga0307416_100212493
754 Ga0307414_10001542
755 Ga0307414_10005468
756 Ga0307414_10033993
757 Ga0307414_10036259
758 Ga0307414_10064172
759 Ga0307414_10085480
760 Ga0307414_10241179
761 Ga0307414_10311926
762 Ga0307414_10466296
763 Ga0307414_10673319
764 Ga0307414_10685416
765 Ga0307411_10003100
766 Ga0307411_10384323
767 Ga0307415_100287281
768 Ga0373941_0000601
769 Ga0373927_0050836
770 Ga0395900_0099624
771 Ga0395900_0139802
772 Ga0395898_1288895
773 Ga0395905_0000030
774 Ga0395905_0044110
775 Ga0395905_0931062
776 Ga0436364_1498783
777 Ga0395901_0610461
778 Ga0237819_03470
779 Ga0439436_0026710
780 Ga0439436_0038012
781 Ga0439436_0089832
782 Ga0439465_0001393
783 Ga0451791_0009035
784 Ga0451797_0896119
785 Ga0451795_0013074
786 Ga0451837_1091997
787 Ga0451839_0957326
788 Ga0451841_0512690
789 Ga0451841_1233105
790 Ga0451843_0084997
791 Ga0451843_0483042
792 Ga0439445_0003339
793 Ga0439432_005316
794 Ga0439432_028187
795 Ga0439432_060972
796 Ga0439449_0000083
797 Ga0439449_0017319
798 Ga0439449_0028158
799 Ga0439449_0032348
800 Ga0439449_0033606
801 Ga0439457_042294
802 Ga0439462_0015190
803 Ga0439462_0016841
804 Ga0439462_0018728
805 Ga0451577_0003130
806 Ga0451577_0006884
807 Ga0451577_0197159
808 Ga0451577_1644011
809 Ga0466972_0000617
810 Ga0466965_0000826
811 Ga0453684_0001232
812 Ga0453684_0031975
813 Ga0453684_0093011
814 Ga0453684_0260564
815 Ga0453684_0533832
816 Ga0466968_0008224
817 Ga0466960_0067585
818 Ga0466959_0024322
819 Ga0451576_0741422
820 Ga0495627_147497
821 Ga0495638_0007840
822 Ga0495605_0044396
823 Ga0495607_0095658
824 Ga0495606_0024532
825 Ga0495610_0001232
826 Ga0495632_0118344
827 Ga0495643_0000925
828 Ga0495663_0003675
829 Ga0495663_0096329
830 Ga0495663_0099187
831 Ga0495633_0004179
832 Ga0495633_0004483
833 Ga0495656_0007956
834 Ga0495656_0009357
835 Ga0495668_0019371
836 Ga0495659_0015053
837 Ga0495661_0251393
838 Ga0495588_0226644
839 Ga0495670_0057630
840 Ga0495671_0040666
841 Ga0495636_0003821
842 Ga0495636_0049139
843 Ga0495636_0109406
844 Ga0495672_0000134
845 Ga0495685_005048
846 Ga0495686_0010849
847 Ga0495615_0192383
848 Ga0496100_0347717
849 Ga0496101_0557832
850 Ga0496102_0287304
851 Ga0496105_0052872
852 Ga0496107_0210351
853 Ga0496108_0184477
854 Ga0496108_1465921
855 Ga0496109_0225324
856 Ga0496109_0578170
857 Ga0496112_0006646
858 Ga0496112_0911622
859 Ga0496113_0222451
860 Ga0496113_0276122
861 Ga0496114_0005495
862 Ga0496114_0052341
863 Ga0496114_0859544
864 Ga0496116_0039960
865 Ga0496116_0290121
866 Ga0496117_0002078
867 Ga0496117_0021211
868 Ga0496117_0026488
869 Ga0496118_0000145
870 Ga0496118_0000573
871 Ga0496118_0010191
872 Ga0496118_0097096
873 Ga0496119_0000211
874 Ga0496119_0009334
875 Ga0496120_0000525
876 Ga0496120_0001043
877 Ga0496122_0000220
878 Ga0496122_0000976
879 Ga0496122_0017868
880 Ga0496123_0000151
881 Ga0496123_0000359
882 Ga0496123_0084991
883 Ga0496124_0000018
884 Ga0496124_0000255
885 Ga0496124_0000437
886 Ga0496124_0033787
887 Ga0496124_0047915
888 Ga0496124_0079473
889 Ga0496124_0156921
890 Ga0496125_0013202
891 Ga0496126_0000806
892 Ga0496126_0010633
893 Ga0496126_0451160
894 Ga0501290_002504
895 Ga0501303_014635
896 Ga0501033_0001911
897 Ga0501034_0000571
898 Ga0501034_0012086
899 Ga0501034_0031589
900 Ga0501034_0756117
901 Ga0501036_0496865
902 Ga0501038_0482189
903 Ga0501043_0014316
904 Ga0501043_0049940
905 Ga0501046_0385680
906 Ga0501047_0006534
907 Ga0501202_056384
908 Ga0501223_023442
909 Ga0501257_122864
910 Ga0501241_048841
911 Ga0501265_010636
912 Ga0501266_017291
913 Ga0501268_020442
914 Ga0501275_000463
915 Ga0501035_0000744
916 Ga0501044_0000049
917 Ga0501044_0304824
918 Ga0501045_0933335
919 nmdc:mga00v17_236530_c1
920 nmdc:mga00v17_401_c1
921 nmdc:mga05p37_543487_c1
922 nmdc:mga0n895_12163_c1
923 nmdc:mga0rr50_130865_c1
924 nmdc:mga08x19_2257_c1
925 nmdc:mga0a205_12466_c1
926 Ga0500646_0026450
927 Ga0500616_0000642
928 Ga0500634_0000083
929 Ga0500645_007498
930 2547500895
931 2572255397
932 2578458911
933 2643816346
934 2643881531
935 2643938967
936 2643977735
937 2644077290
938 2644529818
939 2644662667
940 2644694400
941 2644698379
942 2747948755
943 2748018252
944 2765578455
945 2816516472
946 2819662802
947 2842392814
948 2842781533
949 2852651262
950 2852686205
951 2874221078
952 2919091288
953 2919132333
954 2919136372
955 2928497920
956 2929197202
957 2931381276
958 2937611900
959 2939590579
960 2939622747
961 2939629632
962 2941477793
963 2941489889
964 2961047843
965 2961067182
966 2974309374
967 2977250094
968 2984515416
969 2987605868
970 2995950577
971 8003016631
972 8021623063
973 8021627303
974 8021649787

