F453445

General Info

Members Datasets Scaffolds Average Seq Length
487 265 974 179

Family's Representative Sequence

Representative Sequence 3300013306|Ga0163162_11652240|Ga0163162_116522401
Length 211
Sequence MDRCERTYRHPAVALAARLEKTVRTPSLIKEVLAMKRKSMPTIATVAVVLAVLGGAAISAQDKYSLKSPSGIAFSDFKGYEDWSFVSSARTEEVLKVIAANPEMIAAYKAGVPGNGQPFPEGSKIVKLQWKPKKSTEAPFDVDVPDVFTQAFVMEKDSKRFPDTGGWGYAVFNYDPATAKFTPDAALADCGQSCHVVVKSKDYIFHPYQTR

Samples

Sample ID Description Type Environment
1 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
6 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
7 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
8 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
9 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
10 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
11 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
12 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
35 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
36 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
61 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
67 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
68 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
69 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
70 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
71 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
72 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
74 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
75 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
76 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
80 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
83 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
85 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
86 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
87 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
88 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
89 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
90 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
91 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
92 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
93 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
94 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
95 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
96 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
97 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
98 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
99 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
100 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
101 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
102 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
103 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
104 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
105 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
106 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
107 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
108 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
110 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
111 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
112 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
114 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
115 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
116 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
178 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
179 3300028036 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 Metagenome Rhizosphere
180 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
184 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
185 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
186 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
187 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
188 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
189 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
190 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
191 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
192 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
193 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
194 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
195 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
196 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
197 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
198 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
199 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
200 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
201 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
202 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
203 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
204 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
205 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
206 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
