F453429

General Info

Members Datasets Scaffolds Average Seq Length
487 304 477 126

Family's Representative Sequence

Representative Sequence 3300006178|Ga0075367_10688977|Ga0075367_106889772
Length 117
Sequence MPGIDPTTAQRVTPGVPGLPRDADGPVFREPWEAQAFAMTLALHERGLFTWVEWAEALAAQIDTYYRHWLAALEGLVARKGASSGDELARYRHAWDHAADRTPHGQPIELRREDFSF

Samples

Sample ID Description Type Environment
1 2842677519 Variovorax sp. R-72495 Isolate Unclassified
2 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
3 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
4 2904456579 Variovorax sp. 2002 Isolate Unclassified
5 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
6 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
7 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
8 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
9 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
10 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
11 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
12 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
13 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
14 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
15 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
16 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
17 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
18 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
19 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
48 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
49 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
50 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
51 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
52 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
53 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
54 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
55 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
56 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
57 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
58 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
64 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
65 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
66 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
67 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
74 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
75 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
76 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
77 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
78 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
82 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
83 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
84 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
85 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
86 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
87 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
90 3300022730 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 Metagenome Rhizosphere
91 3300023660 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
92 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
93 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
94 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
95 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
96 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
98 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
132 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
135 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
136 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
137 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
138 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
139 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
140 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
141 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
142 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
143 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
144 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
145 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
146 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
147 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
148 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
149 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
150 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
151 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
152 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
153 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
154 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
155 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
156 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
157 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
158 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
159 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
160 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
161 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
162 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
163 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
164 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
165 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
166 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
167 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
168 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
169 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
170 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
171 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
172 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
173 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
174 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
175 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
176 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
177 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
178 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
179 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
180 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
181 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
182 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
183 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
184 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
185 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
186 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
187 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
188 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
189 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
190 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
191 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
192 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
193 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
194 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
195 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
196 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
197 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
198 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
199 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
200 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
201 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
202 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
203 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
204 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
205 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
206 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
207 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
208 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
209 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
210 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
211 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
212 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
213 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
214 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
215 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
216 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
217 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
218 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
219 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
220 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
221 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
222 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
223 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
224 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
225 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
226 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
227 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
228 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
229 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
230 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
231 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
232 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
233 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
234 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
235 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
236 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
237 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
238 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
239 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
240 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
241 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
242 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
243 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
244 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
245 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
246 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
247 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
248 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
249 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
250 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
251 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
252 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
253 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
254 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
255 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
256 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
257 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
258 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
259 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
260 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
261 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
262 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
263 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
264 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
265 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
266 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
267 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
268 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
269 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
270 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
271 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
272 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
273 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
274 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
275 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
276 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
277 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
278 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
279 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
280 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
281 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
282 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
283 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
284 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
285 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
286 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
287 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
288 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
289 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
290 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
291 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
292 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
293 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
294 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
295 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
296 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
297 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
298 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
299 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
300 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
301 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
302 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
303 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
304 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.71
Metatranscriptomes 1.23
Isolates 2.05

