F453430

General Info

Members Datasets Scaffolds Average Seq Length
487 297 441 286

Family's Representative Sequence

Representative Sequence 3300006844|Ga0075428_100018726|Ga0075428_1000187262
Length 266
Sequence MRQLKIFKQITNRETQSLDKYLQEIGKIDLITADEEVRLTQRIKEGDQGALDKMVKANLRFVVSVAKQYQNQGLSLGDLINEGNVGLVKAAMRFDETRGFKFISYAVWWIRQCIMQALAEQSRVVRLPLNRVGTLNKLNRTLASLEQKFQRDPSPEEIAEVMAPFRSGEDGDLLDVLEDESEESPDYTLINSSLRKDILRSIATLTQREADVILRYFGLNDHRAMSLEEIGQQLDITRERVRQIKEKSLRRLRHASRSSILKHYLG

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2522125168 Dyadobacter beijingensis DSM 21582 Isolate Rhizosphere
3 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
4 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
5 2721755487 Sphingobacterium sp. B29 Isolate Rhizosphere
6 2738541283 Pedobacter sp. OK701 Isolate Unclassified
7 2738541284 Pedobacter sp. YR016 Isolate Unclassified
8 2738541302 Pedobacter sp. CF074 Isolate Unclassified
9 2738543023 Pedobacter sp. OK628 Isolate Unclassified
10 2739367651 Pedobacter sp. OK291 Isolate Unclassified
11 2739367656 Pedobacter sp. CF523 Isolate Unclassified
12 2739367663 Pedobacter sp. YR510 Isolate Unclassified
13 2739367866 Hymenobacter sp. YR204 Isolate Unclassified
14 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
15 2818991437 Pedobacter terrae 518 Isolate Unclassified
16 2818991444 Filimonas endophytica 3197 Isolate Unclassified
17 2839989709 Pontibacter arcticus 2b14 Isolate Unclassified
18 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
19 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
20 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
21 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
22 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
23 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
24 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
25 2884634485 Algoriphagus kandeliae XY-J91 Isolate Unclassified
26 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
27 2890737413 Parapedobacter sp. SGR-10 Isolate Rhizosphere
28 2896317667 Sphingobacterium sp. SGR-19 Isolate Rhizosphere
29 2896344016 Sphingobacterium sp. SGL-16 Isolate Rhizosphere
30 2898713307 Sphingobacterium sp. SGG-5 Isolate Rhizosphere
31 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
32 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
33 2904780799 Sphingobacterium sp. 1304 Isolate Rhizosphere
34 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere
35 2911138879 Spirosoma sp. KUDC1026 Isolate Rhizosphere
36 2919177583 Sphingobacterium sp. 2149 Isolate Rhizosphere
37 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
38 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
39 2919692658 Algoriphagus sp. 4150 Isolate Rhizosphere
40 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
41 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
42 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
43 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
44 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
45 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
46 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
47 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
48 3003233435 Sphingobacterium shayense CrR18 Isolate Unclassified
49 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
50 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
51 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
52 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
53 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
54 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
55 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
56 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
57 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
58 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
59 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
60 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
61 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
62 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
63 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
64 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
65 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
66 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
67 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
68 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
69 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
70 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
71 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
72 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
73 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
74 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
75 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
76 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
77 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
78 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
79 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
80 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
81 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
82 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
83 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
84 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
85 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
86 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
87 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
88 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
89 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
90 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
91 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
92 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
93 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
94 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
95 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
96 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
97 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
98 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
99 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
100 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
101 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
102 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
103 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
104 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
105 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
106 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
107 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
108 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
109 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
110 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
111 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
112 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
113 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
114 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
115 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
116 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
117 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
118 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
119 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
120 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
121 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
122 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
123 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
124 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
125 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
126 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
127 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
128 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
129 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
130 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
131 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
132 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
133 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
134 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
135 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
136 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
137 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
138 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
139 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
140 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
141 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
142 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
143 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
145 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
146 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
148 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
149 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
181 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
182 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
183 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
184 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
185 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
186 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
187 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
188 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
189 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
190 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
191 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
192 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
193 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
194 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
195 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
196 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
197 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
198 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
199 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
200 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
201 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
202 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
203 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
204 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
205 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
206 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
207 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
208 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
209 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
210 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
211 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
212 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
213 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
214 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
215 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
216 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
217 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
218 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
219 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
220 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
221 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
222 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
223 3300041506 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT Metatranscriptome Unclassified
224 3300041916 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT_extra_run Metatranscriptome Unclassified
225 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
226 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
227 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
228 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
229 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
230 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
231 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
232 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
233 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
234 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
235 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
236 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
237 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
238 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
239 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
240 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
241 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
242 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
243 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
244 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
245 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
246 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
247 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
248 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
249 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
250 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
251 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
252 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
253 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
254 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
255 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
256 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
257 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
258 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
259 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
260 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
261 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
262 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
263 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
264 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
265 3300049774 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought Metagenome Rhizosphere
266 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
267 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
268 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
269 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
270 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
271 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
272 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
273 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
274 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
275 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
276 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
277 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
278 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
279 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
280 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
281 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
282 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
283 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
284 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
285 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
286 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
287 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
288 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
289 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
290 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
291 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
292 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
293 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
294 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
295 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
296 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
297 8055588893 Parapedobacter lycopersici KACC 18788 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 80.08
Metatranscriptomes 10.06
Isolates 9.86