207 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
208 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
209 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
210 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
211 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
212 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
213 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
214 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
215 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
216 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
217 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
218 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
219 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
220 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
221 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
222 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
223 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
224 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
225 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
226 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
227 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
228 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
229 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
230 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
231 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
232 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
233 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
234 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
235 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
236 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
237 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
238 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
239 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
240 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
241 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
242 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
243 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
244 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
245 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
246 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
247 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
248 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
249 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
250 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
251 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
252 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
253 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
254 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
255 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
256 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
257 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
258 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
259 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
260 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
261 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
262 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
263 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
264 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
265 2739367700 Dyella sp. YR388 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.56
Metatranscriptomes 1.23
Isolates 0.21

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.37
Nodule 0
Rhizoplane 4.52
Rhizosphere 84.19
Stem 0
Stem Tuber 0
Unclassified 0.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0163162_11652240 3300013306 Bacteria 731
2 JGI24752J21851_1004957 3300001976 Bacteria 1741
3 rootL2_10189407 3300003322 Bacteria 2051
4 rootH1_10096744 3300003323 Bacteria 2918
5 Ga0055527_1004032 3300003760 Bacteria 2073
6 Ga0055526_1019258 3300003771 Bacteria 2495
7 Ga0055536_1000064 3300003781 Bacteria 98237
8 Ga0055530_10016682 3300003791 Bacteria 2333
9 Ga0055531_10002632 3300003794 Bacteria 11875
10 Ga0055531_10016568 3300003794 Bacteria 3170
11 Ga0055531_10028038 3300003794 Bacteria 1954
12 Ga0058863_11378309 3300004799 Bacteria 598
13 Ga0058861_11659729 3300004800 Bacteria 666
14 Ga0065715_10116852 3300005293 Bacteria 2366
15 Ga0065707_10513813 3300005295 Bacteria 747
16 Ga0070676_10020990 3300005328 Bacteria 3654
17 Ga0070683_100005098 3300005329 Bacteria 10922
18 Ga0070690_100123650 3300005330 Bacteria 1739
19 Ga0070677_10004965 3300005333 Bacteria 4370
20 Ga0068869_100133654 3300005334 Bacteria 1909
21 Ga0070666_10120819 3300005335 Bacteria 1817
22 Ga0068868_100080865 3300005338 Bacteria 2604
23 Ga0068868_100385848 3300005338 Bacteria 1206
24 Ga0068868_100398970 3300005338 Bacteria 1187
25 Ga0068868_100546958 3300005338 Bacteria 1020
26 Ga0070660_100007134 3300005339 Bacteria 7768
27 Ga0070660_100413331 3300005339 Bacteria 1116
28 Ga0070689_100048985 3300005340 Bacteria 3260
29 Ga0070689_100145615 3300005340 Bacteria 1908