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.7
Nodule 0.62
Rhizoplane 3.29
Rhizosphere 78.85
Stem 0
Stem Tuber 0
Unclassified 5.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25151J46595_10002286 3300003187 Bacteria 11742
2 Ga0006562J51391_1118683 3300003578 Bacteria 1030
3 JGI25404J52841_10044842 3300003659 Bacteria 933
4 JGI25404J52841_10072088 3300003659 Bacteria 722
5 JGI25404J52841_10138619 3300003659 Bacteria 515
6 Ga0055534_1000131 3300003784 Bacteria 56581
7 Ga0055528_1000629 3300003790 Bacteria 26158
8 Ga0055540_1003935 3300003792 Bacteria 6943
9 Ga0065714_10073651 3300005288 Bacteria 3153
10 Ga0070658_10467761 3300005327 Bacteria 1087
11 Ga0070658_10542588 3300005327 Bacteria 1006
12 Ga0070658_10639979 3300005327 Bacteria 922
13 Ga0070676_11592013 3300005328 Bacteria 505
14 Ga0070683_100581080 3300005329 Bacteria 1072
15 Ga0068869_100002065 3300005334 Bacteria 12072
16 Ga0070680_100273493 3300005336 Bacteria 1430
17 Ga0068868_100091337 3300005338 Bacteria 2453
18 Ga0070660_100041315 3300005339 Bacteria 3514
19 Ga0070660_100147482 3300005339 Bacteria 1890
20 Ga0070661_100301785 3300005344 Bacteria 1247
21 Ga0070668_100152532 3300005347 Bacteria 1869
22 Ga0070669_100170228 3300005353 Bacteria 1697
23 Ga0070669_100534989 3300005353 Bacteria 975
24 Ga0070669_101546781 3300005353 Bacteria 577
25 Ga0070673_100798953 3300005364 Bacteria 871
26 Ga0070688_100253497 3300005365 Bacteria 1254
27 Ga0070713_101550402 3300005436 Bacteria 643
28 Ga0070700_101719789 3300005441 Bacteria 539
29 Ga0070663_100957276 3300005455 Bacteria 742
30 Ga0070678_100219230 3300005456 Bacteria 1580
31 Ga0070678_101579032 3300005456 Bacteria 616
32 Ga0070681_10561256 3300005458 Bacteria 1055
33 Ga0070681_10561260 3300005458 Bacteria 1055
34 Ga0070681_10600548 3300005458 Bacteria 1015
35 Ga0070681_11733629 3300005458 Bacteria 551
36 Ga0070681_11790378 3300005458 Bacteria 541
37 Ga0070679_100479789 3300005530 Bacteria 1188
38 Ga0070679_100497303 3300005530 Bacteria 1163
39 Ga0070684_100365318 3300005535 Bacteria 1328
40 Ga0068853_100016363 3300005539 Bacteria 6102
41 Ga0068853_100508779 3300005539 Bacteria 1137
42 Ga0070696_100995730 3300005546 Bacteria 700
43 Ga0070696_101653088 3300005546 Bacteria 551
44 Ga0068855_101139760 3300005563 Bacteria 813
45 Ga0070664_100531743 3300005564 Bacteria 1086
46 Ga0068857_100023817 3300005577 Bacteria 5389
47 Ga0068857_101566600 3300005577 Bacteria 643
48 Ga0068859_102068577 3300005617 Bacteria 629
49 Ga0068864_100379228 3300005618 Bacteria 1340
50 Ga0068870_10084427 3300005840 Bacteria 1763
51 Ga0068863_100237842 3300005841 Bacteria 1758
52 Ga0068863_101751424 3300005841 Bacteria 631
53 Ga0068863_102241519 3300005841 Bacteria 556
54 Ga0068860_101038295 3300005843 Bacteria 838
55 Ga0068862_100347736 3300005844 Bacteria 1375
56 Ga0068862_101517254 3300005844 Bacteria 676
57 Ga0068862_101619546 3300005844 Bacteria 655
58 Ga0081455_10001090 3300005937 Bacteria 34145
59 Ga0081455_10015632 3300005937 Bacteria 7363
60 Ga0081455_10030942 3300005937 Bacteria 4852
61 Ga0081540_1003684 3300005983 Bacteria 12015
62 Ga0081540_1009943 3300005983 Bacteria 6487
63 Ga0081540_1011144 3300005983 Bacteria 6035
64 Ga0081540_1015213 3300005983 Bacteria 4880
65 Ga0081540_1016250 3300005983 Bacteria 4668
66 Ga0081540_1099047 3300005983 Bacteria 1261
67 Ga0081540_1119142 3300005983 Bacteria 1099
68 Ga0070717_10015214 3300006028 Bacteria 5937
69 Ga0075363_100071543 3300006048 Bacteria 1885
70 Ga0075364_10140927 3300006051 Bacteria 1622
71 Ga0075432_10100441 3300006058 Bacteria 1068
72 Ga0070712_101161248 3300006175 Bacteria 671
73 Ga0075362_10118692 3300006177 Bacteria 1250
74 Ga0075362_10126104 3300006177 Bacteria 1214
75 Ga0075362_10298692 3300006177 Bacteria 799
76 Ga0075367_10148003 3300006178 Bacteria 1456
77 Ga0075367_10688977 3300006178 Bacteria 650
78 Ga0075367_10774380 3300006178 Bacteria 611
79 Ga0075367_11041072 3300006178 Bacteria 523
80 Ga0075369_10053401 3300006186 Bacteria 1754
81 Ga0075369_10287464 3300006186 Bacteria 766
82 Ga0075366_10094551 3300006195 Bacteria 1792
83 Ga0075366_10258563 3300006195 Bacteria 1062
84 Ga0075370_10000206 3300006353 Bacteria 20863
85 Ga0075370_10067662 3300006353 Bacteria 2039
86 Ga0075370_10147548 3300006353 Bacteria 1378
87 Ga0068871_100064472 3300006358 Bacteria 3000
88 Ga0075434_100008357 3300006871 Bacteria 9621
89 Ga0068865_100511569 3300006881 Bacteria 1003
90 Ga0097620_102068344 3300006931 Bacteria 629
91 Ga0099826_10002606 3300006948 Bacteria 11747
92 Ga0099826_10262593 3300006948 Bacteria 903
93 Ga0075435_100118501 3300007076 Bacteria 2207
94 Ga0099794_10088359 3300007265 Bacteria 1536
95 Ga0099795_10001817 3300007788 Bacteria 4806
96 Ga0099795_10343271 3300007788 Bacteria 666
97 Ga0105244_10553341 3300009036 Bacteria 529
98 Ga0105240_10100450 3300009093 Bacteria 3520
99 Ga0111539_10530989 3300009094 Bacteria 1371
100 Ga0105243_10167508 3300009148 Bacteria 1900
101 Ga0105248_10216540 3300009177 Bacteria 2157
102 Ga0105238_10055443 3300009551 Bacteria 3978
103 Ga0105238_10560411 3300009551 Bacteria 1148
104 Ga0099796_10018315 3300010159 Bacteria 2101
105 Ga0105246_10135266 3300011119 Bacteria 1846
106 Ga0105246_10645964 3300011119 Bacteria 920
107 Ga0157314_1038491 3300012500 Bacteria 568
108 Ga0157373_10007173 3300013100 Bacteria 8315
109 Ga0157373_10038216 3300013100 Bacteria 3441
110 Ga0157371_10200730 3300013102 Bacteria 1430
111 Ga0157370_10017546 3300013104 Bacteria 7221
112 Ga0157369_10056151 3300013105 Bacteria 4249
113 Ga0157369_10448575 3300013105 Bacteria 1336
114 Ga0157372_11276480 3300013307 Bacteria 848
115 Ga0157380_10197962 3300014326 Bacteria 1780
116 Ga0182008_10005232 3300014497 Bacteria 7428
117 Ga0182008_10019984 3300014497 Bacteria 3452
118 Ga0157377_10341275 3300014745 Bacteria 1002
119 Ga0157376_10798479 3300014969 Bacteria 956
120 Ga0182006_1046533 3300015261 Bacteria 1685
121 Ga0182006_1119574 3300015261 Bacteria 916
122 Ga0163161_10003921 3300017792 Bacteria 10434
123 Ga0163161_10040902 3300017792 Bacteria 3330
124 Ga0163161_10136291 3300017792 Bacteria 1856
125 Ga0163161_10158716 3300017792 Bacteria 1724
126 Ga0206356_11131140 3300020070 Bacteria 1021
127 Ga0206353_10806980 3300020082 Bacteria 668
128 Ga0213875_10153543 3300021388 Bacteria 1079
129 Ga0224570_111074 3300022730 Bacteria 571
130 Ga0247550_102964 3300023660 Bacteria 598
131 Ga0209129_1008320 3300025258 Bacteria 2906
132 Ga0209565_1000188 3300025263 Bacteria 75532
133 Ga0209565_1030056 3300025263 Bacteria 1064
134 Ga0209673_1000411 3300025273 Bacteria 75532
135 Ga0209673_1017672 3300025273 Bacteria 2622
136 Ga0209675_1000172 3300025291 Bacteria 75532
137 Ga0209676_1047304 3300025292 Bacteria 1157
138 Ga0209676_1060522 3300025292 Bacteria 945
139 Ga0209025_1000424 3300025294 Bacteria 83948
140 Ga0209051_1000240 3300025303 Bacteria 92221
141 Ga0207688_10028086 3300025901 Bacteria 3096
142 Ga0207645_10156893 3300025907 Bacteria 1487
143 Ga0207643_10038916 3300025908 Bacteria 2673
144 Ga0207705_10075729 3300025909 Bacteria 2445
145 Ga0207705_10665376 3300025909 Bacteria 810
146 Ga0207707_10020556 3300025912 Bacteria 5765
147 Ga0207707_11338933 3300025912 Bacteria 574
148 Ga0207695_10495628 3300025913 Bacteria 1104
149 Ga0207671_10544129 3300025914 Bacteria 926
150 Ga0207693_10529987 3300025915 Bacteria 919
151 Ga0207660_10120129 3300025917 Bacteria 1989
152 Ga0207660_10221611 3300025917 Bacteria 1485
153 Ga0207657_10002034 3300025919 Bacteria 21867
154 Ga0207657_10005543 3300025919 Bacteria 13180
155 Ga0207649_11041999 3300025920 Bacteria 644
156 Ga0207652_10098428 3300025921 Bacteria 2579