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.8
Nodule 0
Rhizoplane 0.21
Rhizosphere 80.7
Stem 0
Stem Tuber 0
Unclassified 11.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_3593219 2162886007 Bacteria 12918
2 SwRhRL2b_contig_494904 2162886007 Bacteria 2592
3 JGI24739J22299_10040735 3300001989 Bacteria 1549
4 JGI25152J39213_1000017 3300002773 Bacteria 109718
5 JGI25150J39212_1000001 3300002774 Bacteria 1318726
6 JGI25151J46595_10000001 3300003187 Bacteria 887211
7 JGI25406J46586_10001126 3300003203 Bacteria 12525
8 JGI25153J46596_10000001 3300003215 Bacteria 748985
9 rootH1_10001619 3300003316 Bacteria 18216
10 rootH1_10026975 3300003316 Bacteria 13102
11 rootH1_10198437 3300003316 Bacteria 1273
12 rootH1_10198437 3300003323 Bacteria 1792
13 rootH2_10021864 3300003320 Bacteria 30597
14 rootH2_10221723 3300003320 Bacteria 2460
15 rootL2_10088947 3300003322 Bacteria 7123
16 rootL2_10145132 3300003322 Bacteria 3334
17 rootL2_10145730 3300003322 Bacteria 3102
18 rootH1_10000888 3300003323 Bacteria 41861
19 rootH1_10006004 3300003316 Bacteria 6053
20 rootH1_10006004 3300003323 Bacteria 3031
21 rootH1_10032143 3300003323 Bacteria 9589
22 rootH1_10044857 3300003323 Bacteria 12183
23 rootH1_10124874 3300003323 Bacteria 5701
24 rootH1_10143165 3300003323 Bacteria 5013
25 rootH1_10166634 3300003323 Bacteria 5499
26 Ga0055536_1000001 3300003781 Bacteria 630663
27 Ga0055536_1026426 3300003781 Bacteria 1627
28 Ga0055530_10002525 3300003791 Bacteria 11674
29 Ga0055531_10000537 3300003794 Bacteria 33595
30 Ga0058859_11457578 3300004798 Bacteria 930
31 Ga0058861_11701330 3300004800 Bacteria 913
32 Ga0058862_10100516 3300004803 Bacteria 1090
33 Ga0065165_1000169 3300005262 Bacteria 115398
34 Ga0065165_1001677 3300005262 Bacteria 22412
35 Ga0065714_10003315 3300005288 Bacteria 13218
36 Ga0065714_10067285 3300005288 Bacteria 5698
37 Ga0065714_10088695 3300005288 Bacteria 2007
38 Ga0065704_10070466 3300005289 Bacteria 23732
39 Ga0065704_10075655 3300005289 Bacteria 5473
40 Ga0065715_10155196 3300005293 Bacteria 1685
41 Ga0070658_10028772 3300005327 Bacteria 4462
42 Ga0070676_10112489 3300005328 Bacteria 1697
43 Ga0070683_100005997 3300005329 Bacteria 10180
44 Ga0070683_100018893 3300005329 Bacteria 6115
45 Ga0070670_100137214 3300005331 Bacteria 2114
46 Ga0070677_10006106 3300005333 Bacteria 3997
47 Ga0068869_100015630 3300005334 Bacteria 5098
48 Ga0070666_10006755 3300005335 Bacteria 7066
49 Ga0070680_100028343 3300005336 Bacteria 4491
50 Ga0070682_100002896 3300005337 Bacteria 9517
51 Ga0068868_100007430 3300005338 Bacteria 7801
52 Ga0070660_100002586 3300005339 Bacteria 12419
53 Ga0070661_100002631 3300005344 Bacteria 12276
54 Ga0070675_100014924 3300005354 Bacteria 6134
55 Ga0070671_100121867 3300005355 Bacteria 2195
56 Ga0070671_100276785 3300005355 Bacteria 1427
57 Ga0070673_100051059 3300005364 Bacteria 3236
58 Ga0070659_100000148 3300005366 Bacteria 53569
59 Ga0070659_100002110 3300005366 Bacteria 14167
60 Ga0070659_100018171 3300005366 Bacteria 5305
61 Ga0070667_100113356 3300005367 Bacteria 2353
62 Ga0070714_100000216 3300005435 Bacteria 46037
63 Ga0070678_100241237 3300005456 Bacteria 1511
64 Ga0070662_100005618 3300005457 Bacteria 8020
65 Ga0068867_100086184 3300005459 Bacteria 2376
66 Ga0070706_100148045 3300005467 Bacteria 2192
67 Ga0070698_100714043 3300005471 Bacteria 945
68 Ga0070679_100027317 3300005530 Bacteria 5616
69 Ga0070684_100001215 3300005535 Bacteria 18504
70 Ga0070684_100015245 3300005535 Bacteria 6253
71 Ga0068853_100013898 3300005539 Bacteria 6581
72 Ga0070665_100065538 3300005548 Bacteria 3644
73 Ga0068855_100023607 3300005563 Bacteria 7366
74 Ga0068855_100272445 3300005563 Bacteria 1882
75 Ga0070664_100004754 3300005564 Bacteria 10890
76 Ga0068857_100021834 3300005577 Bacteria 5633
77 Ga0068854_100014594 3300005578 Bacteria 5182
78 Ga0068856_100016680 3300005614 Bacteria 7114
79 Ga0068852_100014178 3300005616 Bacteria 6123
80 Ga0068852_100034958 3300005616 Bacteria 4186
81 Ga0068859_100154396 3300005617 Bacteria 2372
82 Ga0068859_100346978 3300005617 Bacteria 1579
83 Ga0068864_100105344 3300005618 Bacteria 2506
84 Ga0068864_100529574 3300005618 Bacteria 1137
85 Ga0068866_10263948 3300005718 Bacteria 1059
86 Ga0068870_10026117 3300005840 Bacteria 2908
87 Ga0068863_100368462 3300005841 Bacteria 1401
88 Ga0068860_100181280 3300005843 Bacteria 2035
89 Ga0081539_10000885 3300005985 Bacteria 57257
90 Ga0097621_100014934 3300006237 Bacteria 5828
91 Ga0068871_100006528 3300006358 Bacteria 8261
92 Ga0068871_100030647 3300006358 Bacteria 4238
93 Ga0068871_100281020 3300006358 Bacteria 1456
94 Ga0075428_100018726 3300006844 Bacteria 7655
95 Ga0075428_100036856 3300006844 Bacteria 5385
96 Ga0075428_100713244 3300006844 Bacteria 1068
97 Ga0097620_100154395 3300006931 Bacteria 2372
98 Ga0097620_100346970 3300006931 Bacteria 1579
99 Ga0105244_10036006 3300009036 Bacteria 2596
100 Ga0111539_10005241 3300009094 Bacteria 16795
101 Ga0111539_10009709 3300009094 Bacteria 12145
102 Ga0105243_10000004 3300009148 Bacteria 601266
103 Ga0105237_10012563 3300009545 Bacteria 8922
104 Ga0105239_10001888 3300010375 Bacteria 27395
105 Ga0157373_10000094 3300013100 Bacteria 73332
106 Ga0157373_10003688 3300013100 Bacteria 11583
107 Ga0157373_10003884 3300013100 Bacteria 11294
108 Ga0157373_10009100 3300013100 Bacteria 7346
109 Ga0157373_10012652 3300013100 Bacteria 6205
110 Ga0157371_10000021 3300013102 Bacteria 301017
111 Ga0157371_10023576 3300013102 Bacteria 4500
112 Ga0157371_10100284 3300013102 Bacteria 2054
113 Ga0157371_10247303 3300013102 Bacteria 1283
114 Ga0157370_10002892 3300013104 Bacteria 20477
115 Ga0157370_10095405 3300013104 Bacteria 2790
116 Ga0157370_10134755 3300013104 Bacteria 2302
117 Ga0157370_10149775 3300013104 Bacteria 2172
118 Ga0157369_10000008 3300013105 Bacteria 309315
119 Ga0157369_10004961 3300013105 Bacteria 15592
120 Ga0157369_10022704 3300013105 Bacteria 6997
121 Ga0157374_10005011 3300013296 Bacteria 11112
122 Ga0157378_10019286 3300013297 Bacteria 5995
123 Ga0163162_10000206 3300013306 Bacteria 54701
124 Ga0163162_10013496 3300013306 Bacteria 7975
125 Ga0163162_10051315 3300013306 Bacteria 4139
126 Ga0163162_10256990 3300013306 Bacteria 1879
127 Ga0157372_10008826 3300013307 Bacteria 10707
128 Ga0157372_10024792 3300013307 Bacteria 6518
129 Ga0157372_10054606 3300013307 Bacteria 4457
130 Ga0157372_10276144 3300013307 Bacteria 1953
131 Ga0157375_10027854 3300013308 Bacteria 5287
132 Ga0157375_10265976 3300013308 Bacteria 1876
133 Ga0157380_10000443 3300014326 Bacteria 25341
134 Ga0157380_10006371 3300014326 Bacteria 8304
135 Ga0157380_10015862 3300014326 Bacteria 5543
136 Ga0157380_10060430 3300014326 Bacteria 3029
137 Ga0157380_10557469 3300014326 Bacteria 1125
138 Ga0157380_10598553 3300014326 Bacteria 1090
139 Ga0182008_10000008 3300014497 Bacteria 371823
140 Ga0182008_10000080 3300014497 Bacteria 76626
141 Ga0182008_10000627 3300014497 Bacteria 25898
142 Ga0182008_10004195 3300014497 Bacteria 8475
143 Ga0182008_10028447 3300014497 Bacteria 2826
144 Ga0157377_10006202 3300014745 Bacteria 5686