30 Ga0070687_100004841 3300005343 Bacteria 5396
31 Ga0070661_100018776 3300005344 Bacteria 4921
32 Ga0070661_100303470 3300005344 Bacteria 1243
33 Ga0070668_100012104 3300005347 Bacteria 6425
34 Ga0070669_100083682 3300005353 Bacteria 2379
35 Ga0070675_100058793 3300005354 Bacteria 3171
36 Ga0070675_100082976 3300005354 Bacteria 2674
37 Ga0070671_100010112 3300005355 Bacteria 7578
38 Ga0070671_100019663 3300005355 Bacteria 5499
39 Ga0070671_100090533 3300005355 Bacteria 2561
40 Ga0070674_100003995 3300005356 Bacteria 8359
41 Ga0070673_100055695 3300005364 Bacteria 3116
42 Ga0070688_100044511 3300005365 Bacteria 2739
43 Ga0070688_100880369 3300005365 Bacteria 705
44 Ga0070659_100005373 3300005366 Bacteria 9194
45 Ga0070667_100000247 3300005367 Bacteria 61225
46 Ga0070667_100004352 3300005367 Bacteria 11944
47 Ga0070667_100041496 3300005367 Bacteria 3860
48 Ga0070667_100236618 3300005367 Bacteria 1630
49 Ga0070713_100000307 3300005436 Bacteria 32297
50 Ga0070713_100000454 3300005436 Bacteria 26216
51 Ga0070710_10049973 3300005437 Bacteria 2342
52 Ga0070711_100029642 3300005439 Bacteria 3613
53 Ga0070663_100000456 3300005455 Bacteria 21690
54 Ga0070663_100006644 3300005455 Bacteria 6976
55 Ga0070663_100039218 3300005455 Bacteria 3309
56 Ga0070678_100009665 3300005456 Bacteria 5857
57 Ga0070678_100076167 3300005456 Bacteria 2526
58 Ga0070678_100820233 3300005456 Bacteria 846
59 Ga0070662_100998131 3300005457 Bacteria 717
60 Ga0070681_10166128 3300005458 Bacteria 2129
61 Ga0068867_100087801 3300005459 Bacteria 2355
62 Ga0070707_100000407 3300005468 Bacteria 42543
63 Ga0070679_100099260 3300005530 Bacteria 2899
64 Ga0070684_100292576 3300005535 Bacteria 1493
65 Ga0068853_100003182 3300005539 Bacteria 12543
66 Ga0068853_100536367 3300005539 Bacteria 1107
67 Ga0070672_100001909 3300005543 Bacteria 13066
68 Ga0070672_100275030 3300005543 Bacteria 1423
69 Ga0070686_100020944 3300005544 Bacteria 3878
70 Ga0070696_100364406 3300005546 Bacteria 1122
71 Ga0070693_100061930 3300005547 Bacteria 2177
72 Ga0070665_100000418 3300005548 Bacteria 62048
73 Ga0070665_100018348 3300005548 Bacteria 7013
74 Ga0070665_100035649 3300005548 Bacteria 5003
75 Ga0070665_100074846 3300005548 Bacteria 3392
76 Ga0070665_100373774 3300005548 Bacteria 1432
77 Ga0070665_100392883 3300005548 Bacteria 1395
78 Ga0070664_100128371 3300005564 Bacteria 2226
79 Ga0068857_100017349 3300005577 Bacteria 6307
80 Ga0068856_100073766 3300005614 Bacteria 3378
81 Ga0068856_101218943 3300005614 Bacteria 769
82 Ga0070702_100020445 3300005615 Bacteria 3468
83 Ga0070702_100145673 3300005615 Bacteria 1514
84 Ga0068852_100010336 3300005616 Bacteria 6969
85 Ga0068852_100709275 3300005616 Bacteria 1016
86 Ga0068859_100000493 3300005617 Bacteria 38872
87 Ga0068864_100034090 3300005618 Bacteria 4329
88 Ga0068864_100105070 3300005618 Bacteria 2510
89 Ga0068864_100126127 3300005618 Bacteria 2294
90 Ga0068864_100135180 3300005618 Bacteria 2219
91 Ga0068866_10119750 3300005718 Bacteria 1481
92 Ga0068866_10690491 3300005718 Bacteria 699
93 Ga0068861_100038230 3300005719 Bacteria 3572
94 Ga0068861_100142339 3300005719 Bacteria 1959
95 Ga0068851_10002458 3300005834 Bacteria 8138
96 Ga0068851_10003365 3300005834 Bacteria 7114
97 Ga0068851_10273609 3300005834 Bacteria 964
98 Ga0068870_10011018 3300005840 Bacteria 4177
99 Ga0068870_10094031 3300005840 Bacteria 1682
100 Ga0068863_100003675 3300005841 Bacteria 15152
101 Ga0068863_100008011 3300005841 Bacteria 10322
102 Ga0068858_100003245 3300005842 Bacteria 16212
103 Ga0068858_100190045 3300005842 Bacteria 1940
104 Ga0068858_100767602 3300005842 Bacteria 940
105 Ga0068860_100019889 3300005843 Bacteria 6511
106 Ga0068860_100978241 3300005843 Bacteria 864
107 Ga0068862_100008549 3300005844 Bacteria 8470
108 Ga0068862_100013612 3300005844 Bacteria 6737
109 Ga0068862_101153191 3300005844 Bacteria 772
110 Ga0081455_10002062 3300005937 Bacteria 24040
111 Ga0081455_10175247 3300005937 Bacteria 1629
112 Ga0081540_1002377 3300005983 Bacteria 15364
113 Ga0070716_100605700 3300006173 Bacteria 824
114 Ga0075367_10377489 3300006178 Bacteria 895
115 Ga0075369_10126785 3300006186 Bacteria 1158
116 Ga0075427_10056009 3300006194 Bacteria 685
117 Ga0097621_100373211 3300006237 Bacteria 1273
118 Ga0097621_100385485 3300006237 Bacteria 1253
119 Ga0075370_10053617 3300006353 Bacteria 2289
120 Ga0068871_100025891 3300006358 Bacteria 4571
121 Ga0068871_100154490 3300006358 Unclassified 1959
122 Ga0068871_100181206 3300006358 Bacteria 1810
123 Ga0068871_100382332 3300006358 Bacteria 1251
124 Ga0075428_100217267 3300006844 Bacteria 2065
125 Ga0075428_100286670 3300006844 Bacteria 1772
126 Ga0075428_100481670 3300006844 Bacteria 1328
127 Ga0075430_100446050 3300006846 Bacteria 1068
128 Ga0068865_100007846 3300006881 Bacteria 6587
129 Ga0068865_100413190 3300006881 Bacteria 1108
130 Ga0068865_100459793 3300006881 Bacteria 1054
131 Ga0097620_100000493 3300006931 Bacteria 38872
132 Ga0105240_10011849 3300009093 Bacteria 12108
133 Ga0105240_10029630 3300009093 Bacteria 7125