157 Ga0207681_10033358 3300025923 Bacteria 3375
158 Ga0207681_10332140 3300025923 Bacteria 1212
159 Ga0207681_11686263 3300025923 Bacteria 530
160 Ga0207650_10414194 3300025925 Bacteria 1117
161 Ga0207659_10401752 3300025926 Bacteria 1146
162 Ga0207700_10034156 3300025928 Bacteria 3648
163 Ga0207700_10128314 3300025928 Bacteria 2067
164 Ga0207664_10841929 3300025929 Bacteria 825
165 Ga0207686_10660773 3300025934 Bacteria 828
166 Ga0207709_10018188 3300025935 Bacteria 3931
167 Ga0207689_10003079 3300025942 Bacteria 15347
168 Ga0207661_10697129 3300025944 Bacteria 934
169 Ga0207679_11004957 3300025945 Bacteria 764
170 Ga0207667_10505987 3300025949 Bacteria 1225
171 Ga0207667_10562025 3300025949 Bacteria 1153
172 Ga0207667_10702660 3300025949 Bacteria 1013
173 Ga0207651_10554381 3300025960 Bacteria 1000
174 Ga0207668_10014133 3300025972 Bacteria 4937
175 Ga0207639_10549393 3300026041 Bacteria 1060
176 Ga0207708_10687727 3300026075 Bacteria 873
177 Ga0207641_10098704 3300026088 Bacteria 2569
178 Ga0207641_11640753 3300026088 Bacteria 645
179 Ga0207676_10287365 3300026095 Bacteria 1496
180 Ga0207676_10884459 3300026095 Bacteria 875
181 Ga0207683_10079737 3300026121 Bacteria 2903
182 Ga0207683_10474145 3300026121 Bacteria 1155
183 Ga0207698_12219938 3300026142 Bacteria 561
184 Ga0209179_1008482 3300027512 Bacteria 1733
185 Ga0207428_11253164 3300027907 Bacteria 515
186 Ga0268265_10023170 3300028380 Bacteria 4373
187 Ga0268265_10100339 3300028380 Bacteria 2336
188 Ga0268265_10309955 3300028380 Bacteria 1425
189 Ga0268265_10669595 3300028380 Bacteria 999
190 Ga0268265_10675215 3300028380 Bacteria 995
191 Ga0268265_11006878 3300028380 Bacteria 823
192 Ga0268264_11440915 3300028381 Bacteria 699
193 Ga0265334_10274831 3300028573 Bacteria 578
194 Ga0307515_10223405 3300028794 Bacteria 1695
195 Ga0307515_10353614 3300028794 Bacteria 1114
196 Ga0307515_10462981 3300028794 Bacteria 882
197 Ga0316183_1170808 3300030742 Bacteria 5271
198 Ga0316181_1023342 3300030744 Bacteria 2272
199 Ga0265763_1052980 3300030763 Bacteria 515
200 Ga0265330_10009220 3300031235 Bacteria 4699
201 Ga0265330_10435248 3300031235 Bacteria 556
202 Ga0265340_10003262 3300031247 Bacteria 9202
203 Ga0265340_10134279 3300031247 Bacteria 1134
204 Ga0265339_10003705 3300031249 Bacteria 10656
205 Ga0265316_10214372 3300031344 Bacteria 1423
206 Ga0307408_100003804 3300031548 Bacteria 10279
207 Ga0307408_100114823 3300031548 Bacteria 2075
208 Ga0307408_100348711 3300031548 Bacteria 1255
209 Ga0307408_100797813 3300031548 Bacteria 857
210 Ga0307408_100842086 3300031548 Bacteria 835
211 Ga0307408_101235366 3300031548 Bacteria 698
212 Ga0307408_101460511 3300031548 Bacteria 645
213 Ga0307508_10227294 3300031616 Bacteria 1465
214 Ga0307514_10145193 3300031649 Bacteria 1604
215 Ga0265342_10571514 3300031712 Bacteria 572
216 Ga0307405_10125917 3300031731 Bacteria 1761
217 Ga0307405_10371261 3300031731 Bacteria 1110
218 Ga0307405_10415003 3300031731 Bacteria 1057
219 Ga0307413_10090621 3300031824 Bacteria 1990
220 Ga0307406_10001303 3300031901 Bacteria 13987
221 Ga0307406_10195379 3300031901 Bacteria 1485
222 Ga0307412_10058104 3300031911 Bacteria 2585
223 Ga0307412_10081458 3300031911 Bacteria 2238
224 Ga0307412_11043223 3300031911 Bacteria 724
225 Ga0307412_12032207 3300031911 Bacteria 532
226 Ga0307416_100338910 3300032002 Bacteria 1515
227 Ga0307416_100568419 3300032002 Bacteria 1209
228 Ga0307414_10487393 3300032004 Bacteria 1088
229 Ga0307414_11000939 3300032004 Bacteria 769
230 Ga0307414_11673492 3300032004 Bacteria 593
231 Ga0307414_12142727 3300032004 Bacteria 522
232 Ga0307411_10063162 3300032005 Bacteria 2473
233 Ga0307411_10476693 3300032005 Bacteria 1050
234 Ga0316215_1004414 3300033544 Bacteria 1349
235 Ga0373934_0005971 3300035086 Bacteria 4508
236 Ga0373923_0006964 3300035111 Bacteria 3945
237 Ga0373923_0123862 3300035111 Bacteria 1157
238 Ga0373953_0000126 3300035117 Bacteria 18697
239 Ga0373953_0043041 3300035117 Bacteria 1801
240 Ga0373954_0001939 3300035118 Bacteria 8573
241 Ga0373954_0023399 3300035118 Bacteria 2808
242 Ga0373956_0000764 3300035119 Bacteria 13305
243 Ga0373956_0125227 3300035119 Bacteria 1201
244 Ga0373956_0224736 3300035119 Bacteria 891
245 Ga0373957_0000307 3300035120 Bacteria 12288
246 Ga0373957_0114969 3300035120 Bacteria 1086
247 Ga0373960_0272494 3300035121 Bacteria 621
248 Ga0373943_0096199 3300035170 Bacteria 1541
249 Ga0373946_0027086 3300035171 Bacteria 2265
250 Ga0373955_0001379 3300035172 Bacteria 10317
251 Ga0373955_0155023 3300035172 Bacteria 1349
252 Ga0373924_0000464 3300035410 Bacteria 12448
253 Ga0373924_0089994 3300035410 Bacteria 1312
254 Ga0373924_0092186 3300035410 Bacteria 1297
255 Ga0373931_0153034 3300035691 Bacteria 1346
256 Ga0373935_0008277 3300035692 Bacteria 6225
257 Ga0373935_1332274 3300035692 Bacteria 536
258 Ga0373927_0000970 3300035695 Bacteria 21800
259 Ga0373927_0273273 3300035695 Bacteria 1111
260 Ga0373933_0000007 3300035724 Bacteria 123599
261 Ga0373933_0000600 3300035724 Bacteria 22552
262 Ga0373933_0074677 3300035724 Bacteria 2068
263 Ga0373947_0004082 3300035725 Bacteria 8597
264 Ga0373937_0005936 3300036401 Bacteria 10510
265 Ga0373937_0035052 3300036401 Bacteria 4565
266 Ga0373937_0052926 3300036401 Bacteria 3724
267 Ga0372808_003626 3300036459 Bacteria 1914
268 Ga0373925_0005246 3300037068 Bacteria 9681
269 Ga0373925_1564888 3300037068 Bacteria 539
270 Ga0395899_0137366 3300037312 Bacteria 1742
271 Ga0395899_0377130 3300037312 Bacteria 943
272 Ga0395900_0026139 3300037418 Bacteria 5977
273 Ga0395900_0062888 3300037418 Bacteria 3815
274 Ga0395900_0102735 3300037418 Bacteria 2936
275 Ga0395898_0157014 3300037466 Bacteria 2176
276 Ga0395898_0285439 3300037466 Bacteria 1574
277 Ga0395898_0508501 3300037466 Bacteria 1146
278 Ga0395898_0549450 3300037466 Bacteria 1097
279 Ga0395898_0849983 3300037466 Bacteria 852
280 Ga0395905_0288998 3300037471 Bacteria 1526
281 Ga0436364_1420335 3300037853 Bacteria 2115
282 Ga0395901_0162005 3300038443 Bacteria 2349
283 Ga0395901_0586486 3300038443 Bacteria 1126
284 Ga0395901_0692828 3300038443 Bacteria 1017
285 Ga0436363_1111216 3300039450 Bacteria 855
286 Ga0439461_0026298 3300041410 Bacteria 1187
287 Ga0439466_0040894 3300041411 Bacteria 1549
288 Ga0439466_0124410 3300041411 Bacteria 795
289 Ga0451789_0218353 3300041443 Bacteria 566
290 Ga0451793_0071301 3300041452 Bacteria 532
291 Ga0451795_0820344 3300041456 Bacteria 695
292 Ga0451800_1601918 3300041459 Bacteria 568
293 Ga0451802_0537002 3300041460 Bacteria 1627
294 Ga0451802_0555933 3300041460 Bacteria 592
295 Ga0451843_0625670 3300041509 Bacteria 642
296 Ga0439431_0187809 3300041997 Bacteria 599
297 Ga0439442_071686 3300042002 Bacteria 738
298 Ga0450921_001253 3300042123 Bacteria 1491
299 Ga0450923_001524 3300042125 Bacteria 3102
300 Ga0450906_093999 3300042145 Bacteria 545
301 Ga0439446_0029296 3300042156 Bacteria 1589
302 Ga0439434_0013647 3300042435 Bacteria 2412
303 Ga0466961_0508902 3300044693 Bacteria 727
304 Ga0466963_0007897 3300044694 Bacteria 6369
305 Ga0466957_0098062 3300044842 Bacteria 1844
306 Ga0466959_0550443 3300045049 Bacteria 778
307 Ga0466967_0000256 3300045976 Bacteria 23396
308 Ga0495592_0000570 3300046454 Bacteria 26078
309 Ga0495592_0015153 3300046454 Bacteria 5856
310 Ga0495592_0304258 3300046454 Bacteria 1035
311 Ga0495603_0000160 3300046455 Bacteria 33986
312 Ga0495629_0000155 3300046459 Bacteria 60057
313 Ga0495629_0020883 3300046459 Bacteria 4673
314 Ga0495629_0051829 3300046459 Bacteria 2872
315 Ga0495641_0005974 3300046461 Bacteria 8021
316 Ga0495651_0006357 3300046462 Bacteria 9039
317 Ga0495651_0068037 3300046462 Bacteria 2715