145 Ga0182006_1000091 3300015261 Bacteria 109227
146 Ga0182006_1001025 3300015261 Bacteria 18259
147 Ga0182006_1006030 3300015261 Bacteria 5675
148 Ga0182007_10000003 3300015262 Bacteria 548244
149 Ga0182007_10010434 3300015262 Bacteria 3668
150 Ga0182007_10013377 3300015262 Bacteria 3131
151 Ga0183373_1001 3300015682 Bacteria 1410374
152 Ga0163161_10000480 3300017792 Bacteria 32905
153 Ga0163161_10001412 3300017792 Bacteria 17750
154 Ga0163161_10002000 3300017792 Bacteria 14738
155 Ga0163161_10002252 3300017792 Bacteria 13847
156 Ga0163161_10065108 3300017792 Bacteria 2660
157 Ga0206356_11440915 3300020070 Bacteria 1169
158 Ga0206349_1713142 3300020075 Bacteria 1096
159 Ga0206349_1775996 3300020075 Bacteria 948
160 Ga0206351_10807570 3300020077 Bacteria 944
161 Ga0206352_10450743 3300020078 Bacteria 1089
162 Ga0206352_11180388 3300020078 Bacteria 1064
163 Ga0206350_10032828 3300020080 Bacteria 1051
164 Ga0206350_10642238 3300020080 Bacteria 1033
165 Ga0206350_10817121 3300020080 Bacteria 1086
166 Ga0213876_10002683 3300021384 Bacteria 10387
167 Ga0207425_1000002 3300025245 Bacteria 1362590
168 Ga0209026_1000494 3300025250 Bacteria 28903
169 Ga0209129_1000002 3300025258 Bacteria 1359086
170 Ga0209676_1000008 3300025292 Bacteria 991778
171 Ga0209676_1000329 3300025292 Bacteria 91571
172 Ga0209025_1000004 3300025294 Bacteria 1361782
173 Ga0209758_1000006 3300025297 Bacteria 1359562
174 Ga0209050_1000045 3300025298 Bacteria 388022
175 Ga0209050_1004335 3300025298 Bacteria 9674
176 Ga0209050_1028413 3300025298 Bacteria 1815
177 Ga0207426_1000170 3300025302 Bacteria 164216
178 Ga0209257_1000006 3300025304 Bacteria 1570111
179 Ga0207655_1053346 3300025728 Bacteria 1617
180 Ga0207682_10002294 3300025893 Bacteria 8617
181 Ga0207680_10182441 3300025903 Bacteria 1420
182 Ga0207645_10165852 3300025907 Bacteria 1446
183 Ga0207705_10096843 3300025909 Bacteria 2166
184 Ga0207707_10115828 3300025912 Bacteria 2342
185 Ga0207707_10148968 3300025912 Bacteria 2046
186 Ga0207671_10016931 3300025914 Bacteria 5642
187 Ga0207660_10165493 3300025917 Bacteria 1709
188 Ga0207657_10010494 3300025919 Bacteria 9240
189 Ga0207657_10019554 3300025919 Bacteria 6427
190 Ga0207652_10165910 3300025921 Bacteria 1980
191 Ga0207664_10000159 3300025929 Bacteria 54000
192 Ga0207644_10245810 3300025931 Bacteria 1426
193 Ga0207690_10000228 3300025932 Bacteria 41941
194 Ga0207690_10011419 3300025932 Bacteria 5311
195 Ga0207706_10009158 3300025933 Bacteria 9104
196 Ga0207709_10000010 3300025935 Bacteria 601305
197 Ga0207691_10009659 3300025940 Bacteria 9254
198 Ga0207689_10054406 3300025942 Bacteria 3296
199 Ga0207661_10018945 3300025944 Bacteria 5121
200 Ga0207667_10140405 3300025949 Bacteria 2487
201 Ga0207651_10077205 3300025960 Bacteria 2384
202 Ga0207640_10147515 3300025981 Bacteria 1723
203 Ga0207640_10340477 3300025981 Bacteria 1201
204 Ga0207658_10233387 3300025986 Bacteria 1554
205 Ga0207677_10003558 3300026023 Bacteria 8257
206 Ga0207639_10051722 3300026041 Bacteria 3126
207 Ga0207702_10128680 3300026078 Bacteria 2276
208 Ga0207648_10116164 3300026089 Bacteria 2352
209 Ga0207648_10171765 3300026089 Bacteria 1916
210 Ga0207676_10081633 3300026095 Bacteria 2627
211 Ga0207676_10537394 3300026095 Bacteria 1115
212 Ga0207674_10071345 3300026116 Bacteria 3490
213 Ga0207683_10037085 3300026121 Bacteria 4245
214 Ga0207683_10198088 3300026121 Bacteria 1825
215 Ga0207698_10036585 3300026142 Bacteria 3605
216 Ga0207698_10096703 3300026142 Bacteria 2434
217 Ga0207698_10549282 3300026142 Bacteria 1132
218 Ga0268264_10204356 3300028381 Bacteria 1809
219 Ga0265337_1000091 3300028556 Bacteria 44212
220 Ga0265337_1013227 3300028556 Bacteria 2779
221 Ga0265326_10000698 3300028558 Bacteria 12443
222 Ga0265326_10010830 3300028558 Bacteria 2700
223 Ga0265319_1000067 3300028563 Bacteria 82947
224 Ga0265319_1000408 3300028563 Bacteria 30993
225 Ga0265334_10016663 3300028573 Bacteria 3038
226 Ga0265318_10003555 3300028577 Bacteria 7809
227 Ga0265318_10040866 3300028577 Bacteria 1764
228 Ga0265323_10000155 3300028653 Bacteria 40398
229 Ga0265323_10000491 3300028653 Bacteria 22283
230 Ga0265323_10009008 3300028653 Bacteria 4096
231 Ga0265323_10009190 3300028653 Bacteria 4052
232 Ga0265323_10055779 3300028653 Bacteria 1388
233 Ga0265322_10000036 3300028654 Bacteria 79374
234 Ga0265322_10000759 3300028654 Bacteria 11705
235 Ga0265322_10033487 3300028654 Bacteria 1465
236 Ga0265322_10047492 3300028654 Bacteria 1220
237 Ga0265322_10063173 3300028654 Bacteria 1050
238 Ga0265336_10000067 3300028666 Bacteria 93268
239 Ga0307515_10000016 3300028794 Bacteria 554870
240 Ga0307515_10086642 3300028794 Bacteria 3989
241 Ga0265338_10000126 3300028800 Bacteria 140495
242 Ga0265338_10009434 3300028800 Bacteria 11631
243 Ga0265338_10014199 3300028800 Bacteria 8894
244 Ga0265338_10310850 3300028800 Bacteria 1143
245 Ga0265324_10002147 3300029957 Bacteria 10356
246 Ga0265324_10015184 3300029957 Unclassified 2836
247 Ga0265330_10000150 3300031235 Bacteria 56333
248 Ga0265330_10057922 3300031235 Bacteria 1689
249 Ga0265332_10000306 3300031238 Bacteria 37911
250 Ga0265332_10025821 3300031238 Bacteria 2578
251 Ga0265332_10036695 3300031238 Bacteria 2128
252 Ga0265328_10058076 3300031239 Bacteria 1421
253 Ga0265320_10000275 3300031240 Bacteria 42230
254 Ga0265320_10005196 3300031240 Bacteria 8399
255 Ga0265325_10005197 3300031241 Bacteria 8087
256 Ga0265325_10054429 3300031241 Bacteria 2048
257 Ga0265329_10000181 3300031242 Bacteria 32113
258 Ga0265329_10025836 3300031242 Bacteria 1939
259 Ga0265340_10008924 3300031247 Bacteria 5401
260 Ga0265340_10053608 3300031247 Bacteria 1948
261 Ga0265339_10000097 3300031249 Bacteria 73931
262 Ga0265339_10056335 3300031249 Bacteria 2129
263 Ga0265331_10000322 3300031250 Bacteria 51785
264 Ga0265327_10000117 3300031251 Bacteria 173075
265 Ga0265327_10025126 3300031251 Bacteria 3481
266 Ga0265327_10037210 3300031251 Bacteria 2667
267 Ga0265316_10000613 3300031344 Bacteria 39669
268 Ga0265316_10001346 3300031344 Bacteria 26432
269 Ga0265316_10002531 3300031344 Bacteria 18899
270 Ga0265316_10002743 3300031344 Bacteria 18039
271 Ga0265316_10003225 3300031344 Bacteria 16573
272 Ga0265316_10086695 3300031344 Bacteria 2393
273 Ga0265316_10163018 3300031344 Bacteria 1666
274 Ga0307509_10029534 3300031507 Bacteria 6083
275 Ga0307509_10072733 3300031507 Bacteria 3581
276 Ga0307408_100036636 3300031548 Bacteria 3450
277 Ga0265313_10001271 3300031595 Bacteria 23915
278 Ga0265313_10123904 3300031595 Bacteria 1125
279 Ga0316579_10073950 3300031691 Bacteria 1618
280 Ga0265314_10000337 3300031711 Bacteria 65738
281 Ga0265314_10040388 3300031711 Bacteria 3349
282 Ga0265342_10000999 3300031712 Bacteria 27871
283 Ga0265342_10001401 3300031712 Bacteria 22534
284 Ga0265342_10066240 3300031712 Bacteria 2116
285 Ga0265342_10162652 3300031712 Bacteria 1233
286 Ga0316576_10091423 3300031727 Bacteria 2268
287 Ga0316576_10128556 3300031727 Bacteria 1905
288 Ga0316576_10217921 3300031727 Bacteria 1436
289 Ga0316576_10277302 3300031727 Bacteria 1256
290 Ga0307405_10000042 3300031731 Bacteria 79124
291 Ga0307407_10000022 3300031903 Bacteria 120355