134 Ga0105240_10279964 3300009093 Bacteria 1916
135 Ga0105240_10284447 3300009093 Bacteria 1898
136 Ga0111539_10003869 3300009094 Bacteria 19711
137 Ga0105245_10002780 3300009098 Bacteria 15730
138 Ga0105245_10046937 3300009098 Bacteria 3860
139 Ga0105245_11057060 3300009098 Bacteria 857
140 Ga0105247_10000645 3300009101 Bacteria 27935
141 Ga0105247_10049376 3300009101 Bacteria 2587
142 Ga0105247_10119312 3300009101 Bacteria 1707
143 Ga0105247_10894865 3300009101 Bacteria 685
144 Ga0114129_10182392 3300009147 Bacteria 2855
145 Ga0105243_10168969 3300009148 Bacteria 1892
146 Ga0105243_10815152 3300009148 Bacteria 921
147 Ga0105243_11030437 3300009148 Bacteria 827
148 Ga0105243_11079269 3300009148 Bacteria 810
149 Ga0105241_10003569 3300009174 Bacteria 11568
150 Ga0105241_10146721 3300009174 Bacteria 1926
151 Ga0105242_10245034 3300009176 Bacteria 1613
152 Ga0105242_10750358 3300009176 Bacteria 961
153 Ga0105242_10839615 3300009176 Bacteria 913
154 Ga0105248_10000881 3300009177 Bacteria 33646
155 Ga0105248_10029328 3300009177 Bacteria 6138
156 Ga0105248_10106628 3300009177 Bacteria 3159
157 Ga0105248_10110253 3300009177 Bacteria 3103
158 Ga0105248_10141751 3300009177 Bacteria 2712
159 Ga0105248_10886231 3300009177 Bacteria 1007
160 Ga0105248_11515734 3300009177 Bacteria 759
161 Ga0105237_10003203 3300009545 Bacteria 19613
162 Ga0105237_10293115 3300009545 Bacteria 1630
163 Ga0105237_10303280 3300009545 Bacteria 1600
164 Ga0105237_10426907 3300009545 Bacteria 1331
165 Ga0105238_10032611 3300009551 Bacteria 5300
166 Ga0105238_10717088 3300009551 Bacteria 1013
167 Ga0105238_10875232 3300009551 Bacteria 916
168 Ga0105249_10000287 3300009553 Bacteria 51938
169 Ga0105249_10017938 3300009553 Bacteria 6290
170 Ga0105249_10067664 3300009553 Bacteria 3291
171 Ga0105249_10294372 3300009553 Bacteria 1626
172 Ga0105239_10018619 3300010375 Bacteria 7671
173 Ga0105239_10676873 3300010375 Bacteria 1179
174 Ga0105239_11390851 3300010375 Bacteria 810
175 Ga0105246_10000310 3300011119 Bacteria 25833
176 Ga0157373_10142189 3300013100 Bacteria 1688
177 Ga0157371_10012033 3300013102 Bacteria 6633
178 Ga0157370_10859290 3300013104 Bacteria 824
179 Ga0157374_10005705 3300013296 Bacteria 10500
180 Ga0157374_10144615 3300013296 Bacteria 2309
181 Ga0157374_10157161 3300013296 Bacteria 2213
182 Ga0157374_10906869 3300013296 Bacteria 899
183 Ga0157378_10184154 3300013297 Bacteria 1966
184 Ga0157378_10291643 3300013297 Bacteria 1576
185 Ga0157378_10514823 3300013297 Bacteria 1197
186 Ga0163162_10054955 3300013306 Bacteria 4007
187 Ga0163162_10106157 3300013306 Bacteria 2903
188 Ga0163162_10590901 3300013306 Bacteria 1237
189 Ga0157372_10289940 3300013307 Bacteria 1903
190 Ga0157375_10017639 3300013308 Bacteria 6448
191 Ga0157375_10390075 3300013308 Bacteria 1559
192 Ga0157375_10422128 3300013308 Bacteria 1500
193 Ga0157375_10606869 3300013308 Bacteria 1253
194 Ga0163163_10089293 3300014325 Bacteria 3094
195 Ga0163163_10541144 3300014325 Bacteria 1227
196 Ga0163163_10823877 3300014325 Bacteria 991
197 Ga0157380_10108381 3300014326 Bacteria 2328
198 Ga0157380_10130539 3300014326 Bacteria 2143
199 Ga0157380_10178114 3300014326 Bacteria 1865
200 Ga0157377_10411343 3300014745 Bacteria 924
201 Ga0157379_10071962 3300014968 Bacteria 3093
202 Ga0157379_10117762 3300014968 Bacteria 2389
203 Ga0157379_10146199 3300014968 Bacteria 2132
204 Ga0157379_10240488 3300014968 Bacteria 1642
205 Ga0157376_10138761 3300014969 Bacteria 2179
206 Ga0157376_10182665 3300014969 Bacteria 1918
207 Ga0157376_10440606 3300014969 Bacteria 1268
208 Ga0157376_10544115 3300014969 Bacteria 1148
209 Ga0157376_10849379 3300014969 Bacteria 928
210 Ga0163161_10005251 3300017792 Bacteria 9015
211 Ga0206355_1449314 3300020076 Bacteria 593
212 Ga0206350_10607791 3300020080 Bacteria 691
213 Ga0209672_101532 3300025228 Bacteria 8018
214 Ga0209759_1005650 3300025256 Bacteria 4326
215 Ga0209130_1002992 3300025284 Bacteria 7661
216 Ga0209675_1005888 3300025291 Bacteria 5029
217 Ga0209676_1000235 3300025292 Bacteria 119060
218 Ga0209676_1001312 3300025292 Bacteria 25251
219 Ga0209025_1079712 3300025294 Bacteria 1118
220 Ga0209564_1005554 3300025295 Bacteria 7138
221 Ga0209564_1008773 3300025295 Bacteria 4930
222 Ga0209758_1101181 3300025297 Bacteria 819
223 Ga0209050_1001408 3300025298 Bacteria 26095
224 Ga0209257_1000331 3300025304 Bacteria 98650
225 Ga0209257_1001583 3300025304 Bacteria 26197
226 Ga0207697_10010428 3300025315 Bacteria 3973
227 Ga0207656_10001957 3300025321 Bacteria 6850
228 Ga0207682_10138045 3300025893 Bacteria 1092
229 Ga0207642_10393870 3300025899 Bacteria 827
230 Ga0207710_10001902 3300025900 Bacteria 10012
231 Ga0207710_10028175 3300025900 Bacteria 2437
232 Ga0207680_10083074 3300025903 Bacteria 2018
233 Ga0207680_10165834 3300025903 Bacteria 1484
234 Ga0207680_10497633 3300025903 Bacteria 868
235 Ga0207647_10001252 3300025904 Bacteria 19532
236 Ga0207685_10142434 3300025905 Bacteria 1076
237 Ga0207699_10094280 3300025906 Bacteria 1885
238 Ga0207699_10435152 3300025906 Bacteria 939