318 Ga0495653_0002759 3300046463 Bacteria 14010
319 Ga0495653_0028755 3300046463 Bacteria 4443
320 Ga0495653_0099524 3300046463 Bacteria 2110
321 Ga0495580_0000417 3300046472 Bacteria 35303
322 Ga0495582_0000125 3300046473 Bacteria 40813
323 Ga0495639_0000021 3300046475 Bacteria 73256
324 Ga0495662_0000303 3300046476 Bacteria 21400
325 Ga0495664_0011504 3300046477 Bacteria 4991
326 Ga0495664_0039234 3300046477 Bacteria 2798
327 Ga0495594_0000042 3300046499 Bacteria 55641
328 Ga0495608_0003962 3300046511 Bacteria 10635
329 Ga0495608_0303882 3300046511 Bacteria 987
330 Ga0495610_0112470 3300046512 Bacteria 1204
331 Ga0495618_0063376 3300046514 Bacteria 2347
332 Ga0495618_0074272 3300046514 Bacteria 2165
333 Ga0495620_0130618 3300046515 Bacteria 986
334 Ga0495628_0009664 3300046516 Bacteria 8230
335 Ga0495628_0018360 3300046516 Bacteria 5795
336 Ga0495630_0004542 3300046517 Bacteria 9724
337 Ga0495630_0068005 3300046517 Bacteria 2678
338 Ga0495648_0401807 3300046524 Bacteria 612
339 Ga0495666_0010593 3300046526 Bacteria 4596
340 Ga0495642_0304148 3300046528 Bacteria 699
341 Ga0495652_0003587 3300046529 Bacteria 15224
342 Ga0495652_0168350 3300046529 Bacteria 1693
343 Ga0495665_0000062 3300046531 Bacteria 44027
344 Ga0495640_0008019 3300046533 Bacteria 8297
345 Ga0495640_0010884 3300046533 Bacteria 7013
346 Ga0495640_0327443 3300046533 Bacteria 948
347 Ga0495587_0002145 3300046536 Bacteria 13193
348 Ga0495609_0344788 3300046538 Bacteria 601
349 Ga0495645_0007470 3300046543 Bacteria 7608
350 Ga0495645_0073494 3300046543 Bacteria 2463
351 Ga0495645_0439822 3300046543 Bacteria 824
352 Ga0495622_0001788 3300046557 Bacteria 10598
353 Ga0495622_0192589 3300046557 Bacteria 911
354 Ga0495667_0000747 3300046559 Bacteria 20874
355 Ga0495668_0174322 3300046616 Bacteria 1178
356 Ga0495634_0000798 3300046642 Bacteria 30556
357 Ga0495634_0014453 3300046642 Bacteria 5691
358 Ga0495625_0170976 3300046660 Bacteria 1451
359 Ga0495635_0000532 3300046663 Bacteria 24183
360 Ga0495635_0000926 3300046663 Bacteria 19326
361 Ga0495635_0014444 3300046663 Bacteria 5524
362 Ga0495661_0147469 3300046665 Bacteria 1274
363 Ga0495588_0100264 3300046674 Bacteria 1521
364 Ga0495588_0378668 3300046674 Bacteria 743
365 Ga0495657_0002564 3300046675 Bacteria 15242
366 Ga0495657_0102290 3300046675 Bacteria 1824
367 Ga0495599_0000394 3300046678 Bacteria 24995
368 Ga0495599_0476062 3300046678 Bacteria 737
369 Ga0495623_0003632 3300046679 Bacteria 10193
370 Ga0495646_0000916 3300046680 Bacteria 16760
371 Ga0495646_0012286 3300046680 Bacteria 5446
372 Ga0495647_0001909 3300046681 Bacteria 6490
373 Ga0495658_0004264 3300046683 Bacteria 7036
374 Ga0495658_0018615 3300046683 Bacteria 3613
375 Ga0495658_0034082 3300046683 Bacteria 2792
376 Ga0495658_0724061 3300046683 Bacteria 637
377 Ga0495613_0003945 3300046689 Bacteria 11110
378 Ga0495613_0017041 3300046689 Bacteria 5409
379 Ga0495624_0000320 3300046690 Bacteria 38290
380 Ga0495624_0070090 3300046690 Bacteria 2183
381 Ga0495670_0084063 3300046691 Bacteria 1624
382 Ga0495671_0049174 3300046692 Bacteria 2102
383 Ga0495600_0002273 3300046809 Bacteria 10948
384 Ga0495600_0161589 3300046809 Bacteria 1448
385 Ga0495600_0381276 3300046809 Bacteria 879
386 Ga0495660_0044649 3300046810 Bacteria 2437
387 Ga0495581_0000239 3300047315 Bacteria 26032
388 Ga0495581_0267990 3300047315 Bacteria 999
389 Ga0495604_0037770 3300047317 Bacteria 3801
390 Ga0495604_0042010 3300047317 Bacteria 3584
391 Ga0495604_0132572 3300047317 Bacteria 1789
392 Ga0495604_0740544 3300047317 Bacteria 622
393 Ga0495674_0001066 3300047319 Bacteria 26406
394 Ga0495674_0007646 3300047319 Bacteria 10321
395 Ga0495674_0020210 3300047319 Bacteria 6167
396 Ga0495676_0035232 3300047321 Bacteria 4188
397 Ga0495680_0003634 3300047322 Bacteria 15066
398 Ga0495680_0016672 3300047322 Bacteria 6304
399 Ga0495680_0244445 3300047322 Bacteria 1273
400 Ga0495675_0001271 3300047444 Bacteria 15273
401 Ga0495673_0047925 3300047469 Bacteria 1886
402 Ga0495684_0001102 3300047471 Bacteria 21742
403 Ga0495684_0056123 3300047471 Bacteria 3003
404 Ga0495593_0000013 3300047673 Bacteria 82874
405 Ga0495593_0000928 3300047673 Bacteria 17048
406 Ga0495593_0165373 3300047673 Bacteria 1116
407 Ga0495602_0003533 3300048088 Bacteria 16153
408 Ga0495602_0557296 3300048088 Bacteria 793
409 Ga0495614_0011966 3300048089 Bacteria 3812
410 Ga0495614_0204877 3300048089 Bacteria 893
411 Ga0496101_0098952 3300048904 Bacteria 2180
412 Ga0496101_1171086 3300048904 Bacteria 603
413 Ga0496111_0349043 3300048914 Bacteria 1095
414 Ga0496112_0355749 3300048915 Bacteria 1407
415 Ga0496112_0360998 3300048915 Bacteria 1394
416 Ga0496114_1214863 3300048917 Bacteria 640
417 Ga0496115_0011688 3300048918 Bacteria 6590
418 Ga0496115_0154658 3300048918 Bacteria 1894
419 Ga0496115_0389472 3300048918 Bacteria 1132
420 Ga0496115_0501291 3300048918 Bacteria 976
421 Ga0496118_0129942 3300048921 Bacteria 1620
422 Ga0496121_0031162 3300048924 Bacteria 4878
423 Ga0496121_0039727 3300048924 Bacteria 4139
424 Ga0496121_0085855 3300048924 Bacteria 2476
425 Ga0496124_0311195 3300048927 Bacteria 1132
426 Ga0496125_0489428 3300048928 Bacteria 695
427 Ga0496126_0047348 3300048929 Bacteria 3936
428 Ga0496126_0071118 3300048929 Bacteria 3098
429 Ga0496126_0207409 3300048929 Bacteria 1651
430 Ga0496126_0233072 3300048929 Bacteria 1542
431 Ga0496126_0683213 3300048929 Bacteria 800
432 Ga0501067_0094119 3300049583 Bacteria 1663
433 Ga0501073_0061549 3300049589 Bacteria 2619
434 Ga0501076_0621865 3300049592 Bacteria 891
435 Ga0501076_1491393 3300049592 Bacteria 555
436 Ga0501077_0361572 3300049593 Bacteria 927
437 Ga0501080_0057197 3300049742 Bacteria 3631
438 Ga0501262_000257 3300049759 Bacteria 6460
439 nmdc:mga03683_22906_c1 3300050489 Bacteria 2426
440 nmdc:mga03683_351328_c1 3300050489 Bacteria 698
441 nmdc:mga03n38_35704_c1 3300050490 Bacteria 2132
442 nmdc:mga0k408_140930_c1 3300050493 Bacteria 1434
443 nmdc:mga06z11_313057_c1 3300050494 Bacteria 935
444 nmdc:mga06z11_920736_c1 3300050494 Bacteria 533
445 nmdc:mga07m45_143011_c1 3300050496 Bacteria 1386
446 nmdc:mga07m45_270_c1 3300050496 Bacteria 20991
447 nmdc:mga07m45_54913_c1 3300050496 Bacteria 2251
448 nmdc:mga05p37_2152333_c1 3300050507 Bacteria 520
449 nmdc:mga06r32_525785_c1 3300050510 Bacteria 1158
450 nmdc:mga0n895_281980_c1 3300050512 Bacteria 1685
451 nmdc:mga0n895_461788_c1 3300050512 Bacteria 1281
452 nmdc:mga0rr50_385098_c1 3300050513 Bacteria 1183
453 nmdc:mga08x19_323252_c1 3300050514 Bacteria 1074
454 nmdc:mga0sz30_40111_c1 3300050516 Bacteria 1967
455 Ga0495601_0003650 3300053077 Bacteria 8851
456 Ga0500610_0000564 3300053079 Bacteria 11399
457 Ga0500610_0004569 3300053079 Bacteria 5523
458 Ga0500610_0115824 3300053079 Bacteria 1374
459 Ga0495595_0000293 3300053084 Bacteria 19495
460 Ga0495619_0001314 3300053085 Bacteria 16317
461 Ga0495619_0095812 3300053085 Bacteria 2014
462 Ga0495619_0133206 3300053085 Bacteria 1708
463 Ga0500647_0178978 3300053091 Bacteria 974
464 Ga0500651_0000077 3300053093 Bacteria 62750
465 Ga0500650_0440826 3300053098 Bacteria 559
466 Ga0500560_040017 3300053107 Bacteria 1466
467 Ga0500572_164780 3300053111 Bacteria 726
468 Ga0500593_062155 3300053117 Bacteria 1638
469 Ga0500607_001827 3300053121 Bacteria 18349
470 Ga0500607_046107 3300053121 Bacteria 2337
471 Ga0500608_257106 3300053122 Bacteria 677
472 Ga0500626_033259 3300053128 Bacteria 2330
473 Ga0500658_0001391 3300053134 Bacteria 9766
474 Ga0500559_0012636 3300053136 Bacteria 3585
475 Ga0500574_081998 3300053141 Bacteria 951
476 Ga0500636_0165462 3300053177 Bacteria 1201
477 Ga0501084_0179246 3300054114 Bacteria 1789