292 Ga0307412_10000023 3300031911 Bacteria 237005
293 Ga0307412_10159756 3300031911 Bacteria 1673
294 Ga0307409_100019033 3300031995 Bacteria 4637
295 Ga0307409_100163751 3300031995 Bacteria 1948
296 Ga0307416_100000047 3300032002 Bacteria 120385
297 Ga0307416_100039016 3300032002 Bacteria 3671
298 Ga0307414_10001020 3300032004 Bacteria 14307
299 Ga0307414_10001969 3300032004 Bacteria 10635
300 Ga0307414_10004335 3300032004 Bacteria 7702
301 Ga0307414_10033584 3300032004 Bacteria 3393
302 Ga0307414_10054222 3300032004 Bacteria 2800
303 Ga0307414_10080776 3300032004 Bacteria 2379
304 Ga0307414_10249063 3300032004 Bacteria 1475
305 Ga0307414_10354739 3300032004 Bacteria 1260
306 Ga0307414_10537789 3300032004 Bacteria 1039
307 Ga0307414_10617180 3300032004 Bacteria 974
308 Ga0307415_100060885 3300032126 Bacteria 2611
309 Ga0316583_10003216 3300032133 Bacteria 5746
310 Ga0316583_10010936 3300032133 Bacteria 3269
311 Ga0316583_10018837 3300032133 Bacteria 2480
312 Ga0316583_10025755 3300032133 Bacteria 2100
313 Ga0316583_10082103 3300032133 Bacteria 1126
314 Ga0316580_10038593 3300032139 Bacteria 1476
315 Ga0316593_10075620 3300032168 Bacteria 1169
316 Ga0316596_1007373 3300033541 Bacteria 2598
317 Ga0316582_0194013 3300036647 Bacteria 1384
318 Ga0316584_0076225 3300036712 Bacteria 2513
319 Ga0316584_0080515 3300036712 Bacteria 2440
320 Ga0316584_0177593 3300036712 Bacteria 1577
321 Ga0316584_0218057 3300036712 Bacteria 1403
322 Ga0436365_0038916 3300039437 Bacteria 17419
323 Ga0451850_49488 3300041506 Bacteria 953
324 Ga0452271_57680 3300041916 Bacteria 1028
325 Ga0450896_004232 3300042133 Bacteria 1942
326 Ga0451577_0000207 3300042876 Bacteria 123185
327 Ga0451577_0000439 3300042876 Bacteria 73641
328 Ga0451577_0007369 3300042876 Bacteria 10800
329 Ga0451577_0028867 3300042876 Bacteria 5017
330 Ga0451577_0031752 3300042876 Bacteria 4764
331 Ga0451577_0032817 3300042876 Bacteria 4680
332 Ga0451577_0111488 3300042876 Bacteria 2448
333 Ga0451577_0152164 3300042876 Bacteria 2082
334 Ga0451577_0174808 3300042876 Bacteria 1935
335 Ga0466972_0000010 3300044658 Bacteria 256339
336 Ga0453683_0001818 3300044673 Bacteria 17607
337 Ga0453683_0030957 3300044673 Bacteria 3381
338 Ga0453683_0272890 3300044673 Bacteria 1079
339 Ga0453684_0000039 3300044712 Bacteria 697730
340 Ga0453684_0000054 3300044712 Bacteria 543775
341 Ga0453684_0000310 3300044712 Bacteria 206883
342 Ga0453684_0000791 3300044712 Bacteria 108441
343 Ga0453684_0004286 3300044712 Bacteria 30426
344 Ga0453684_0006996 3300044712 Bacteria 21098
345 Ga0453684_0012849 3300044712 Bacteria 13719
346 Ga0453684_0023372 3300044712 Bacteria 9113
347 Ga0453684_0025938 3300044712 Bacteria 8487
348 Ga0453684_0033152 3300044712 Bacteria 7206
349 Ga0453684_0067272 3300044712 Bacteria 4557
350 Ga0453684_0194823 3300044712 Bacteria 2367
351 Ga0453684_0240686 3300044712 Bacteria 2083
352 Ga0453684_0632767 3300044712 Bacteria 1169
353 Ga0466968_0100458 3300044735 Bacteria 1291
354 Ga0466970_0000921 3300044765 Bacteria 14222
355 Ga0466960_0245941 3300044901 Bacteria 992
356 Ga0451576_0004470 3300045051 Bacteria 18111
357 Ga0451576_0020786 3300045051 Bacteria 7145
358 Ga0451576_0030791 3300045051 Bacteria 5727
359 Ga0451576_0179300 3300045051 Bacteria 2212
360 Ga0451576_0186015 3300045051 Bacteria 2169
361 Ga0451576_0569559 3300045051 Bacteria 1190
362 Ga0495638_0000015 3300046460 Bacteria 414645
363 Ga0495638_0000020 3300046460 Bacteria 372434
364 Ga0495610_0000066 3300046512 Bacteria 124205
365 Ga0495610_0000463 3300046512 Bacteria 41930
366 Ga0495637_0028261 3300046520 Bacteria 2506
367 Ga0495663_0043492 3300046525 Bacteria 1372
368 Ga0495633_0087666 3300046558 Bacteria 1447
369 Ga0495677_0024687 3300047445 Bacteria 2181
370 Ga0496116_0004398 3300048919 Bacteria 13477
371 Ga0496117_0001577 3300048920 Bacteria 32356
372 Ga0496122_0000591 3300048925 Bacteria 74549
373 Ga0496122_0022226 3300048925 Bacteria 5645
374 Ga0496123_0054405 3300048926 Bacteria 2635
375 Ga0496124_0112429 3300048927 Bacteria 2190
376 Ga0496125_0092509 3300048928 Bacteria 2261
377 Ga0496126_0111374 3300048929 Bacteria 2384
378 Ga0501308_003566 3300049128 Bacteria 1448
379 Ga0501309_001878 3300049129 Bacteria 2167
380 Ga0501309_004917 3300049129 Bacteria 1573
381 Ga0501310_003032 3300049130 Bacteria 1627
382 Ga0501305_002098 3300049161 Bacteria 2098
383 Ga0501305_008037 3300049161 Bacteria 1355
384 Ga0495678_010253 3300049459 Bacteria 4565
385 Ga0501312_001561 3300049528 Bacteria 2282
386 Ga0501313_007784 3300049529 Bacteria 1185
387 Ga0501315_001132 3300049531 Bacteria 2173
388 Ga0501315_006828 3300049531 Bacteria 1283
389 Ga0501320_003225 3300049536 Bacteria 1367
390 Ga0501323_001964 3300049539 Bacteria 1926
391 Ga0501323_005328 3300049539 Bacteria 1403
392 Ga0501335_006363 3300049551 Bacteria 1075
393 Ga0501034_0008845 3300049571 Bacteria 10590
394 Ga0501034_0111073 3300049571 Bacteria 2732
395 Ga0501043_0081846 3300049579 Bacteria 2537
396 Ga0501047_0017081 3300049581 Bacteria 6940
397 Ga0501047_0047619 3300049581 Bacteria 4141
398 Ga0501217_004889 3300049661 Bacteria 2776
399 Ga0501257_001560 3300049686 Bacteria 4776
400 Ga0501225_0008370 3300049705 Bacteria 2969
401 Ga0501264_001682 3300049761 Bacteria 2265
402 Ga0501278_005283 3300049774 Bacteria 946
403 Ga0501044_0015994 3300049823 Bacteria 8072
404 Ga0501044_0100947 3300049823 Bacteria 2903
405 nmdc:mga08y16_28509_c1 3300050511 Bacteria 5886
406 Ga0500646_0024515 3300053090 Bacteria 1625
407 Ga0500651_0002251 3300053093 Bacteria 10120
408 Ga0500651_0225361 3300053093 Bacteria 1098
409 Ga0500557_006657 3300053105 Bacteria 2637
410 Ga0500562_000035 3300053108 Bacteria 81116
411 Ga0500618_000038 3300053125 Bacteria 116036
412 Ga0500618_002446 3300053125 Bacteria 6989
413 Ga0500642_0069649 3300053130 Bacteria 1598
414 Ga0500655_002609 3300053133 Bacteria 3269
415 Ga0500568_0055744 3300053139 Bacteria 1542
416 Ga0500604_0000207 3300053151 Bacteria 16825
417 Ga0500616_0000007 3300053153 Bacteria 836875
418 Ga0500616_0006075 3300053153 Bacteria 8010
419 Ga0500622_0000031 3300053156 Bacteria 207165
420 Ga0500622_0000039 3300053156 Bacteria 170859
421 Ga0500622_0000298 3300053156 Bacteria 50798
422 Ga0500645_001575 3300053730 Bacteria 11356
423 Ga0587070_021869 3300059491 Bacteria 1084
424 Ga0587073_0032113 3300059492 Bacteria 1092
425 Ga0587077_014497 3300059493 Bacteria 1298
426 Ga0587077_025887 3300059493 Bacteria 1079
427 Ga0587082_030886 3300059504 Bacteria 933
428 Ga0587088_018346 3300059508 Bacteria 1138
429 Ga0587090_016013 3300059510 Bacteria 1116
430 Ga0587091_014828 3300059511 Bacteria 1277
431 Ga0587094_013985 3300059513 Bacteria 1091
432 Ga0587067_023209 3300059640 Bacteria 1086
433 Ga0587075_015151 3300059644 Bacteria 1081
434 Ga0587076_022940 3300059645 Bacteria 1047
435 Ga0587078_010005 3300059646 Bacteria 1084
436 Ga0587079_025590 3300059647 Bacteria 1097
437 Ga0587107_001906 3300059652 Bacteria 1789
438 Ga0587114_011766 3300059655 Bacteria 1097
439 Ga0587071_025196 3300060344 Bacteria 1115
440 Ga0587071_034306 3300060344 Bacteria 992
441 Ga0587111_0019772 3300060346 Bacteria 1281