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00731

AIRC

AIR carboxylase

40

189

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2fw8-assembly1.cif.gz_A structure of pure (n5-carboxyaminoimidazole ribonucleotide mutase) h89g from the acidophilic bacterium acetobacter aceti, at ph 8 0.9852 6 157
5clf-assembly1.cif.gz_B structure of pure (n5-carboxyaminoimidazole ribonucleotide mutase) from the acidophilic bacterium acetobacter aceti, at ph 8.5 0.9846 6 157
2fw9-assembly1.cif.gz_B structure of pure (n5-carboxyaminoimidazole ribonucleotide mutase) h59f from the acidophilic bacterium acetobacter aceti, at ph 8 0.9844 7 157
2fwi-assembly1.cif.gz_B structure of pure (n5-carboxyaminoimidazole ribonucleotide mutase) h59d, from the acidophilic bacterium acetobacter aceti, complexed with 5-aminoimidazole ribonucleotide (air) 0.9843 6 157
2fwa-assembly1.cif.gz_B structure of pure (n5-carboxyaminoimidazole ribonucleotide mutase) h89n from the acidophilic bacterium acetobacter aceti, at ph 7 0.9841 6 157
ID Description Score Start End Superfamily
5cvtB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9813 6 157 3.40.50.1970
af_P21264_391_571_3.40.50.1970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9638 6 162 3.40.50.1970
af_Q9SJ42_1_162_3.40.50.1970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9558 14 162 3.40.50.1970
2ywxA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9418 10 163 3.40.50.1970
3trhI00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9348 10 163 3.40.50.1970
ID Description Score Start End GO Terms
AF-A0A017HSY8-F1-model_v4 Multifunctional fusion protein [Includes: N5-carboxyaminoimidazole ribonucleotide synthase (N5-CAIR synthase) (EC 6.3.4.18) (5-(carboxyamino)imidazole ribonucleotide synthetase); N5-carboxyaminoimidazole ribonucleotide mutase (N5-CAIR mutase) (EC 5.4.99.18) (5-(carboxyamino)imidazole ribonucleotide mutase)] 0.9941 8 133 GO:0004638
GO:0005524
GO:0005829
GO:0006189
GO:0034023
GO:0034028
GO:0046872
AF-H6SRU5-F1-model_v4 N5-carboxyaminoimidazole ribonucleotide mutase (N5-CAIR mutase) (EC 5.4.99.18) (5-(carboxyamino)imidazole ribonucleotide mutase) 0.9909 7 157 GO:0006189
GO:0016829
GO:0034023
AF-T0Y1U6-F1-model_v4 Phosphoribosylaminoimidazole carboxylase catalytic subunit 0.9908 6 147 GO:0006189
GO:0016853
AF-A0A353P8S8-F1-model_v4 5-(Carboxyamino)imidazole ribonucleotide mutase 0.9902 6 135 GO:0006189
GO:0016853
AF-L8GN82-F1-model_v4 Phosphoribosylaminoimidazole carboxylase, ATPase subunit 0.9896 6 156 GO:0004638
GO:0004639
GO:0005524
GO:0005829
GO:0006189
GO:0046872

Map