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050494 nmdc:mga06z11_920736_c1 nmdc:mga06z11_920736_c1_177_512 99
2 3300005353 Ga0070669_101546781 Ga0070669_1015467811 103
3 3300006058 Ga0075432_10100441 Ga0075432_101004412 109
4 3300006177 Ga0075362_10118692 Ga0075362_101186922 109
5 3300006178 Ga0075367_10688977 Ga0075367_106889772 109
6 3300017792 Ga0163161_10040902 Ga0163161_100409024 109
7 3300025923 Ga0207681_11686263 Ga0207681_116862632 109
8 3300027907 Ga0207428_11253164 Ga0207428_112531642 109
9 3300032004 Ga0307414_12142727 Ga0307414_121427272 109
10 3300042002 Ga0439442_071686 Ga0439442_071686_85_459 109
11 3300042125 Ga0450923_001524 Ga0450923_001524_2287_2661 109
12 3300042145 Ga0450906_093999 Ga0450906_093999_94_468 109
13 3300042156 Ga0439446_0029296 Ga0439446_0029296_592_966 109
14 3300042435 Ga0439434_0013647 Ga0439434_0013647_1659_2033 109
15 3300025945 Ga0207679_11004957 Ga0207679_110049572 111
16 3300028380 Ga0268265_11006878 Ga0268265_110068782 111
17 3300048915 Ga0496112_0355749 Ga0496112_0355749_214_600 111
18 3300012500 Ga0157314_1038491 Ga0157314_10384912 114
19 3300031548 Ga0307408_100797813 Ga0307408_1007978131 114
20 3300005546 Ga0070696_101653088 Ga0070696_1016530881 115
21 3300006871 Ga0075434_100008357 Ga0075434_1000083574 115
22 3300007076 Ga0075435_100118501 Ga0075435_1001185014 115
23 3300050512 nmdc:mga0n895_281980_c1 nmdc:mga0n895_281980_c1_755_1126 115
24 3300050513 nmdc:mga0rr50_385098_c1 nmdc:mga0rr50_385098_c1_250_621 115
25 3300050514 nmdc:mga08x19_323252_c1 nmdc:mga08x19_323252_c1_596_967 115
26 iso_pu_bacteria 2876761206 2876767277 115
27 iso_pu_bacteria 8006926726 8006927510 115
28 3300006178 Ga0075367_10774380 Ga0075367_107743802 116
29 3300007265 Ga0099794_10088359 Ga0099794_100883591 116
30 3300021388 Ga0213875_10153543 Ga0213875_101535432 116
31 3300022730 Ga0224570_111074 Ga0224570_1110742 116
32 3300035695 Ga0373927_0273273 Ga0373927_0273273_32_406 116
33 3300037853 Ga0436364_1420335 Ga0436364_1420335_1091_1465 116
34 3300053098 Ga0500650_0440826 Ga0500650_0440826_38_412 116
35 iso_pu_bacteria 2928084124 2928087453 116
36 3300003659 JGI25404J52841_10044842 JGI25404J52841_100448422 117
37 3300003659 JGI25404J52841_10072088 JGI25404J52841_100720881 117
38 3300003659 JGI25404J52841_10138619 JGI25404J52841_101386191 117
39 3300005328 Ga0070676_11592013 Ga0070676_115920131 117
40 3300005334 Ga0068869_100002065 Ga0068869_10000206512 117
41 3300005338 Ga0068868_100091337 Ga0068868_1000913372 117
42 3300005347 Ga0070668_100152532 Ga0070668_1001525323 117
43 3300005365 Ga0070688_100253497 Ga0070688_1002534972 117
44 3300005441 Ga0070700_101719789 Ga0070700_1017197891 117
45 3300005456 Ga0070678_101579032 Ga0070678_1015790321 117
46 3300005458 Ga0070681_11790378 Ga0070681_117903781 117
47 3300005546 Ga0070696_100995730 Ga0070696_1009957302 117
48 3300005617 Ga0068859_102068577 Ga0068859_1020685772 117
49 3300005841 Ga0068863_100237842 Ga0068863_1002378421 117
50 3300005844 Ga0068862_101619546 Ga0068862_1016195462 117
51 3300005937 Ga0081455_10001090 Ga0081455_1000109026 117
52 3300005937 Ga0081455_10015632 Ga0081455_100156325 117
53 3300005937 Ga0081455_10030942 Ga0081455_100309423 117
54 3300005983 Ga0081540_1003684 Ga0081540_10036846 117
55 3300005983 Ga0081540_1009943 Ga0081540_10099439 117
56 3300005983 Ga0081540_1011144 Ga0081540_10111448 117
57 3300005983 Ga0081540_1015213 Ga0081540_10152133 117
58 3300005983 Ga0081540_1099047 Ga0081540_10990471 117
59 3300006028 Ga0070717_10015214 Ga0070717_100152146 117
60 3300006931 Ga0097620_102068344 Ga0097620_1020683442 117
61 3300009036 Ga0105244_10553341 Ga0105244_105533411 117
62 3300013307 Ga0157372_11276480 Ga0157372_112764802 117
63 3300017792 Ga0163161_10136291 Ga0163161_101362912 117
64 3300017792 Ga0163161_10158716 Ga0163161_101587163 117
65 3300025901 Ga0207688_10028086 Ga0207688_100280865 117
66 3300025907 Ga0207645_10156893 Ga0207645_101568932 117
67 3300025928 Ga0207700_10034156 Ga0207700_100341565 117
68 3300025928 Ga0207700_10128314 Ga0207700_101283142 117
69 3300025929 Ga0207664_10841929 Ga0207664_108419292 117
70 3300025942 Ga0207689_10003079 Ga0207689_100030796 117
71 3300026088 Ga0207641_10098704 Ga0207641_100987043 117
72 3300026121 Ga0207683_10474145 Ga0207683_104741452 117
73 3300028380 Ga0268265_10669595 Ga0268265_106695951 117
74 3300028380 Ga0268265_10675215 Ga0268265_106752152 117
75 3300028573 Ga0265334_10274831 Ga0265334_102748311 117
76 3300028794 Ga0307515_10462981 Ga0307515_104629812 117
77 3300031247 Ga0265340_10134279 Ga0265340_101342792 117
78 3300031249 Ga0265339_10003705 Ga0265339_1000370510 117
79 3300031616 Ga0307508_10227294 Ga0307508_102272942 117
80 3300033544 Ga0316215_1004414 Ga0316215_10044143 117
81 3300035692 Ga0373935_1332274 Ga0373935_1332274_36_419 117
82 3300036459 Ga0372808_003626 Ga0372808_003626_249_626 117
83 3300037068 Ga0373925_1564888 Ga0373925_1564888_10_393 117
84 3300037312 Ga0395899_0137366 Ga0395899_0137366_1113_1490 117
85 3300037312 Ga0395899_0377130 Ga0395899_0377130_226_600 117
86 3300037418 Ga0395900_0026139 Ga0395900_0026139_1536_1910 117
87 3300037418 Ga0395900_0102735 Ga0395900_0102735_226_603 117
88 3300037466 Ga0395898_0157014 Ga0395898_0157014_245_622 117
89 3300037466 Ga0395898_0549450 Ga0395898_0549450_75_458 117
90 3300037471 Ga0395905_0288998 Ga0395905_0288998_96_473 117
91 3300038443 Ga0395901_0162005 Ga0395901_0162005_951_1325 117
92 3300041459 Ga0451800_1601918 Ga0451800_1601918_131_514 117
93 3300041997 Ga0439431_0187809 Ga0439431_0187809_67_495 117
94 3300044693 Ga0466961_0508902 Ga0466961_0508902_270_647 117
95 3300044694 Ga0466963_0007897 Ga0466963_0007897_3526_3900 117
96 3300044842 Ga0466957_0098062 Ga0466957_0098062_655_1029 117
97 3300045049 Ga0466959_0550443 Ga0466959_0550443_335_709 117
98 3300045976 Ga0466967_0000256 Ga0466967_0000256_5627_6001 117
99 3300046528 Ga0495642_0304148 Ga0495642_0304148_85_468 117
100 3300046557 Ga0495622_0192589 Ga0495622_0192589_86_439 117
101 3300046616 Ga0495668_0174322 Ga0495668_0174322_200_583 117
102 3300046675 Ga0495657_0102290 Ga0495657_0102290_1060_1443 117
103 3300046683 Ga0495658_0034082 Ga0495658_0034082_991_1344 117
104 3300046690 Ga0495624_0070090 Ga0495624_0070090_318_671 117
105 3300047315 Ga0495581_0267990 Ga0495581_0267990_550_933 117
106 3300048089 Ga0495614_0204877 Ga0495614_0204877_149_502 117
107 3300048918 Ga0496115_0011688 Ga0496115_0011688_3596_3979 117
108 3300048921 Ga0496118_0129942 Ga0496118_0129942_514_897 117
109 3300048924 Ga0496121_0031162 Ga0496121_0031162_486_869 117
110 3300048924 Ga0496121_0039727 Ga0496121_0039727_3263_3646 117
111 3300048924 Ga0496121_0085855 Ga0496121_0085855_1601_1975 117
112 3300048927 Ga0496124_0311195 Ga0496124_0311195_41_424 117
113 3300048928 Ga0496125_0489428 Ga0496125_0489428_243_626 117
114 3300048929 Ga0496126_0047348 Ga0496126_0047348_1812_2195 117
115 3300048929 Ga0496126_0071118 Ga0496126_0071118_1419_1772 117
116 3300049583 Ga0501067_0094119 Ga0501067_0094119_477_860 117
117 3300049589 Ga0501073_0061549 Ga0501073_0061549_116_499 117
118 3300049592 Ga0501076_0621865 Ga0501076_0621865_201_584 117
119 3300049592 Ga0501076_1491393 Ga0501076_1491393_41_424 117
120 3300049593 Ga0501077_0361572 Ga0501077_0361572_500_883 117
121 3300049742 Ga0501080_0057197 Ga0501080_0057197_2358_2741 117
122 3300050512 nmdc:mga0n895_461788_c1 nmdc:mga0n895_461788_c1_113_496 117
123 3300053093 Ga0500651_0000077 Ga0500651_0000077_25171_25524 117
124 3300053107 Ga0500560_040017 Ga0500560_040017_551_904 117
125 3300053111 Ga0500572_164780 Ga0500572_164780_276_629 117
126 3300053128 Ga0500626_033259 Ga0500626_033259_1576_1929 117
127 3300053134 Ga0500658_0001391 Ga0500658_0001391_6614_6967 117
128 3300053136 Ga0500559_0012636 Ga0500559_0012636_1605_1958 117
129 3300053141 Ga0500574_081998 Ga0500574_081998_392_745 117
130 3300053177 Ga0500636_0165462 Ga0500636_0165462_664_1047 117
131 3300054114 Ga0501084_0179246 Ga0501084_0179246_80_463 117
132 iso_pu_bacteria 2904449895 2904450258 117
133 iso_pu_bacteria 2904456579 2904456919 117
134 iso_pu_bacteria 2945909444 2945913368 117
135 iso_pu_bacteria 2945945610 2945948919 117
136 iso_pu_bacteria 2945984333 2945984402 117
137 3300005327 Ga0070658_10542588 Ga0070658_105425882 118
138 3300005329 Ga0070683_100581080 Ga0070683_1005810802 118
139 3300005336 Ga0070680_100273493 Ga0070680_1002734932 118
140 3300005339 Ga0070660_100147482 Ga0070660_1001474822 118
141 3300005344 Ga0070661_100301785 Ga0070661_1003017852 118
142 3300005353 Ga0070669_100170228 Ga0070669_1001702281 118
143 3300005353 Ga0070669_100534989 Ga0070669_1005349892 118
144 3300005436 Ga0070713_101550402 Ga0070713_1015504021 118
145 3300005456 Ga0070678_100219230 Ga0070678_1002192303 118
146 3300005458 Ga0070681_10561256 Ga0070681_105612561 118
147 3300005458 Ga0070681_10561260 Ga0070681_105612601 118
148 3300005530 Ga0070679_100497303 Ga0070679_1004973031 118
149 3300005535 Ga0070684_100365318 Ga0070684_1003653182 118
150 3300005539 Ga0068853_100016363 Ga0068853_1000163634 118
151 3300005563 Ga0068855_101139760 Ga0068855_1011397602 118
152 3300005564 Ga0070664_100531743 Ga0070664_1005317432 118
153 3300005577 Ga0068857_100023817 Ga0068857_1000238172 118
154 3300005618 Ga0068864_100379228 Ga0068864_1003792282 118
155 3300005840 Ga0068870_10084427 Ga0068870_100844272 118
156 3300005844 Ga0068862_100347736 Ga0068862_1003477362 118
157 3300005983 Ga0081540_1016250 Ga0081540_10162502 118
158 3300005983 Ga0081540_1119142 Ga0081540_11191422 118
159 3300006175 Ga0070712_101161248 Ga0070712_1011612482 118
160 3300006186 Ga0075369_10287464 Ga0075369_102874642 118
161 3300006195 Ga0075366_10258563 Ga0075366_102585632 118
162 3300006881 Ga0068865_100511569 Ga0068865_1005115691 118
163 3300007788 Ga0099795_10001817 Ga0099795_100018172 118
164 3300007788 Ga0099795_10343271 Ga0099795_103432711 118
165 3300009093 Ga0105240_10100450 Ga0105240_101004505 118
166 3300009094 Ga0111539_10530989 Ga0111539_105309892 118