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046460 Ga0495638_0000015 Ga0495638_0000015_148903_149766 250
2 3300049459 Ga0495678_010253 Ga0495678_010253_3721_4491 256
3 3300005471 Ga0070698_100714043 Ga0070698_1007140431 259
4 3300060344 Ga0587071_034306 Ga0587071_034306_195_977 259
5 3300006844 Ga0075428_100018726 Ga0075428_1000187262 265
6 3300010375 Ga0105239_10001888 Ga0105239_1000188814 271
7 3300013307 Ga0157372_10276144 Ga0157372_102761442 271
8 3300014326 Ga0157380_10557469 Ga0157380_105574691 274
9 3300003323 rootH1_10124874 rootH1_101248741 275
10 3300005329 Ga0070683_100018893 Ga0070683_1000188933 275
11 3300005535 Ga0070684_100015245 Ga0070684_1000152453 275
12 3300013100 Ga0157373_10012652 Ga0157373_100126527 275
13 3300013307 Ga0157372_10008826 Ga0157372_100088263 275
14 3300025944 Ga0207661_10018945 Ga0207661_100189455 275
15 3300031727 Ga0316576_10217921 Ga0316576_102179211 276
16 3300020077 Ga0206351_10807570 Ga0206351_108075701 279
17 3300020080 Ga0206350_10642238 Ga0206350_106422381 280
18 3300036712 Ga0316584_0076225 Ga0316584_0076225_84_929 280
19 3300031691 Ga0316579_10073950 Ga0316579_100739502 281
20 3300032133 Ga0316583_10082103 Ga0316583_100821032 281
21 3300032168 Ga0316593_10075620 Ga0316593_100756201 281
22 3300036647 Ga0316582_0194013 Ga0316582_0194013_466_1314 281
23 3300049571 Ga0501034_0111073 Ga0501034_0111073_430_1293 282
24 iso_pu_bacteria 2522125168 2522551148 282
25 iso_pu_bacteria 2585427687 2586209073 282
26 iso_pu_bacteria 2599185184 2599480199 282
27 iso_pu_bacteria 2721755487 2722727673 282
28 iso_pu_bacteria 2738541283 2738757219 282
29 iso_pu_bacteria 2738541284 2738760582 282
30 iso_pu_bacteria 2738541302 2738855649 282
31 iso_pu_bacteria 2738543023 2739300598 282
32 iso_pu_bacteria 2739367651 2739590532 282
33 iso_pu_bacteria 2739367656 2739617229 282
34 iso_pu_bacteria 2739367663 2739647489 282
35 iso_pu_bacteria 2739367866 2740032912 282
36 iso_pu_bacteria 2775506987 2776612723 282
37 iso_pu_bacteria 2818991437 2819549276 282
38 iso_pu_bacteria 2839989709 2839991568 282
39 iso_pu_bacteria 2842722452 2842724841 282
40 iso_pu_bacteria 2842903701 2842907677 282
41 iso_pu_bacteria 2842909656 2842913139 282
42 iso_pu_bacteria 2849281842 2849284669 282
43 iso_pu_bacteria 2852623160 2852623450 282
44 iso_pu_bacteria 2852627209 2852630162 282
45 iso_pu_bacteria 2857627736 2857630181 282
46 iso_pu_bacteria 2884634485 2884635121 282
47 iso_pu_bacteria 2884933994 2884937651 282
48 iso_pu_bacteria 2890737413 2890738571 282
49 iso_pu_bacteria 2896317667 2896318323 282
50 iso_pu_bacteria 2896344016 2896344463 282
51 iso_pu_bacteria 2898713307 2898715473 282
52 iso_pu_bacteria 2902048731 2902050006 282
53 iso_pu_bacteria 2904445276 2904449326 282
54 iso_pu_bacteria 2904780799 2904781638 282
55 iso_pu_bacteria 2910245624 2910247631 282
56 iso_pu_bacteria 2911138879 2911142039 282
57 iso_pu_bacteria 2919177583 2919177652 282
58 iso_pu_bacteria 2919186247 2919189901 282
59 iso_pu_bacteria 2919437846 2919438501 282
60 iso_pu_bacteria 2919692658 2919695234 282
61 iso_pu_bacteria 2928078545 2928083645 282
62 iso_pu_bacteria 2928147474 2928151096 282
63 iso_pu_bacteria 2932082852 2932084396 282
64 iso_pu_bacteria 2939664404 2939668181 282
65 iso_pu_bacteria 2945997725 2946001831 282
66 iso_pu_bacteria 2954016120 2954018664 282
67 iso_pu_bacteria 2977232053 2977232768 282
68 iso_pu_bacteria 3003233435 3003233822 282
69 iso_pu_bacteria 8055588893 8055589281 282
70 3300005435 Ga0070714_100000216 Ga0070714_10000021630 283
71 3300005467 Ga0070706_100148045 Ga0070706_1001480452 283
72 3300025929 Ga0207664_10000159 Ga0207664_1000015937 283
73 3300028653 Ga0265323_10009008 Ga0265323_100090084 283
74 3300028800 Ga0265338_10310850 Ga0265338_103108501 283
75 3300031235 Ga0265330_10057922 Ga0265330_100579222 283
76 3300031238 Ga0265332_10025821 Ga0265332_100258212 283
77 3300031344 Ga0265316_10003225 Ga0265316_1000322512 283
78 3300031711 Ga0265314_10040388 Ga0265314_100403883 283
79 3300031727 Ga0316576_10128556 Ga0316576_101285561 283
80 3300031727 Ga0316576_10277302 Ga0316576_102773021 283
81 3300032133 Ga0316583_10003216 Ga0316583_100032167 283
82 3300032133 Ga0316583_10010936 Ga0316583_100109363 283
83 3300032133 Ga0316583_10018837 Ga0316583_100188372 283
84 3300032133 Ga0316583_10025755 Ga0316583_100257552 283
85 3300032139 Ga0316580_10038593 Ga0316580_100385932 283
86 3300036712 Ga0316584_0080515 Ga0316584_0080515_719_1573 283
87 3300036712 Ga0316584_0177593 Ga0316584_0177593_557_1417 283
88 3300044712 Ga0453684_0067272 Ga0453684_0067272_3247_4110 283
89 3300049581 Ga0501047_0047619 Ga0501047_0047619_3022_3885 283
90 3300049823 Ga0501044_0015994 Ga0501044_0015994_5492_6355 283
91 3300059493 Ga0587077_014497 Ga0587077_014497_391_1266 283
92 3300059511 Ga0587091_014828 Ga0587091_014828_32_907 283
93 3300059652 Ga0587107_001906 Ga0587107_001906_39_914 283
94 3300060346 Ga0587111_0019772 Ga0587111_0019772_374_1249 283
95 iso_pu_bacteria 2818991444 2819589843 283
96 3300028556 Ga0265337_1000091 Ga0265337_100009144 284
97 3300028556 Ga0265337_1013227 Ga0265337_10132272 284
98 3300028558 Ga0265326_10000698 Ga0265326_1000069811 284
99 3300028558 Ga0265326_10010830 Ga0265326_100108304 284
100 3300028563 Ga0265319_1000067 Ga0265319_100006717 284
101 3300028563 Ga0265319_1000408 Ga0265319_100040819 284
102 3300028573 Ga0265334_10016663 Ga0265334_100166635 284
103 3300028577 Ga0265318_10003555 Ga0265318_100035559 284
104 3300028577 Ga0265318_10040866 Ga0265318_100408662 284
105 3300028653 Ga0265323_10000491 Ga0265323_1000049118 284
106 3300028653 Ga0265323_10055779 Ga0265323_100557791 284
107 3300028654 Ga0265322_10000036 Ga0265322_1000003659 284
108 3300028654 Ga0265322_10000759 Ga0265322_100007598 284
109 3300028654 Ga0265322_10033487 Ga0265322_100334872 284
110 3300028654 Ga0265322_10047492 Ga0265322_100474922 284
111 3300028654 Ga0265322_10063173 Ga0265322_100631732 284
112 3300028666 Ga0265336_10000067 Ga0265336_1000006724 284
113 3300028800 Ga0265338_10000126 Ga0265338_1000012672 284
114 3300028800 Ga0265338_10009434 Ga0265338_100094344 284
115 3300028800 Ga0265338_10014199 Ga0265338_100141997 284
116 3300029957 Ga0265324_10002147 Ga0265324_1000214712 284
117 3300029957 Ga0265324_10015184 Ga0265324_100151843 284
118 3300031235 Ga0265330_10000150 Ga0265330_1000015029 284
119 3300031238 Ga0265332_10000306 Ga0265332_1000030620 284
120 3300031238 Ga0265332_10036695 Ga0265332_100366954 284
121 3300031239 Ga0265328_10058076 Ga0265328_100580762 284
122 3300031240 Ga0265320_10000275 Ga0265320_1000027519 284
123 3300031240 Ga0265320_10005196 Ga0265320_100051964 284
124 3300031241 Ga0265325_10005197 Ga0265325_100051976 284
125 3300031241 Ga0265325_10054429 Ga0265325_100544292 284
126 3300031242 Ga0265329_10000181 Ga0265329_1000018125 284
127 3300031242 Ga0265329_10025836 Ga0265329_100258363 284
128 3300031247 Ga0265340_10008924 Ga0265340_100089247 284
129 3300031247 Ga0265340_10053608 Ga0265340_100536082 284
130 3300031249 Ga0265339_10000097 Ga0265339_1000009727 284
131 3300031249 Ga0265339_10056335 Ga0265339_100563354 284
132 3300031250 Ga0265331_10000322 Ga0265331_1000032236 284
133 3300031344 Ga0265316_10002531 Ga0265316_1000253111 284