239 Ga0207645_10000252 3300025907 Bacteria 44594
240 Ga0207645_10042308 3300025907 Bacteria 2915
241 Ga0207643_10000915 3300025908 Bacteria 17653
242 Ga0207705_10157691 3300025909 Bacteria 1703
243 Ga0207654_10170115 3300025911 Bacteria 1414
244 Ga0207707_10393337 3300025912 Bacteria 1191
245 Ga0207695_10003169 3300025913 Bacteria 23443
246 Ga0207695_10010837 3300025913 Bacteria 11105
247 Ga0207695_10473539 3300025913 Bacteria 1135
248 Ga0207671_10004128 3300025914 Bacteria 14038
249 Ga0207671_10218018 3300025914 Bacteria 1494
250 Ga0207671_10948192 3300025914 Bacteria 679
251 Ga0207693_10037338 3300025915 Bacteria 3829
252 Ga0207663_10077906 3300025916 Bacteria 2159
253 Ga0207657_10002694 3300025919 Bacteria 19148
254 Ga0207649_10000855 3300025920 Bacteria 19489
255 Ga0207652_10844105 3300025921 Bacteria 811
256 Ga0207646_10000736 3300025922 Bacteria 42554
257 Ga0207681_10399781 3300025923 Bacteria 1109
258 Ga0207694_10018136 3300025924 Bacteria 5321
259 Ga0207694_10355478 3300025924 Bacteria 1213
260 Ga0207694_10542155 3300025924 Bacteria 976
261 Ga0207650_10000665 3300025925 Bacteria 27103
262 Ga0207650_10142095 3300025925 Bacteria 1888
263 Ga0207659_10066299 3300025926 Bacteria 2619
264 Ga0207659_10488348 3300025926 Bacteria 1041
265 Ga0207659_10533940 3300025926 Bacteria 996
266 Ga0207687_10128807 3300025927 Bacteria 1904
267 Ga0207687_10506838 3300025927 Bacteria 1008
268 Ga0207700_10000341 3300025928 Bacteria 27463
269 Ga0207700_10000415 3300025928 Bacteria 25010
270 Ga0207700_11270518 3300025928 Bacteria 656
271 Ga0207664_10257782 3300025929 Bacteria 1524
272 Ga0207644_10000989 3300025931 Bacteria 18148
273 Ga0207644_10001059 3300025931 Bacteria 17593
274 Ga0207644_10003609 3300025931 Bacteria 10025
275 Ga0207644_10148771 3300025931 Bacteria 1810
276 Ga0207690_10040843 3300025932 Bacteria 3035
277 Ga0207690_10184390 3300025932 Bacteria 1574
278 Ga0207706_10015243 3300025933 Bacteria 6952
279 Ga0207686_10046619 3300025934 Bacteria 2675
280 Ga0207686_10052630 3300025934 Bacteria 2542
281 Ga0207709_10184952 3300025935 Bacteria 1475
282 Ga0207669_10021387 3300025937 Bacteria 3415
283 Ga0207669_10084911 3300025937 Bacteria 2042
284 Ga0207669_10088512 3300025937 Bacteria 2008
285 Ga0207669_10186195 3300025937 Bacteria 1493
286 Ga0207704_10049991 3300025938 Bacteria 2520
287 Ga0207704_10320443 3300025938 Bacteria 1195
288 Ga0207704_10572646 3300025938 Bacteria 921
289 Ga0207665_10114516 3300025939 Bacteria 1898
290 Ga0207691_10001266 3300025940 Bacteria 25285
291 Ga0207691_10309631 3300025940 Bacteria 1355
292 Ga0207711_10000233 3300025941 Bacteria 59549
293 Ga0207711_10043317 3300025941 Bacteria 3838
294 Ga0207711_10087309 3300025941 Bacteria 2736
295 Ga0207711_10095068 3300025941 Bacteria 2627
296 Ga0207711_10122070 3300025941 Bacteria 2327
297 Ga0207711_10125646 3300025941 Bacteria 2294
298 Ga0207711_10145612 3300025941 Bacteria 2134
299 Ga0207711_11485154 3300025941 Bacteria 621
300 Ga0207689_10000615 3300025942 Bacteria 34012
301 Ga0207661_10039347 3300025944 Bacteria 3711
302 Ga0207661_10371766 3300025944 Bacteria 1292
303 Ga0207679_10000051 3300025945 Bacteria 111207
304 Ga0207679_10179919 3300025945 Bacteria 1748
305 Ga0207667_10567984 3300025949 Bacteria 1146
306 Ga0207651_10001714 3300025960 Bacteria 10118
307 Ga0207712_10000143 3300025961 Bacteria 74697
308 Ga0207712_10045574 3300025961 Bacteria 3037
309 Ga0207712_10412296 3300025961 Bacteria 1138
310 Ga0207668_10165796 3300025972 Bacteria 1727
311 Ga0207640_11291798 3300025981 Bacteria 651
312 Ga0207640_11341301 3300025981 Bacteria 640
313 Ga0207658_10000013 3300025986 Bacteria 220396
314 Ga0207658_10003842 3300025986 Bacteria 10581
315 Ga0207658_10113233 3300025986 Bacteria 2149
316 Ga0207658_10251349 3300025986 Bacteria 1502
317 Ga0207658_10321983 3300025986 Bacteria 1339
318 Ga0207658_10482534 3300025986 Bacteria 1102
319 Ga0207677_10347626 3300026023 Bacteria 1241
320 Ga0207677_10777215 3300026023 Bacteria 856
321 Ga0207677_11011884 3300026023 Bacteria 754
322 Ga0207677_11048776 3300026023 Bacteria 741
323 Ga0207677_11139279 3300026023 Bacteria 712
324 Ga0207703_10009880 3300026035 Bacteria 7485
325 Ga0207703_10276988 3300026035 Bacteria 1522
326 Ga0207639_10012494 3300026041 Bacteria 5915
327 Ga0207639_10743349 3300026041 Bacteria 912
328 Ga0207678_10000178 3300026067 Bacteria 54207
329 Ga0207678_10000521 3300026067 Bacteria 34912
330 Ga0207678_10037987 3300026067 Bacteria 4186
331 Ga0207678_10098558 3300026067 Bacteria 2497
332 Ga0207641_10000020 3300026088 Bacteria 286415
333 Ga0207641_10005949 3300026088 Bacteria 10338
334 Ga0207641_10011673 3300026088 Bacteria 7214
335 Ga0207641_11370159 3300026088 Bacteria 708
336 Ga0207648_10000698 3300026089 Bacteria 37564
337 Ga0207648_10042492 3300026089 Bacteria 3990
338 Ga0207676_10000081 3300026095 Bacteria 92635
339 Ga0207676_10035837 3300026095 Bacteria 3770
340 Ga0207676_10472907 3300026095 Bacteria 1185
341 Ga0207676_10485904 3300026095 Bacteria 1170
342 Ga0207674_10000163 3300026116 Bacteria 79568