167 3300010159 Ga0099796_10018315 Ga0099796_100183152 118
168 3300011119 Ga0105246_10645964 Ga0105246_106459642 118
169 3300013105 Ga0157369_10056151 Ga0157369_100561516 118
170 3300014326 Ga0157380_10197962 Ga0157380_101979621 118
171 3300014745 Ga0157377_10341275 Ga0157377_103412752 118
172 3300014969 Ga0157376_10798479 Ga0157376_107984792 118
173 3300020070 Ga0206356_11131140 Ga0206356_111311402 118
174 3300020082 Ga0206353_10806980 Ga0206353_108069801 118
175 3300023660 Ga0247550_102964 Ga0247550_1029641 118
176 3300025908 Ga0207643_10038916 Ga0207643_100389162 118
177 3300025909 Ga0207705_10075729 Ga0207705_100757294 118
178 3300025909 Ga0207705_10665376 Ga0207705_106653762 118
179 3300025912 Ga0207707_10020556 Ga0207707_100205566 118
180 3300025913 Ga0207695_10495628 Ga0207695_104956282 118
181 3300025914 Ga0207671_10544129 Ga0207671_105441292 118
182 3300025915 Ga0207693_10529987 Ga0207693_105299872 118
183 3300025917 Ga0207660_10120129 Ga0207660_101201292 118
184 3300025919 Ga0207657_10002034 Ga0207657_1000203411 118
185 3300025920 Ga0207649_11041999 Ga0207649_110419992 118
186 3300025923 Ga0207681_10033358 Ga0207681_100333584 118
187 3300025923 Ga0207681_10332140 Ga0207681_103321402 118
188 3300025925 Ga0207650_10414194 Ga0207650_104141942 118
189 3300025926 Ga0207659_10401752 Ga0207659_104017522 118
190 3300025934 Ga0207686_10660773 Ga0207686_106607732 118
191 3300025944 Ga0207661_10697129 Ga0207661_106971292 118
192 3300025949 Ga0207667_10505987 Ga0207667_105059872 118
193 3300025949 Ga0207667_10562025 Ga0207667_105620252 118
194 3300025960 Ga0207651_10554381 Ga0207651_105543812 118
195 3300025972 Ga0207668_10014133 Ga0207668_100141335 118
196 3300026075 Ga0207708_10687727 Ga0207708_106877272 118
197 3300026095 Ga0207676_10287365 Ga0207676_102873653 118
198 3300026121 Ga0207683_10079737 Ga0207683_100797374 118
199 3300026142 Ga0207698_12219938 Ga0207698_122199382 118
200 3300027512 Ga0209179_1008482 Ga0209179_10084822 118
201 3300028380 Ga0268265_10023170 Ga0268265_100231704 118
202 3300028380 Ga0268265_10309955 Ga0268265_103099552 118
203 3300028794 Ga0307515_10353614 Ga0307515_103536142 118
204 3300030763 Ga0265763_1052980 Ga0265763_10529801 118
205 3300031235 Ga0265330_10009220 Ga0265330_100092203 118
206 3300031235 Ga0265330_10435248 Ga0265330_104352481 118
207 3300031247 Ga0265340_10003262 Ga0265340_100032627 118
208 3300031344 Ga0265316_10214372 Ga0265316_102143722 118
209 3300031712 Ga0265342_10571514 Ga0265342_105715142 118
210 3300035086 Ga0373934_0005971 Ga0373934_0005971_98_484 118
211 3300035111 Ga0373923_0006964 Ga0373923_0006964_2813_3199 118
212 3300035111 Ga0373923_0123862 Ga0373923_0123862_507_896 118
213 3300035117 Ga0373953_0000126 Ga0373953_0000126_10697_11083 118
214 3300035117 Ga0373953_0043041 Ga0373953_0043041_924_1310 118
215 3300035118 Ga0373954_0001939 Ga0373954_0001939_811_1197 118
216 3300035118 Ga0373954_0023399 Ga0373954_0023399_183_569 118
217 3300035119 Ga0373956_0000764 Ga0373956_0000764_6343_6729 118
218 3300035119 Ga0373956_0125227 Ga0373956_0125227_659_1045 118
219 3300035119 Ga0373956_0224736 Ga0373956_0224736_320_709 118
220 3300035120 Ga0373957_0000307 Ga0373957_0000307_3817_4203 118
221 3300035120 Ga0373957_0114969 Ga0373957_0114969_176_562 118
222 3300035121 Ga0373960_0272494 Ga0373960_0272494_11_394 118
223 3300035170 Ga0373943_0096199 Ga0373943_0096199_168_557 118
224 3300035171 Ga0373946_0027086 Ga0373946_0027086_1335_1724 118
225 3300035172 Ga0373955_0001379 Ga0373955_0001379_7623_8009 118
226 3300035172 Ga0373955_0155023 Ga0373955_0155023_215_604 118
227 3300035410 Ga0373924_0000464 Ga0373924_0000464_5987_6373 118
228 3300035410 Ga0373924_0089994 Ga0373924_0089994_635_1021 118
229 3300035410 Ga0373924_0092186 Ga0373924_0092186_124_513 118
230 3300035691 Ga0373931_0153034 Ga0373931_0153034_676_1059 118
231 3300035692 Ga0373935_0008277 Ga0373935_0008277_1358_1747 118
232 3300035695 Ga0373927_0000970 Ga0373927_0000970_1993_2382 118
233 3300035724 Ga0373933_0000007 Ga0373933_0000007_68383_68772 118
234 3300035724 Ga0373933_0000600 Ga0373933_0000600_9120_9506 118
235 3300035724 Ga0373933_0074677 Ga0373933_0074677_1108_1494 118
236 3300035725 Ga0373947_0004082 Ga0373947_0004082_7530_7919 118
237 3300036401 Ga0373937_0005936 Ga0373937_0005936_2437_2823 118
238 3300036401 Ga0373937_0035052 Ga0373937_0035052_2598_2987 118
239 3300036401 Ga0373937_0052926 Ga0373937_0052926_34_420 118
240 3300037068 Ga0373925_0005246 Ga0373925_0005246_7783_8172 118
241 3300037466 Ga0395898_0849983 Ga0395898_0849983_132_521 118
242 3300038443 Ga0395901_0586486 Ga0395901_0586486_654_1043 118
243 3300041410 Ga0439461_0026298 Ga0439461_0026298_103_510 118
244 3300041456 Ga0451795_0820344 Ga0451795_0820344_296_682 118
245 3300041460 Ga0451802_0537002 Ga0451802_0537002_534_920 118
246 3300041509 Ga0451843_0625670 Ga0451843_0625670_130_519 118
247 3300046454 Ga0495592_0000570 Ga0495592_0000570_11183_11569 118
248 3300046454 Ga0495592_0015153 Ga0495592_0015153_3483_3872 118
249 3300046454 Ga0495592_0304258 Ga0495592_0304258_153_539 118
250 3300046455 Ga0495603_0000160 Ga0495603_0000160_5576_5965 118
251 3300046459 Ga0495629_0000155 Ga0495629_0000155_35068_35457 118
252 3300046459 Ga0495629_0020883 Ga0495629_0020883_1000_1386 118
253 3300046459 Ga0495629_0051829 Ga0495629_0051829_283_669 118
254 3300046461 Ga0495641_0005974 Ga0495641_0005974_1644_2033 118
255 3300046462 Ga0495651_0006357 Ga0495651_0006357_889_1275 118
256 3300046462 Ga0495651_0068037 Ga0495651_0068037_976_1362 118
257 3300046463 Ga0495653_0002759 Ga0495653_0002759_12115_12501 118
258 3300046463 Ga0495653_0028755 Ga0495653_0028755_3953_4339 118
259 3300046463 Ga0495653_0099524 Ga0495653_0099524_216_605 118
260 3300046472 Ga0495580_0000417 Ga0495580_0000417_17156_17545 118
261 3300046473 Ga0495582_0000125 Ga0495582_0000125_32790_33179 118
262 3300046475 Ga0495639_0000021 Ga0495639_0000021_58850_59239 118
263 3300046476 Ga0495662_0000303 Ga0495662_0000303_9098_9487 118
264 3300046477 Ga0495664_0011504 Ga0495664_0011504_4028_4417 118
265 3300046477 Ga0495664_0039234 Ga0495664_0039234_418_804 118
266 3300046499 Ga0495594_0000042 Ga0495594_0000042_24535_24924 118
267 3300046511 Ga0495608_0003962 Ga0495608_0003962_1638_2024 118
268 3300046511 Ga0495608_0303882 Ga0495608_0303882_57_446 118
269 3300046514 Ga0495618_0063376 Ga0495618_0063376_979_1368 118
270 3300046514 Ga0495618_0074272 Ga0495618_0074272_1450_1836 118
271 3300046516 Ga0495628_0009664 Ga0495628_0009664_3456_3842 118
272 3300046516 Ga0495628_0018360 Ga0495628_0018360_2052_2441 118
273 3300046517 Ga0495630_0004542 Ga0495630_0004542_4875_5264 118
274 3300046517 Ga0495630_0068005 Ga0495630_0068005_1873_2259 118
275 3300046526 Ga0495666_0010593 Ga0495666_0010593_3382_3771 118
276 3300046529 Ga0495652_0003587 Ga0495652_0003587_7150_7536 118
277 3300046529 Ga0495652_0168350 Ga0495652_0168350_1173_1559 118
278 3300046531 Ga0495665_0000062 Ga0495665_0000062_32648_33037 118
279 3300046533 Ga0495640_0008019 Ga0495640_0008019_6923_7309 118
280 3300046533 Ga0495640_0010884 Ga0495640_0010884_1676_2065 118
281 3300046533 Ga0495640_0327443 Ga0495640_0327443_94_480 118
282 3300046536 Ga0495587_0002145 Ga0495587_0002145_9907_10293 118
283 3300046543 Ga0495645_0007470 Ga0495645_0007470_6851_7237 118
284 3300046543 Ga0495645_0073494 Ga0495645_0073494_866_1252 118
285 3300046543 Ga0495645_0439822 Ga0495645_0439822_58_447 118
286 3300046557 Ga0495622_0001788 Ga0495622_0001788_10035_10424 118
287 3300046559 Ga0495667_0000747 Ga0495667_0000747_9372_9758 118
288 3300046642 Ga0495634_0000798 Ga0495634_0000798_5448_5837 118
289 3300046642 Ga0495634_0014453 Ga0495634_0014453_1493_1879 118
290 3300046663 Ga0495635_0000532 Ga0495635_0000532_7095_7481 118
291 3300046663 Ga0495635_0000926 Ga0495635_0000926_5883_6272 118
292 3300046663 Ga0495635_0014444 Ga0495635_0014444_2737_3123 118
293 3300046674 Ga0495588_0100264 Ga0495588_0100264_460_849 118
294 3300046675 Ga0495657_0002564 Ga0495657_0002564_7294_7680 118
295 3300046678 Ga0495599_0000394 Ga0495599_0000394_8978_9364 118
296 3300046678 Ga0495599_0476062 Ga0495599_0476062_187_573 118
297 3300046679 Ga0495623_0003632 Ga0495623_0003632_7371_7757 118
298 3300046680 Ga0495646_0000916 Ga0495646_0000916_3251_3637 118
299 3300046680 Ga0495646_0012286 Ga0495646_0012286_1376_1765 118
300 3300046681 Ga0495647_0001909 Ga0495647_0001909_297_686 118
301 3300046683 Ga0495658_0004264 Ga0495658_0004264_5575_5964 118
302 3300046683 Ga0495658_0018615 Ga0495658_0018615_159_542 118
303 3300046683 Ga0495658_0724061 Ga0495658_0724061_35_421 118
304 3300046689 Ga0495613_0003945 Ga0495613_0003945_5448_5837 118
305 3300046689 Ga0495613_0017041 Ga0495613_0017041_3553_3939 118
306 3300046690 Ga0495624_0000320 Ga0495624_0000320_2667_3056 118
307 3300046809 Ga0495600_0002273 Ga0495600_0002273_3191_3577 118
308 3300046809 Ga0495600_0161589 Ga0495600_0161589_1020_1409 118
309 3300046809 Ga0495600_0381276 Ga0495600_0381276_206_592 118
310 3300047315 Ga0495581_0000239 Ga0495581_0000239_24964_25353 118
311 3300047317 Ga0495604_0037770 Ga0495604_0037770_3337_3723 118
312 3300047317 Ga0495604_0042010 Ga0495604_0042010_762_1148 118
313 3300047317 Ga0495604_0132572 Ga0495604_0132572_1369_1755 118
314 3300047317 Ga0495604_0740544 Ga0495604_0740544_177_563 118
315 3300047319 Ga0495674_0001066 Ga0495674_0001066_1112_1501 118
316 3300047319 Ga0495674_0007646 Ga0495674_0007646_5046_5432 118
317 3300047319 Ga0495674_0020210 Ga0495674_0020210_3694_4080 118
318 3300047321 Ga0495676_0035232 Ga0495676_0035232_3114_3503 118
319 3300047322 Ga0495680_0003634 Ga0495680_0003634_1638_2024 118
320 3300047322 Ga0495680_0016672 Ga0495680_0016672_4390_4779 118
321 3300047322 Ga0495680_0244445 Ga0495680_0244445_703_1089 118
322 3300047444 Ga0495675_0001271 Ga0495675_0001271_11987_12373 118
323 3300047469 Ga0495673_0047925 Ga0495673_0047925_705_1106 118
324 3300047471 Ga0495684_0001102 Ga0495684_0001102_11986_12372 118