134 3300031344 Ga0265316_10002743 Ga0265316_1000274318 284
135 3300031344 Ga0265316_10086695 Ga0265316_100866951 284
136 3300031344 Ga0265316_10163018 Ga0265316_101630184 284
137 3300031595 Ga0265313_10001271 Ga0265313_1000127112 284
138 3300031595 Ga0265313_10123904 Ga0265313_101239042 284
139 3300031711 Ga0265314_10000337 Ga0265314_1000033726 284
140 3300031712 Ga0265342_10000999 Ga0265342_100009996 284
141 3300031712 Ga0265342_10001401 Ga0265342_100014018 284
142 3300031712 Ga0265342_10066240 Ga0265342_100662404 284
143 3300042876 Ga0451577_0000207 Ga0451577_0000207_59234_60091 284
144 3300042876 Ga0451577_0000439 Ga0451577_0000439_52512_53369 284
145 3300042876 Ga0451577_0031752 Ga0451577_0031752_1701_2558 284
146 3300042876 Ga0451577_0111488 Ga0451577_0111488_846_1703 284
147 3300042876 Ga0451577_0152164 Ga0451577_0152164_796_1653 284
148 3300044673 Ga0453683_0030957 Ga0453683_0030957_115_972 284
149 3300044673 Ga0453683_0272890 Ga0453683_0272890_132_989 284
150 3300044712 Ga0453684_0000039 Ga0453684_0000039_312167_313024 284
151 3300044712 Ga0453684_0000054 Ga0453684_0000054_351134_351991 284
152 3300044712 Ga0453684_0000791 Ga0453684_0000791_25677_26534 284
153 3300044712 Ga0453684_0012849 Ga0453684_0012849_9631_10488 284
154 3300044712 Ga0453684_0025938 Ga0453684_0025938_1568_2425 284
155 3300044712 Ga0453684_0194823 Ga0453684_0194823_730_1587 284
156 3300044712 Ga0453684_0632767 Ga0453684_0632767_104_961 284
157 3300045051 Ga0451576_0004470 Ga0451576_0004470_10797_11654 284
158 3300045051 Ga0451576_0179300 Ga0451576_0179300_1048_1905 284
159 3300045051 Ga0451576_0186015 Ga0451576_0186015_755_1612 284
160 3300045051 Ga0451576_0569559 Ga0451576_0569559_203_1060 284
161 iso_pu_bacteria 2929154850 2929160072 284
162 3300005366 Ga0070659_100018171 Ga0070659_1000181711 285
163 3300020075 Ga0206349_1713142 Ga0206349_17131421 285
164 3300020078 Ga0206352_10450743 Ga0206352_104507431 285
165 3300020080 Ga0206350_10032828 Ga0206350_100328281 285
166 3300025250 Ga0209026_1000494 Ga0209026_10004949 285
167 3300025932 Ga0207690_10011419 Ga0207690_100114192 285
168 3300028653 Ga0265323_10000155 Ga0265323_1000015530 285
169 3300031344 Ga0265316_10000613 Ga0265316_1000061335 285
170 3300031344 Ga0265316_10001346 Ga0265316_1000134621 285
171 3300031712 Ga0265342_10162652 Ga0265342_101626521 285
172 3300044712 Ga0453684_0006996 Ga0453684_0006996_18538_19398 285
173 3300047445 Ga0495677_0024687 Ga0495677_0024687_140_997 285
174 2162886007 SwRhRL2b_contig_3593219 SwRhRL2b_0263.00004930 286
175 2162886007 SwRhRL2b_contig_494904 SwRhRL2b_0892.00000350 286
176 3300001989 JGI24739J22299_10040735 JGI24739J22299_100407352 286
177 3300002773 JGI25152J39213_1000017 JGI25152J39213_10000176 286
178 3300002774 JGI25150J39212_1000001 JGI25150J39212_1000001680 286
179 3300003187 JGI25151J46595_10000001 JGI25151J46595_10000001125 286
180 3300003203 JGI25406J46586_10001126 JGI25406J46586_100011262 286
181 3300003215 JGI25153J46596_10000001 JGI25153J46596_1000000114 286
182 3300003316 rootH1_10001619 rootH1_100016195 286
183 3300003316 rootH1_10026975 rootH1_100269757 286
184 3300003316 rootH1_10198437 rootH1_101984372 286
185 3300003320 rootH2_10021864 rootH2_100218642 286
186 3300003320 rootH2_10221723 rootH2_102217232 286
187 3300003322 rootL2_10088947 rootL2_100889477 286
188 3300003322 rootL2_10145132 rootL2_101451324 286
189 3300003322 rootL2_10145730 rootL2_101457302 286
190 3300003323 rootH1_10000888 rootH1_100008885 286
191 3300003323 rootH1_10006004 rootH1_100060042 286
192 3300003323 rootH1_10032143 rootH1_100321438 286
193 3300003323 rootH1_10044857 rootH1_1004485710 286
194 3300003323 rootH1_10143165 rootH1_101431654 286
195 3300003323 rootH1_10166634 rootH1_101666342 286
196 3300003781 Ga0055536_1000001 Ga0055536_1000001134 286
197 3300003781 Ga0055536_1026426 Ga0055536_10264262 286
198 3300003791 Ga0055530_10002525 Ga0055530_1000252512 286
199 3300003794 Ga0055531_10000537 Ga0055531_100005372 286
200 3300004798 Ga0058859_11457578 Ga0058859_114575781 286
201 3300004800 Ga0058861_11701330 Ga0058861_117013301 286
202 3300004803 Ga0058862_10100516 Ga0058862_101005161 286
203 3300005262 Ga0065165_1000169 Ga0065165_100016946 286
204 3300005262 Ga0065165_1001677 Ga0065165_10016779 286
205 3300005288 Ga0065714_10003315 Ga0065714_1000331513 286
206 3300005288 Ga0065714_10067285 Ga0065714_100672857 286
207 3300005288 Ga0065714_10088695 Ga0065714_100886952 286
208 3300005289 Ga0065704_10070466 Ga0065704_100704665 286
209 3300005289 Ga0065704_10075655 Ga0065704_100756556 286
210 3300005293 Ga0065715_10155196 Ga0065715_101551962 286
211 3300005327 Ga0070658_10028772 Ga0070658_100287726 286
212 3300005328 Ga0070676_10112489 Ga0070676_101124892 286
213 3300005329 Ga0070683_100005997 Ga0070683_10000599713 286
214 3300005331 Ga0070670_100137214 Ga0070670_1001372141 286
215 3300005333 Ga0070677_10006106 Ga0070677_100061062 286
216 3300005334 Ga0068869_100015630 Ga0068869_1000156303 286
217 3300005335 Ga0070666_10006755 Ga0070666_100067552 286
218 3300005336 Ga0070680_100028343 Ga0070680_1000283433 286
219 3300005337 Ga0070682_100002896 Ga0070682_1000028967 286
220 3300005338 Ga0068868_100007430 Ga0068868_1000074305 286
221 3300005339 Ga0070660_100002586 Ga0070660_1000025867 286
222 3300005344 Ga0070661_100002631 Ga0070661_10000263113 286
223 3300005354 Ga0070675_100014924 Ga0070675_1000149242 286
224 3300005355 Ga0070671_100121867 Ga0070671_1001218674 286
225 3300005355 Ga0070671_100276785 Ga0070671_1002767852 286
226 3300005364 Ga0070673_100051059 Ga0070673_1000510593 286
227 3300005366 Ga0070659_100000148 Ga0070659_10000014827 286
228 3300005366 Ga0070659_100002110 Ga0070659_1000021108 286
229 3300005367 Ga0070667_100113356 Ga0070667_1001133563 286
230 3300005456 Ga0070678_100241237 Ga0070678_1002412372 286
231 3300005457 Ga0070662_100005618 Ga0070662_1000056184 286
232 3300005459 Ga0068867_100086184 Ga0068867_1000861842 286
233 3300005530 Ga0070679_100027317 Ga0070679_1000273176 286
234 3300005535 Ga0070684_100001215 Ga0070684_1000012157 286
235 3300005539 Ga0068853_100013898 Ga0068853_1000138987 286
236 3300005548 Ga0070665_100065538 Ga0070665_1000655382 286
237 3300005563 Ga0068855_100023607 Ga0068855_1000236073 286
238 3300005563 Ga0068855_100272445 Ga0068855_1002724452 286
239 3300005564 Ga0070664_100004754 Ga0070664_1000047546 286
240 3300005577 Ga0068857_100021834 Ga0068857_1000218345 286
241 3300005578 Ga0068854_100014594 Ga0068854_1000145944 286
242 3300005614 Ga0068856_100016680 Ga0068856_1000166803 286
243 3300005616 Ga0068852_100014178 Ga0068852_1000141785 286
244 3300005616 Ga0068852_100034958 Ga0068852_1000349585 286
245 3300005617 Ga0068859_100154396 Ga0068859_1001543963 286
246 3300005617 Ga0068859_100346978 Ga0068859_1003469782 286
247 3300005618 Ga0068864_100105344 Ga0068864_1001053442 286
248 3300005618 Ga0068864_100529574 Ga0068864_1005295742 286
249 3300005718 Ga0068866_10263948 Ga0068866_102639481 286
250 3300005840 Ga0068870_10026117 Ga0068870_100261172 286
251 3300005841 Ga0068863_100368462 Ga0068863_1003684622 286
252 3300005843 Ga0068860_100181280 Ga0068860_1001812802 286
253 3300005985 Ga0081539_10000885 Ga0081539_1000088558 286
254 3300006237 Ga0097621_100014934 Ga0097621_1000149347 286