343 Ga0207674_10013290 3300026116 Bacteria 9143
344 Ga0207675_100006376 3300026118 Bacteria 11184
345 Ga0207675_100066148 3300026118 Bacteria 3378
346 Ga0207675_100476034 3300026118 Bacteria 1240
347 Ga0207683_10004496 3300026121 Bacteria 12032
348 Ga0207683_10280032 3300026121 Bacteria 1524
349 Ga0207698_10053197 3300026142 Bacteria 3106
350 Ga0207428_10000081 3300027907 Bacteria 136049
351 Ga0265354_1000144 3300028016 Bacteria 12925
352 Ga0265355_1000051 3300028036 Bacteria 3787
353 Ga0268266_10000003 3300028379 Bacteria 1701703
354 Ga0268266_10006369 3300028379 Bacteria 10815
355 Ga0268266_10070212 3300028379 Bacteria 3035
356 Ga0268266_10083112 3300028379 Bacteria 2795
357 Ga0268266_10250866 3300028379 Bacteria 1637
358 Ga0268266_10466121 3300028379 Bacteria 1202
359 Ga0268265_10018878 3300028380 Bacteria 4785
360 Ga0268265_10279803 3300028380 Bacteria 1492
361 Ga0268265_10467925 3300028380 Bacteria 1181
362 Ga0268265_11150395 3300028380 Bacteria 772
363 Ga0268265_11429999 3300028380 Bacteria 694
364 Ga0268264_10020885 3300028381 Bacteria 5349
365 Ga0268264_10064486 3300028381 Bacteria 3083
366 Ga0268264_10145420 3300028381 Bacteria 2119
367 Ga0268264_10499058 3300028381 Bacteria 1187
368 Ga0265318_10000614 3300028577 Bacteria 24662
369 Ga0307511_10025379 3300030521 Bacteria 5465
370 Ga0265770_1001679 3300030878 Bacteria 3033
371 Ga0265328_10214507 3300031239 Bacteria 732
372 Ga0265320_10000189 3300031240 Bacteria 51176
373 Ga0265320_10166262 3300031240 Bacteria 992
374 Ga0265325_10034789 3300031241 Bacteria 2678
375 Ga0265325_10043493 3300031241 Bacteria 2343
376 Ga0265325_10054326 3300031241 Bacteria 2051
377 Ga0265325_10066840 3300031241 Bacteria 1812
378 Ga0265329_10000655 3300031242 Bacteria 17736
379 Ga0265340_10050326 3300031247 Bacteria 2021
380 Ga0265339_10005239 3300031249 Bacteria 8659
381 Ga0265339_10214276 3300031249 Bacteria 945
382 Ga0265331_10000021 3300031250 Bacteria 242632
383 Ga0265331_10066907 3300031250 Bacteria 1686
384 Ga0265316_10002339 3300031344 Bacteria 19784
385 Ga0307513_10023721 3300031456 Bacteria 7161
386 Ga0307513_10058003 3300031456 Bacteria 4119
387 Ga0307513_10078076 3300031456 Bacteria 3426
388 Ga0307513_10176715 3300031456 Bacteria 2004
389 Ga0265313_10005141 3300031595 Bacteria 9741
390 Ga0265313_10008542 3300031595 Bacteria 6787
391 Ga0265342_10000032 3300031712 Bacteria 150633
392 Ga0373943_0080570 3300035170 Bacteria 1669
393 Ga0373955_0071759 3300035172 Bacteria 1938
394 Ga0373933_0109615 3300035724 Bacteria 1721
395 Ga0373947_0504057 3300035725 Bacteria 823
396 Ga0373937_0159985 3300036401 Bacteria 2111
397 Ga0373937_0191590 3300036401 Bacteria 1921
398 Ga0373937_0803826 3300036401 Bacteria 888
399 Ga0436365_0619737 3300039437 Bacteria 1137
400 Ga0436363_0659851 3300039450 Bacteria 981
401 Ga0436363_1322193 3300039450 Bacteria 816
402 Ga0439436_0139674 3300041404 Bacteria 681
403 Ga0439465_0070806 3300041413 Bacteria 1168
404 Ga0451793_1112945 3300041452 Unclassified 669
405 Ga0451802_0216574 3300041460 Bacteria 732
406 Ga0451853_3382773 3300041512 Bacteria 1362
407 Ga0466972_0145235 3300044658 Bacteria 1116
408 Ga0466970_0449474 3300044765 Bacteria 739
409 Ga0451576_0080406 3300045051 Bacteria 3391
410 Ga0466967_0059051 3300045976 Bacteria 3393
411 Ga0495592_0569589 3300046454 Bacteria 694
412 Ga0495629_0036502 3300046459 Bacteria 3469
413 Ga0495638_0000343 3300046460 Bacteria 58771
414 Ga0495638_0019931 3300046460 Bacteria 4434
415 Ga0495650_0003718 3300046471 Bacteria 10921
416 Ga0495580_0310981 3300046472 Bacteria 1072
417 Ga0495639_0184032 3300046475 Bacteria 1018
418 Ga0495585_0139986 3300046492 Bacteria 1268
419 Ga0495585_0336364 3300046492 Bacteria 736
420 Ga0495606_0000242 3300046507 Bacteria 96491
421 Ga0495632_0192200 3300046519 Bacteria 932
422 Ga0495642_0053105 3300046528 Bacteria 1669
423 Ga0495621_0108607 3300046539 Bacteria 1062
424 Ga0495668_0197585 3300046616 Bacteria 1101
425 Ga0495634_0225102 3300046642 Bacteria 1156
426 Ga0495625_0055247 3300046660 Bacteria 2832
427 Ga0495625_0066673 3300046660 Bacteria 2535
428 Ga0495625_0099782 3300046660 Bacteria 1996
429 Ga0495625_0250149 3300046660 Bacteria 1151
430 Ga0495658_0607482 3300046683 Bacteria 701
431 Ga0495613_0779347 3300046689 Bacteria 625
432 Ga0495649_0002991 3300046694 Bacteria 11606
433 Ga0495649_0288357 3300046694 Bacteria 838
434 Ga0495674_0143474 3300047319 Bacteria 2006
435 Ga0495676_0781973 3300047321 Bacteria 615
436 Ga0495684_0144625 3300047471 Bacteria 1781
437 Ga0495686_0001451 3300047472 Bacteria 25820
438 Ga0496102_0237535 3300048905 Bacteria 1718
439 Ga0496104_0089270 3300048907 Bacteria 2945
440 Ga0496104_0512599 3300048907 Bacteria 1111
441 Ga0496104_0529909 3300048907 Bacteria 1089
442 Ga0496104_1230833 3300048907 Bacteria 652
443 Ga0496108_0001499 3300048911 Bacteria 18467
444 Ga0496108_0462234 3300048911 Bacteria 1109
445 Ga0496109_0000247 3300048912 Bacteria 51929
446 Ga0496109_0234410 3300048912 Bacteria 1727
447 Ga0496109_0280082 3300048912 Bacteria 1572
448 Ga0496110_0000506 3300048913 Bacteria 26464