325 3300047471 Ga0495684_0056123 Ga0495684_0056123_1214_1600 118
326 3300047673 Ga0495593_0000013 Ga0495593_0000013_24958_25347 118
327 3300047673 Ga0495593_0000928 Ga0495593_0000928_8180_8566 118
328 3300047673 Ga0495593_0165373 Ga0495593_0165373_171_557 118
329 3300048088 Ga0495602_0003533 Ga0495602_0003533_7688_8074 118
330 3300048088 Ga0495602_0557296 Ga0495602_0557296_366_752 118
331 3300048089 Ga0495614_0011966 Ga0495614_0011966_328_717 118
332 3300048904 Ga0496101_1171086 Ga0496101_1171086_100_483 118
333 3300048914 Ga0496111_0349043 Ga0496111_0349043_463_855 118
334 3300048915 Ga0496112_0360998 Ga0496112_0360998_507_899 118
335 3300048917 Ga0496114_1214863 Ga0496114_1214863_108_494 118
336 3300048918 Ga0496115_0154658 Ga0496115_0154658_865_1251 118
337 3300048918 Ga0496115_0389472 Ga0496115_0389472_302_688 118
338 3300048918 Ga0496115_0501291 Ga0496115_0501291_528_911 118
339 3300048929 Ga0496126_0207409 Ga0496126_0207409_644_1030 118
340 3300048929 Ga0496126_0233072 Ga0496126_0233072_888_1274 118
341 3300050507 nmdc:mga05p37_2152333_c1 nmdc:mga05p37_2152333_c1_76_465 118
342 3300053077 Ga0495601_0003650 Ga0495601_0003650_2294_2680 118
343 3300053084 Ga0495595_0000293 Ga0495595_0000293_2321_2707 118
344 3300053085 Ga0495619_0001314 Ga0495619_0001314_3817_4203 118
345 3300053085 Ga0495619_0095812 Ga0495619_0095812_324_713 118
346 3300053085 Ga0495619_0133206 Ga0495619_0133206_620_1006 118
347 3300005327 Ga0070658_10467761 Ga0070658_104677611 119
348 3300005327 Ga0070658_10639979 Ga0070658_106399791 119
349 3300005339 Ga0070660_100041315 Ga0070660_1000413153 119
350 3300005364 Ga0070673_100798953 Ga0070673_1007989532 119
351 3300005455 Ga0070663_100957276 Ga0070663_1009572762 119
352 3300005458 Ga0070681_10600548 Ga0070681_106005482 119
353 3300005530 Ga0070679_100479789 Ga0070679_1004797892 119
354 3300005539 Ga0068853_100508779 Ga0068853_1005087792 119
355 3300005577 Ga0068857_101566600 Ga0068857_1015666002 119
356 3300005841 Ga0068863_101751424 Ga0068863_1017514242 119
357 3300005843 Ga0068860_101038295 Ga0068860_1010382952 119
358 3300006358 Ga0068871_100064472 Ga0068871_1000644722 119
359 3300009177 Ga0105248_10216540 Ga0105248_102165401 119
360 3300009551 Ga0105238_10055443 Ga0105238_100554433 119
361 3300009551 Ga0105238_10560411 Ga0105238_105604112 119
362 3300013100 Ga0157373_10038216 Ga0157373_100382165 119
363 3300025917 Ga0207660_10221611 Ga0207660_102216112 119
364 3300025919 Ga0207657_10005543 Ga0207657_1000554315 119
365 3300025921 Ga0207652_10098428 Ga0207652_100984284 119
366 3300025949 Ga0207667_10702660 Ga0207667_107026602 119
367 3300026041 Ga0207639_10549393 Ga0207639_105493932 119
368 3300026095 Ga0207676_10884459 Ga0207676_108844592 119
369 3300028381 Ga0268264_11440915 Ga0268264_114409152 119
370 3300048929 Ga0496126_0683213 Ga0496126_0683213_170_553 119
371 3300005458 Ga0070681_11733629 Ga0070681_117336291 120
372 3300005841 Ga0068863_102241519 Ga0068863_1022415192 120
373 3300013102 Ga0157371_10200730 Ga0157371_102007302 120
374 3300013105 Ga0157369_10448575 Ga0157369_104485751 120
375 3300025912 Ga0207707_11338933 Ga0207707_113389332 120
376 3300026088 Ga0207641_11640753 Ga0207641_116407532 120
377 3300028794 Ga0307515_10223405 Ga0307515_102234052 120
378 3300031548 Ga0307408_100003804 Ga0307408_10000380411 120
379 3300031649 Ga0307514_10145193 Ga0307514_101451932 120
380 3300031731 Ga0307405_10371261 Ga0307405_103712612 120
381 3300031731 Ga0307405_10415003 Ga0307405_104150032 120
382 3300031901 Ga0307406_10001303 Ga0307406_100013038 120
383 3300031911 Ga0307412_11043223 Ga0307412_110432231 120
384 3300037418 Ga0395900_0062888 Ga0395900_0062888_552_938 120
385 3300037466 Ga0395898_0285439 Ga0395898_0285439_839_1225 120
386 3300037466 Ga0395898_0508501 Ga0395898_0508501_98_484 120
387 3300038443 Ga0395901_0692828 Ga0395901_0692828_433_819 120
388 3300041411 Ga0439466_0124410 Ga0439466_0124410_120_491 120
389 3300041443 Ga0451789_0218353 Ga0451789_0218353_52_414 120
390 3300046512 Ga0495610_0112470 Ga0495610_0112470_29_391 120
391 3300046524 Ga0495648_0401807 Ga0495648_0401807_109_471 120
392 3300046538 Ga0495609_0344788 Ga0495609_0344788_31_393 120
393 3300046660 Ga0495625_0170976 Ga0495625_0170976_689_1051 120
394 3300046665 Ga0495661_0147469 Ga0495661_0147469_25_387 120
395 3300046691 Ga0495670_0084063 Ga0495670_0084063_728_1090 120
396 3300046810 Ga0495660_0044649 Ga0495660_0044649_2001_2363 120
397 3300053079 Ga0500610_0000564 Ga0500610_0000564_6371_6733 120
398 3300053079 Ga0500610_0115824 Ga0500610_0115824_763_1125 120
399 3300003187 JGI25151J46595_10002286 JGI25151J46595_1000228611 121
400 3300003578 Ga0006562J51391_1118683 Ga0006562J51391_11186832 121
401 3300003784 Ga0055534_1000131 Ga0055534_100013147 121
402 3300003790 Ga0055528_1000629 Ga0055528_100062917 121
403 3300003792 Ga0055540_1003935 Ga0055540_10039352 121
404 3300005288 Ga0065714_10073651 Ga0065714_100736514 121
405 3300005844 Ga0068862_101517254 Ga0068862_1015172541 121
406 3300006048 Ga0075363_100071543 Ga0075363_1000715432 121
407 3300006051 Ga0075364_10140927 Ga0075364_101409273 121
408 3300006177 Ga0075362_10126104 Ga0075362_101261042 121
409 3300006177 Ga0075362_10298692 Ga0075362_102986922 121
410 3300006178 Ga0075367_10148003 Ga0075367_101480032 121
411 3300006178 Ga0075367_11041072 Ga0075367_110410721 121
412 3300006186 Ga0075369_10053401 Ga0075369_100534013 121
413 3300006195 Ga0075366_10094551 Ga0075366_100945513 121
414 3300006353 Ga0075370_10000206 Ga0075370_1000020611 121
415 3300006353 Ga0075370_10067662 Ga0075370_100676622 121
416 3300006353 Ga0075370_10147548 Ga0075370_101475481 121
417 3300006948 Ga0099826_10002606 Ga0099826_1000260613 121
418 3300006948 Ga0099826_10262593 Ga0099826_102625931 121
419 3300009148 Ga0105243_10167508 Ga0105243_101675083 121
420 3300011119 Ga0105246_10135266 Ga0105246_101352662 121
421 3300013100 Ga0157373_10007173 Ga0157373_100071739 121
422 3300013104 Ga0157370_10017546 Ga0157370_100175461 121
423 3300014497 Ga0182008_10005232 Ga0182008_100052329 121
424 3300014497 Ga0182008_10019984 Ga0182008_100199842 121
425 3300015261 Ga0182006_1046533 Ga0182006_10465332 121
426 3300015261 Ga0182006_1119574 Ga0182006_11195742 121
427 3300017792 Ga0163161_10003921 Ga0163161_1000392111 121
428 3300025258 Ga0209129_1008320 Ga0209129_10083205 121
429 3300025263 Ga0209565_1000188 Ga0209565_100018867 121
430 3300025263 Ga0209565_1030056 Ga0209565_10300562 121
431 3300025273 Ga0209673_1000411 Ga0209673_100041167 121
432 3300025273 Ga0209673_1017672 Ga0209673_10176723 121
433 3300025291 Ga0209675_1000172 Ga0209675_100017267 121
434 3300025292 Ga0209676_1047304 Ga0209676_10473042 121
435 3300025292 Ga0209676_1060522 Ga0209676_10605222 121
436 3300025294 Ga0209025_1000424 Ga0209025_100042412 121
437 3300025303 Ga0209051_1000240 Ga0209051_100024060 121
438 3300025935 Ga0207709_10018188 Ga0207709_100181882 121
439 3300028380 Ga0268265_10100339 Ga0268265_101003392 121
440 3300030742 Ga0316183_1170808 Ga0316183_11708086 121
441 3300030744 Ga0316181_1023342 Ga0316181_10233422 121
442 3300031548 Ga0307408_100114823 Ga0307408_1001148233 121
443 3300031548 Ga0307408_100348711 Ga0307408_1003487112 121
444 3300031548 Ga0307408_100842086 Ga0307408_1008420862 121
445 3300031548 Ga0307408_101235366 Ga0307408_1012353661 121
446 3300031548 Ga0307408_101460511 Ga0307408_1014605112 121
447 3300031731 Ga0307405_10125917 Ga0307405_101259172 121
448 3300031824 Ga0307413_10090621 Ga0307413_100906213 121
449 3300031901 Ga0307406_10195379 Ga0307406_101953792 121
450 3300031911 Ga0307412_10058104 Ga0307412_100581042 121
451 3300031911 Ga0307412_10081458 Ga0307412_100814581 121
452 3300031911 Ga0307412_12032207 Ga0307412_120322071 121
453 3300032002 Ga0307416_100338910 Ga0307416_1003389102 121
454 3300032002 Ga0307416_100568419 Ga0307416_1005684191 121
455 3300032004 Ga0307414_10487393 Ga0307414_104873932 121
456 3300032004 Ga0307414_11000939 Ga0307414_110009391 121
457 3300032004 Ga0307414_11673492 Ga0307414_116734921 121
458 3300032005 Ga0307411_10063162 Ga0307411_100631622 121
459 3300032005 Ga0307411_10476693 Ga0307411_104766932 121
460 3300039450 Ga0436363_1111216 Ga0436363_1111216_155_544 121
461 3300041411 Ga0439466_0040894 Ga0439466_0040894_472_846 121
462 3300041452 Ga0451793_0071301 Ga0451793_0071301_75_440 121
463 3300041460 Ga0451802_0555933 Ga0451802_0555933_135_503 121
464 3300042123 Ga0450921_001253 Ga0450921_001253_959_1333 121
465 3300046515 Ga0495620_0130618 Ga0495620_0130618_297_662 121
466 3300046674 Ga0495588_0378668 Ga0495588_0378668_152_526 121
467 3300046692 Ga0495671_0049174 Ga0495671_0049174_76_441 121
468 3300048904 Ga0496101_0098952 Ga0496101_0098952_404_793 121
469 3300049759 Ga0501262_000257 Ga0501262_000257_49_423 121
470 3300050489 nmdc:mga03683_22906_c1 nmdc:mga03683_22906_c1_1188_1565 121
471 3300050489 nmdc:mga03683_351328_c1 nmdc:mga03683_351328_c1_44_418 121
472 3300050490 nmdc:mga03n38_35704_c1 nmdc:mga03n38_35704_c1_1451_1825 121
473 3300050493 nmdc:mga0k408_140930_c1 nmdc:mga0k408_140930_c1_10_375 121
474 3300050494 nmdc:mga06z11_313057_c1 nmdc:mga06z11_313057_c1_145_519 121
475 3300050496 nmdc:mga07m45_143011_c1 nmdc:mga07m45_143011_c1_43_417 121
476 3300050496 nmdc:mga07m45_270_c1 nmdc:mga07m45_270_c1_10513_10887 121
477 3300050496 nmdc:mga07m45_54913_c1 nmdc:mga07m45_54913_c1_901_1266 121
478 3300050510 nmdc:mga06r32_525785_c1 nmdc:mga06r32_525785_c1_552_1067 121
479 3300050516 nmdc:mga0sz30_40111_c1 nmdc:mga0sz30_40111_c1_324_701 121
480 3300053079 Ga0500610_0004569 Ga0500610_0004569_4393_4758 121
481 3300053091 Ga0500647_0178978 Ga0500647_0178978_118_486 121
482 3300053117 Ga0500593_062155 Ga0500593_062155_706_1071 121
483 3300053121 Ga0500607_001827 Ga0500607_001827_8029_8394 121
484 3300053121 Ga0500607_046107 Ga0500607_046107_541_909 121
485 3300053122 Ga0500608_257106 Ga0500608_257106_60_428 121
486 iso_pu_bacteria 2842677519 2842677982 121
487 iso_pu_bacteria 2919462493 2919463296 121