255 3300006358 Ga0068871_100006528 Ga0068871_1000065288 286
256 3300006358 Ga0068871_100030647 Ga0068871_1000306474 286
257 3300006358 Ga0068871_100281020 Ga0068871_1002810202 286
258 3300006844 Ga0075428_100036856 Ga0075428_1000368562 286
259 3300006844 Ga0075428_100713244 Ga0075428_1007132441 286
260 3300006931 Ga0097620_100154395 Ga0097620_1001543953 286
261 3300006931 Ga0097620_100346970 Ga0097620_1003469702 286
262 3300009036 Ga0105244_10036006 Ga0105244_100360063 286
263 3300009094 Ga0111539_10005241 Ga0111539_1000524113 286
264 3300009094 Ga0111539_10009709 Ga0111539_100097098 286
265 3300009148 Ga0105243_10000004 Ga0105243_10000004289 286
266 3300009545 Ga0105237_10012563 Ga0105237_100125631 286
267 3300013100 Ga0157373_10000094 Ga0157373_100000943 286
268 3300013100 Ga0157373_10003688 Ga0157373_100036884 286
269 3300013100 Ga0157373_10003884 Ga0157373_100038846 286
270 3300013100 Ga0157373_10009100 Ga0157373_100091004 286
271 3300013102 Ga0157371_10000021 Ga0157371_10000021209 286
272 3300013102 Ga0157371_10023576 Ga0157371_100235763 286
273 3300013102 Ga0157371_10100284 Ga0157371_101002841 286
274 3300013102 Ga0157371_10247303 Ga0157371_102473031 286
275 3300013104 Ga0157370_10002892 Ga0157370_100028924 286
276 3300013104 Ga0157370_10095405 Ga0157370_100954052 286
277 3300013104 Ga0157370_10134755 Ga0157370_101347553 286
278 3300013104 Ga0157370_10149775 Ga0157370_101497752 286
279 3300013105 Ga0157369_10000008 Ga0157369_10000008147 286
280 3300013105 Ga0157369_10004961 Ga0157369_1000496113 286
281 3300013105 Ga0157369_10022704 Ga0157369_100227044 286
282 3300013296 Ga0157374_10005011 Ga0157374_100050116 286
283 3300013297 Ga0157378_10019286 Ga0157378_100192865 286
284 3300013306 Ga0163162_10000206 Ga0163162_1000020629 286
285 3300013306 Ga0163162_10013496 Ga0163162_100134966 286
286 3300013306 Ga0163162_10051315 Ga0163162_100513152 286
287 3300013306 Ga0163162_10256990 Ga0163162_102569902 286
288 3300013307 Ga0157372_10024792 Ga0157372_100247927 286
289 3300013307 Ga0157372_10054606 Ga0157372_100546064 286
290 3300013308 Ga0157375_10027854 Ga0157375_100278547 286
291 3300013308 Ga0157375_10265976 Ga0157375_102659762 286
292 3300014326 Ga0157380_10000443 Ga0157380_100004436 286
293 3300014326 Ga0157380_10006371 Ga0157380_100063715 286
294 3300014326 Ga0157380_10015862 Ga0157380_100158622 286
295 3300014326 Ga0157380_10060430 Ga0157380_100604304 286
296 3300014326 Ga0157380_10598553 Ga0157380_105985531 286
297 3300014497 Ga0182008_10000008 Ga0182008_10000008109 286
298 3300014497 Ga0182008_10000080 Ga0182008_1000008037 286
299 3300014497 Ga0182008_10000627 Ga0182008_1000062724 286
300 3300014497 Ga0182008_10004195 Ga0182008_100041956 286
301 3300014497 Ga0182008_10028447 Ga0182008_100284472 286
302 3300014745 Ga0157377_10006202 Ga0157377_100062024 286
303 3300015261 Ga0182006_1000091 Ga0182006_10000918 286
304 3300015261 Ga0182006_1001025 Ga0182006_10010259 286
305 3300015261 Ga0182006_1006030 Ga0182006_10060303 286
306 3300015262 Ga0182007_10000003 Ga0182007_10000003116 286
307 3300015262 Ga0182007_10010434 Ga0182007_100104343 286
308 3300015262 Ga0182007_10013377 Ga0182007_100133772 286
309 3300015682 Ga0183373_1001 Ga0183373_1001855 286
310 3300017792 Ga0163161_10000480 Ga0163161_1000048031 286
311 3300017792 Ga0163161_10001412 Ga0163161_1000141212 286
312 3300017792 Ga0163161_10002000 Ga0163161_1000200011 286
313 3300017792 Ga0163161_10002252 Ga0163161_100022527 286
314 3300017792 Ga0163161_10065108 Ga0163161_100651083 286
315 3300020070 Ga0206356_11440915 Ga0206356_114409151 286
316 3300020075 Ga0206349_1775996 Ga0206349_17759961 286
317 3300020078 Ga0206352_11180388 Ga0206352_111803881 286
318 3300020080 Ga0206350_10817121 Ga0206350_108171211 286
319 3300021384 Ga0213876_10002683 Ga0213876_100026835 286
320 3300025245 Ga0207425_1000002 Ga0207425_1000002497 286
321 3300025258 Ga0209129_1000002 Ga0209129_1000002497 286
322 3300025292 Ga0209676_1000008 Ga0209676_1000008724 286
323 3300025292 Ga0209676_1000329 Ga0209676_100032960 286
324 3300025294 Ga0209025_1000004 Ga0209025_1000004694 286
325 3300025297 Ga0209758_1000006 Ga0209758_1000006694 286
326 3300025298 Ga0209050_1000045 Ga0209050_100004561 286
327 3300025298 Ga0209050_1004335 Ga0209050_10043355 286
328 3300025298 Ga0209050_1028413 Ga0209050_10284132 286
329 3300025302 Ga0207426_1000170 Ga0207426_100017069 286
330 3300025304 Ga0209257_1000006 Ga0209257_1000006299 286
331 3300025728 Ga0207655_1053346 Ga0207655_10533462 286
332 3300025893 Ga0207682_10002294 Ga0207682_100022948 286
333 3300025903 Ga0207680_10182441 Ga0207680_101824411 286
334 3300025907 Ga0207645_10165852 Ga0207645_101658522 286
335 3300025909 Ga0207705_10096843 Ga0207705_100968433 286
336 3300025912 Ga0207707_10115828 Ga0207707_101158281 286
337 3300025912 Ga0207707_10148968 Ga0207707_101489684 286
338 3300025914 Ga0207671_10016931 Ga0207671_100169311 286
339 3300025917 Ga0207660_10165493 Ga0207660_101654932 286
340 3300025919 Ga0207657_10010494 Ga0207657_100104947 286
341 3300025919 Ga0207657_10019554 Ga0207657_100195541 286
342 3300025921 Ga0207652_10165910 Ga0207652_101659102 286
343 3300025931 Ga0207644_10245810 Ga0207644_102458101 286
344 3300025932 Ga0207690_10000228 Ga0207690_1000022826 286
345 3300025933 Ga0207706_10009158 Ga0207706_100091584 286
346 3300025935 Ga0207709_10000010 Ga0207709_10000010291 286
347 3300025940 Ga0207691_10009659 Ga0207691_100096598 286
348 3300025942 Ga0207689_10054406 Ga0207689_100544062 286
349 3300025949 Ga0207667_10140405 Ga0207667_101404052 286
350 3300025960 Ga0207651_10077205 Ga0207651_100772053 286
351 3300025981 Ga0207640_10147515 Ga0207640_101475152 286
352 3300025981 Ga0207640_10340477 Ga0207640_103404772 286
353 3300025986 Ga0207658_10233387 Ga0207658_102333872 286
354 3300026023 Ga0207677_10003558 Ga0207677_100035586 286
355 3300026041 Ga0207639_10051722 Ga0207639_100517222 286
356 3300026078 Ga0207702_10128680 Ga0207702_101286804 286
357 3300026089 Ga0207648_10116164 Ga0207648_101161642 286
358 3300026089 Ga0207648_10171765 Ga0207648_101717653 286
359 3300026095 Ga0207676_10081633 Ga0207676_100816332 286
360 3300026095 Ga0207676_10537394 Ga0207676_105373942 286
361 3300026116 Ga0207674_10071345 Ga0207674_100713454 286
362 3300026121 Ga0207683_10037085 Ga0207683_100370854 286
363 3300026121 Ga0207683_10198088 Ga0207683_101980881 286
364 3300026142 Ga0207698_10036585 Ga0207698_100365855 286
365 3300026142 Ga0207698_10096703 Ga0207698_100967032 286
366 3300026142 Ga0207698_10549282 Ga0207698_105492821 286
367 3300028381 Ga0268264_10204356 Ga0268264_102043562 286
368 3300028653 Ga0265323_10009190 Ga0265323_100091905 286
369 3300028794 Ga0307515_10000016 Ga0307515_10000016362 286
370 3300028794 Ga0307515_10086642 Ga0307515_100866424 286
371 3300031251 Ga0265327_10000117 Ga0265327_1000011755 286
372 3300031251 Ga0265327_10025126 Ga0265327_100251263 286
373 3300031251 Ga0265327_10037210 Ga0265327_100372104 286
374 3300031507 Ga0307509_10029534 Ga0307509_100295342 286
375 3300031507 Ga0307509_10072733 Ga0307509_100727334 286
376 3300031548 Ga0307408_100036636 Ga0307408_1000366363 286
377 3300031727 Ga0316576_10091423 Ga0316576_100914232 286
378 3300031731 Ga0307405_10000042 Ga0307405_1000004273 286