449 Ga0496110_0375914 3300048913 Bacteria 1295
450 Ga0496111_0010383 3300048914 Bacteria 6246
451 Ga0496112_0000062 3300048915 Bacteria 72601
452 Ga0496113_0000663 3300048916 Bacteria 17441
453 Ga0496115_0000177 3300048918 Bacteria 59539
454 Ga0496115_0032053 3300048918 Bacteria 4145
455 Ga0496115_0103707 3300048918 Bacteria 2333
456 Ga0496115_0140780 3300048918 Bacteria 1990
457 Ga0496115_0704788 3300048918 Bacteria 793
458 Ga0496121_0005151 3300048924 Bacteria 16990
459 Ga0496121_0080183 3300048924 Bacteria 2589
460 Ga0496122_0000062 3300048925 Bacteria 241387
461 Ga0496123_0000253 3300048926 Bacteria 108364
462 Ga0496124_0138612 3300048927 Bacteria 1923
463 Ga0496124_0448093 3300048927 Bacteria 881
464 Ga0496126_0008515 3300048929 Bacteria 11055
465 Ga0496126_0025191 3300048929 Bacteria 5728
466 Ga0496126_0030874 3300048929 Bacteria 5072
467 Ga0496126_0136467 3300048929 Bacteria 2115
468 Ga0496126_0270493 3300048929 Bacteria 1410
469 Ga0495682_0039427 3300049460 Bacteria 1734
470 Ga0501043_0005167 3300049579 Bacteria 10559
471 Ga0501047_0022093 3300049581 Bacteria 6112
472 Ga0501044_0091072 3300049823 Bacteria 3076
473 nmdc:mga03683_511846_c1 3300050489 Bacteria 582
474 nmdc:mga0k408_223732_c1 3300050493 Bacteria 1123
475 nmdc:mga07m45_31627_c1 3300050496 Bacteria 2090
476 nmdc:mga08y16_257473_c1 3300050511 Bacteria 1802
477 nmdc:mga08y16_31_c1 3300050511 Bacteria 195124
478 nmdc:mga0a205_727379_c1 3300050515 Bacteria 842
479 Ga0495619_0228442 3300053085 Bacteria 1289
480 Ga0500643_000682 3300053087 Bacteria 22753
481 Ga0500595_055992 3300053119 Bacteria 1206
482 Ga0500597_001914 3300053120 Bacteria 5552
483 Ga0500658_0223818 3300053134 Bacteria 863
484 Ga0500559_0000012 3300053136 Bacteria 164222
485 Ga0500622_0026033 3300053156 Bacteria 3089
486 Ga0587062_034735 3300059639 Bacteria 790
487 2739730341 2739367700 Bacteria 4747630
488 Ga0163162_11652240
489 JGI24752J21851_1004957
490 rootL2_10189407
491 rootH1_10096744
492 Ga0055527_1004032
493 Ga0055526_1019258
494 Ga0055536_1000064
495 Ga0055530_10016682
496 Ga0055531_10002632
497 Ga0055531_10016568
498 Ga0055531_10028038
499 Ga0058863_11378309
500 Ga0058861_11659729
501 Ga0065715_10116852
502 Ga0065707_10513813
503 Ga0070676_10020990
504 Ga0070683_100005098
505 Ga0070690_100123650
506 Ga0070677_10004965
507 Ga0068869_100133654
508 Ga0070666_10120819
509 Ga0068868_100080865
510 Ga0068868_100385848
511 Ga0068868_100398970
512 Ga0068868_100546958
513 Ga0070660_100007134
514 Ga0070660_100413331
515 Ga0070689_100048985
516 Ga0070689_100145615
517 Ga0070687_100004841
518 Ga0070661_100018776
519 Ga0070661_100303470
520 Ga0070668_100012104
521 Ga0070669_100083682
522 Ga0070675_100058793
523 Ga0070675_100082976
524 Ga0070671_100010112
525 Ga0070671_100019663
526 Ga0070671_100090533
527 Ga0070674_100003995
528 Ga0070673_100055695
529 Ga0070688_100044511
530 Ga0070688_100880369
531 Ga0070659_100005373
532 Ga0070667_100000247
533 Ga0070667_100004352
534 Ga0070667_100041496
535 Ga0070667_100236618
536 Ga0070713_100000307
537 Ga0070713_100000454
538 Ga0070710_10049973
539 Ga0070711_100029642
540 Ga0070663_100000456
541 Ga0070663_100006644
542 Ga0070663_100039218
543 Ga0070678_100009665
544 Ga0070678_100076167
545 Ga0070678_100820233
546 Ga0070662_100998131
547 Ga0070681_10166128
548 Ga0068867_100087801
549 Ga0070707_100000407
550 Ga0070679_100099260
551 Ga0070684_100292576
552 Ga0068853_100003182
553 Ga0068853_100536367
554 Ga0070672_100001909
555 Ga0070672_100275030
556 Ga0070686_100020944
557 Ga0070696_100364406
558 Ga0070693_100061930
559 Ga0070665_100000418
560 Ga0070665_100018348
561 Ga0070665_100035649
562 Ga0070665_100074846
563 Ga0070665_100373774
564 Ga0070665_100392883
565 Ga0070664_100128371
566 Ga0068857_100017349
567 Ga0068856_100073766
568 Ga0068856_101218943
569 Ga0070702_100020445
570 Ga0070702_100145673
571 Ga0068852_100010336
572 Ga0068852_100709275
573 Ga0068859_100000493
574 Ga0068864_100034090
575 Ga0068864_100105070
576 Ga0068864_100126127
577 Ga0068864_100135180
578 Ga0068866_10119750
579 Ga0068866_10690491
580 Ga0068861_100038230
581 Ga0068861_100142339
582 Ga0068851_10002458
583 Ga0068851_10003365
584 Ga0068851_10273609
585 Ga0068870_10011018
586 Ga0068870_10094031
587 Ga0068863_100003675
588 Ga0068863_100008011
589 Ga0068858_100003245
590 Ga0068858_100190045
591 Ga0068858_100767602
592 Ga0068860_100019889
593 Ga0068860_100978241
594 Ga0068862_100008549
595 Ga0068862_100013612
596 Ga0068862_101153191
597 Ga0081455_10002062
598 Ga0081455_10175247
599 Ga0081540_1002377
600 Ga0070716_100605700
601 Ga0075367_10377489
602 Ga0075369_10126785
603 Ga0075427_10056009
604 Ga0097621_100373211
605 Ga0097621_100385485
606 Ga0075370_10053617
607 Ga0068871_100025891
608 Ga0068871_100154490
609 Ga0068871_100181206
610 Ga0068871_100382332
611 Ga0075428_100217267
612 Ga0075428_100286670
613 Ga0075428_100481670
614 Ga0075430_100446050
615 Ga0068865_100007846
616 Ga0068865_100413190
617 Ga0068865_100459793
618 Ga0097620_100000493
619 Ga0105240_10011849
620 Ga0105240_10029630