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF21006

NHase_beta_N

Nitrile hydratase beta subunit, N-terminal

11

114

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
4fm4-assembly7.cif.gz_N wild type fe-type nitrile hydratase from comamonas testosteroni ni1 0.6405 11 116
3qz9-assembly4.cif.gz_H crystal structure of co-type nitrile hydratase beta-y215f from pseudomonas putida. 0.622 3 114
3qxe-assembly3.cif.gz_F crystal structure of co-type nitrile hydratase from pseudomonas putida. 0.6203 3 114
3qyg-assembly4.cif.gz_H crystal structure of co-type nitrile hydratase beta-e56q from pseudomonas putida. 0.6102 1 114
3qyh-assembly2.cif.gz_D crystal structure of co-type nitrile hydratase beta-h71l from pseudomonas putida. 0.6098 1 114
ID Description Score Start End Superfamily
3qxeB01 Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Nitrile hydratase, beta subunit 0.6093 1 114 1.10.472.20
4fm4B01 Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Nitrile hydratase, beta subunit 0.5568 1 116 1.10.472.20
4fm4B01 Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Nitrile hydratase, beta subunit 0.552 1 116 1.10.472.20
1ireB01 Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Nitrile hydratase, beta subunit 0.5173 3 118 1.10.472.20
3qxeB01 Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Nitrile hydratase, beta subunit 0.4961 1 114 1.10.472.20
ID Description Score Start End GO Terms
AF-I3THQ4-F1-model_v4 Nitrile hydratase beta subunit-like N-terminal domain-containing protein 0.9025 2 85
AF-A0A1E4ZL45-F1-model_v4 Nitrile hydratase accessory protein 0.8793 10 84
AF-A0A7T8ME00-F1-model_v4 deleted 0.8718 11 91
AF-A0A537WK21-F1-model_v4 Nitrile hydratase accessory protein 0.8572 8 87
AF-A0A382Z3Z7-F1-model_v4 Nitrile hydratase beta subunit-like N-terminal domain-containing protein 0.851 11 84

Feature Viewer

pLDDT pTM Quality
84.03 0.58 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map