379 3300031903 Ga0307407_10000022 Ga0307407_1000002276 286
380 3300031911 Ga0307412_10000023 Ga0307412_10000023208 286
381 3300031911 Ga0307412_10159756 Ga0307412_101597561 286
382 3300031995 Ga0307409_100019033 Ga0307409_1000190336 286
383 3300031995 Ga0307409_100163751 Ga0307409_1001637512 286
384 3300032002 Ga0307416_100000047 Ga0307416_10000004776 286
385 3300032002 Ga0307416_100039016 Ga0307416_1000390164 286
386 3300032004 Ga0307414_10001020 Ga0307414_100010202 286
387 3300032004 Ga0307414_10001969 Ga0307414_100019698 286
388 3300032004 Ga0307414_10004335 Ga0307414_100043352 286
389 3300032004 Ga0307414_10033584 Ga0307414_100335841 286
390 3300032004 Ga0307414_10054222 Ga0307414_100542222 286
391 3300032004 Ga0307414_10080776 Ga0307414_100807761 286
392 3300032004 Ga0307414_10249063 Ga0307414_102490632 286
393 3300032004 Ga0307414_10354739 Ga0307414_103547391 286
394 3300032004 Ga0307414_10537789 Ga0307414_105377891 286
395 3300032004 Ga0307414_10617180 Ga0307414_106171801 286
396 3300032126 Ga0307415_100060885 Ga0307415_1000608852 286
397 3300033541 Ga0316596_1007373 Ga0316596_10073731 286
398 3300036712 Ga0316584_0218057 Ga0316584_0218057_497_1360 286
399 3300039437 Ga0436365_0038916 Ga0436365_0038916_5136_6002 286
400 3300041506 Ga0451850_49488 Ga0451850_49488_62_925 286
401 3300041916 Ga0452271_57680 Ga0452271_57680_151_1014 286
402 3300042133 Ga0450896_004232 Ga0450896_004232_266_1129 286
403 3300042876 Ga0451577_0007369 Ga0451577_0007369_1250_2113 286
404 3300042876 Ga0451577_0028867 Ga0451577_0028867_4105_4974 286
405 3300042876 Ga0451577_0032817 Ga0451577_0032817_3050_3913 286
406 3300042876 Ga0451577_0174808 Ga0451577_0174808_405_1268 286
407 3300044658 Ga0466972_0000010 Ga0466972_0000010_68391_69263 286
408 3300044673 Ga0453683_0001818 Ga0453683_0001818_8229_9092 286
409 3300044712 Ga0453684_0000310 Ga0453684_0000310_127674_128537 286
410 3300044712 Ga0453684_0004286 Ga0453684_0004286_12986_13849 286
411 3300044712 Ga0453684_0023372 Ga0453684_0023372_6514_7380 286
412 3300044712 Ga0453684_0033152 Ga0453684_0033152_5411_6286 286
413 3300044712 Ga0453684_0240686 Ga0453684_0240686_1146_2009 286
414 3300044735 Ga0466968_0100458 Ga0466968_0100458_175_1047 286
415 3300044765 Ga0466970_0000921 Ga0466970_0000921_3090_3962 286
416 3300044901 Ga0466960_0245941 Ga0466960_0245941_37_909 286
417 3300045051 Ga0451576_0020786 Ga0451576_0020786_5133_5996 286
418 3300045051 Ga0451576_0030791 Ga0451576_0030791_2253_3116 286
419 3300046460 Ga0495638_0000020 Ga0495638_0000020_99399_100262 286
420 3300046512 Ga0495610_0000066 Ga0495610_0000066_20648_21508 286
421 3300046512 Ga0495610_0000463 Ga0495610_0000463_16136_16996 286
422 3300046520 Ga0495637_0028261 Ga0495637_0028261_313_1173 286
423 3300046525 Ga0495663_0043492 Ga0495663_0043492_331_1191 286
424 3300046558 Ga0495633_0087666 Ga0495633_0087666_253_1113 286
425 3300048919 Ga0496116_0004398 Ga0496116_0004398_3323_4183 286
426 3300048920 Ga0496117_0001577 Ga0496117_0001577_16512_17372 286
427 3300048925 Ga0496122_0000591 Ga0496122_0000591_69280_70140 286
428 3300048925 Ga0496122_0022226 Ga0496122_0022226_1592_2452 286
429 3300048926 Ga0496123_0054405 Ga0496123_0054405_662_1522 286
430 3300048927 Ga0496124_0112429 Ga0496124_0112429_1210_2070 286
431 3300048928 Ga0496125_0092509 Ga0496125_0092509_370_1230 286
432 3300048929 Ga0496126_0111374 Ga0496126_0111374_412_1272 286
433 3300049128 Ga0501308_003566 Ga0501308_003566_294_1157 286
434 3300049129 Ga0501309_001878 Ga0501309_001878_961_1824 286
435 3300049129 Ga0501309_004917 Ga0501309_004917_399_1262 286
436 3300049130 Ga0501310_003032 Ga0501310_003032_527_1390 286
437 3300049161 Ga0501305_002098 Ga0501305_002098_995_1858 286
438 3300049161 Ga0501305_008037 Ga0501305_008037_178_1041 286
439 3300049528 Ga0501312_001561 Ga0501312_001561_157_1020 286
440 3300049529 Ga0501313_007784 Ga0501313_007784_227_1090 286
441 3300049531 Ga0501315_001132 Ga0501315_001132_1111_1974 286
442 3300049531 Ga0501315_006828 Ga0501315_006828_339_1202 286
443 3300049536 Ga0501320_003225 Ga0501320_003225_267_1130 286
444 3300049539 Ga0501323_001964 Ga0501323_001964_357_1220 286
445 3300049539 Ga0501323_005328 Ga0501323_005328_191_1054 286
446 3300049551 Ga0501335_006363 Ga0501335_006363_118_981 286
447 3300049571 Ga0501034_0008845 Ga0501034_0008845_8739_9605 286
448 3300049579 Ga0501043_0081846 Ga0501043_0081846_553_1422 286
449 3300049581 Ga0501047_0017081 Ga0501047_0017081_1031_1900 286
450 3300049661 Ga0501217_004889 Ga0501217_004889_460_1323 286
451 3300049686 Ga0501257_001560 Ga0501257_001560_150_1013 286
452 3300049705 Ga0501225_0008370 Ga0501225_0008370_186_1049 286
453 3300049761 Ga0501264_001682 Ga0501264_001682_1058_1921 286
454 3300049774 Ga0501278_005283 Ga0501278_005283_16_879 286
455 3300049823 Ga0501044_0100947 Ga0501044_0100947_209_1075 286
456 3300050511 nmdc:mga08y16_28509_c1 nmdc:mga08y16_28509_c1_491_1354 286
457 3300053090 Ga0500646_0024515 Ga0500646_0024515_186_1049 286
458 3300053093 Ga0500651_0002251 Ga0500651_0002251_8440_9300 286
459 3300053093 Ga0500651_0225361 Ga0500651_0225361_86_949 286
460 3300053105 Ga0500557_006657 Ga0500557_006657_1164_2027 286
461 3300053108 Ga0500562_000035 Ga0500562_000035_11862_12728 286
462 3300053125 Ga0500618_000038 Ga0500618_000038_63225_64085 286
463 3300053125 Ga0500618_002446 Ga0500618_002446_3100_3963 286
464 3300053130 Ga0500642_0069649 Ga0500642_0069649_557_1420 286
465 3300053133 Ga0500655_002609 Ga0500655_002609_2205_3068 286
466 3300053139 Ga0500568_0055744 Ga0500568_0055744_653_1513 286
467 3300053151 Ga0500604_0000207 Ga0500604_0000207_6436_7299 286
468 3300053153 Ga0500616_0000007 Ga0500616_0000007_830491_831354 286
469 3300053153 Ga0500616_0006075 Ga0500616_0006075_1749_2612 286
470 3300053156 Ga0500622_0000031 Ga0500622_0000031_72797_73660 286
471 3300053156 Ga0500622_0000039 Ga0500622_0000039_88476_89339 286
472 3300053156 Ga0500622_0000298 Ga0500622_0000298_46796_47662 286
473 3300053730 Ga0500645_001575 Ga0500645_001575_467_1333 286
474 3300059491 Ga0587070_021869 Ga0587070_021869_190_1053 286
475 3300059492 Ga0587073_0032113 Ga0587073_0032113_203_1066 286
476 3300059493 Ga0587077_025887 Ga0587077_025887_35_898 286
477 3300059504 Ga0587082_030886 Ga0587082_030886_36_899 286
478 3300059508 Ga0587088_018346 Ga0587088_018346_203_1066 286
479 3300059510 Ga0587090_016013 Ga0587090_016013_86_949 286
480 3300059513 Ga0587094_013985 Ga0587094_013985_203_1066 286
481 3300059640 Ga0587067_023209 Ga0587067_023209_192_1055 286
482 3300059644 Ga0587075_015151 Ga0587075_015151_31_894 286
483 3300059645 Ga0587076_022940 Ga0587076_022940_153_1016 286
484 3300059646 Ga0587078_010005 Ga0587078_010005_190_1053 286
485 3300059647 Ga0587079_025590 Ga0587079_025590_203_1066 286
486 3300059655 Ga0587114_011766 Ga0587114_011766_31_894 286
487 3300060344 Ga0587071_025196 Ga0587071_025196_190_1053 286

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04545

Sigma70_r4

Sigma-70, region 4

201

254

0.98

PF00140

Sigma70_r1_2

Sigma-70 factor, region 1.2

17

48

0.97

PF04542

Sigma70_r2

Sigma-70 region 2

54

124

0.97

PF04539

Sigma70_r3

Sigma-70 region 3

133

163

0.94

Feature Viewer

pLDDT pTM Quality
74.12 0.4 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map