621 Ga0105240_10279964
622 Ga0105240_10284447
623 Ga0111539_10003869
624 Ga0105245_10002780
625 Ga0105245_10046937
626 Ga0105245_11057060
627 Ga0105247_10000645
628 Ga0105247_10049376
629 Ga0105247_10119312
630 Ga0105247_10894865
631 Ga0114129_10182392
632 Ga0105243_10168969
633 Ga0105243_10815152
634 Ga0105243_11030437
635 Ga0105243_11079269
636 Ga0105241_10003569
637 Ga0105241_10146721
638 Ga0105242_10245034
639 Ga0105242_10750358
640 Ga0105242_10839615
641 Ga0105248_10000881
642 Ga0105248_10029328
643 Ga0105248_10106628
644 Ga0105248_10110253
645 Ga0105248_10141751
646 Ga0105248_10886231
647 Ga0105248_11515734
648 Ga0105237_10003203
649 Ga0105237_10293115
650 Ga0105237_10303280
651 Ga0105237_10426907
652 Ga0105238_10032611
653 Ga0105238_10717088
654 Ga0105238_10875232
655 Ga0105249_10000287
656 Ga0105249_10017938
657 Ga0105249_10067664
658 Ga0105249_10294372
659 Ga0105239_10018619
660 Ga0105239_10676873
661 Ga0105239_11390851
662 Ga0105246_10000310
663 Ga0157373_10142189
664 Ga0157371_10012033
665 Ga0157370_10859290
666 Ga0157374_10005705
667 Ga0157374_10144615
668 Ga0157374_10157161
669 Ga0157374_10906869
670 Ga0157378_10184154
671 Ga0157378_10291643
672 Ga0157378_10514823
673 Ga0163162_10054955
674 Ga0163162_10106157
675 Ga0163162_10590901
676 Ga0157372_10289940
677 Ga0157375_10017639
678 Ga0157375_10390075
679 Ga0157375_10422128
680 Ga0157375_10606869
681 Ga0163163_10089293
682 Ga0163163_10541144
683 Ga0163163_10823877
684 Ga0157380_10108381
685 Ga0157380_10130539
686 Ga0157380_10178114
687 Ga0157377_10411343
688 Ga0157379_10071962
689 Ga0157379_10117762
690 Ga0157379_10146199
691 Ga0157379_10240488
692 Ga0157376_10138761
693 Ga0157376_10182665
694 Ga0157376_10440606
695 Ga0157376_10544115
696 Ga0157376_10849379
697 Ga0163161_10005251
698 Ga0206355_1449314
699 Ga0206350_10607791
700 Ga0209672_101532
701 Ga0209759_1005650
702 Ga0209130_1002992
703 Ga0209675_1005888
704 Ga0209676_1000235
705 Ga0209676_1001312
706 Ga0209025_1079712
707 Ga0209564_1005554
708 Ga0209564_1008773
709 Ga0209758_1101181
710 Ga0209050_1001408
711 Ga0209257_1000331
712 Ga0209257_1001583
713 Ga0207697_10010428
714 Ga0207656_10001957
715 Ga0207682_10138045
716 Ga0207642_10393870
717 Ga0207710_10001902
718 Ga0207710_10028175
719 Ga0207680_10083074
720 Ga0207680_10165834
721 Ga0207680_10497633
722 Ga0207647_10001252
723 Ga0207685_10142434
724 Ga0207699_10094280
725 Ga0207699_10435152
726 Ga0207645_10000252
727 Ga0207645_10042308
728 Ga0207643_10000915
729 Ga0207705_10157691
730 Ga0207654_10170115
731 Ga0207707_10393337
732 Ga0207695_10003169
733 Ga0207695_10010837
734 Ga0207695_10473539
735 Ga0207671_10004128
736 Ga0207671_10218018
737 Ga0207671_10948192
738 Ga0207693_10037338
739 Ga0207663_10077906
740 Ga0207657_10002694
741 Ga0207649_10000855
742 Ga0207652_10844105
743 Ga0207646_10000736
744 Ga0207681_10399781
745 Ga0207694_10018136
746 Ga0207694_10355478
747 Ga0207694_10542155
748 Ga0207650_10000665
749 Ga0207650_10142095
750 Ga0207659_10066299
751 Ga0207659_10488348
752 Ga0207659_10533940
753 Ga0207687_10128807
754 Ga0207687_10506838
755 Ga0207700_10000341
756 Ga0207700_10000415
757 Ga0207700_11270518
758 Ga0207664_10257782
759 Ga0207644_10000989
760 Ga0207644_10001059
761 Ga0207644_10003609
762 Ga0207644_10148771
763 Ga0207690_10040843
764 Ga0207690_10184390
765 Ga0207706_10015243
766 Ga0207686_10046619
767 Ga0207686_10052630
768 Ga0207709_10184952
769 Ga0207669_10021387
770 Ga0207669_10084911
771 Ga0207669_10088512
772 Ga0207669_10186195
773 Ga0207704_10049991
774 Ga0207704_10320443
775 Ga0207704_10572646
776 Ga0207665_10114516
777 Ga0207691_10001266
778 Ga0207691_10309631
779 Ga0207711_10000233
780 Ga0207711_10043317
781 Ga0207711_10087309
782 Ga0207711_10095068
783 Ga0207711_10122070
784 Ga0207711_10125646
785 Ga0207711_10145612
786 Ga0207711_11485154
787 Ga0207689_10000615
788 Ga0207661_10039347
789 Ga0207661_10371766
790 Ga0207679_10000051
791 Ga0207679_10179919
792 Ga0207667_10567984
793 Ga0207651_10001714
794 Ga0207712_10000143
795 Ga0207712_10045574
796 Ga0207712_10412296
797 Ga0207668_10165796
798 Ga0207640_11291798
799 Ga0207640_11341301
800 Ga0207658_10000013
801 Ga0207658_10003842
802 Ga0207658_10113233
803 Ga0207658_10251349
804 Ga0207658_10321983
805 Ga0207658_10482534
806 Ga0207677_10347626
807 Ga0207677_10777215
808 Ga0207677_11011884
809 Ga0207677_11048776
810 Ga0207677_11139279
811 Ga0207703_10009880
812 Ga0207703_10276988
813 Ga0207639_10012494
814 Ga0207639_10743349
815 Ga0207678_10000178
816 Ga0207678_10000521
817 Ga0207678_10037987
818 Ga0207678_10098558
819 Ga0207641_10000020
820 Ga0207641_10005949
821 Ga0207641_10011673
822 Ga0207641_11370159
823 Ga0207648_10000698
824 Ga0207648_10042492
825 Ga0207676_10000081
826 Ga0207676_10035837
827 Ga0207676_10472907
828 Ga0207676_10485904
829 Ga0207674_10000163
830 Ga0207674_10013290
831 Ga0207675_100006376
832 Ga0207675_100066148
833 Ga0207675_100476034
834 Ga0207683_10004496
835 Ga0207683_10280032
836 Ga0207698_10053197
837 Ga0207428_10000081
838 Ga0265354_1000144
839 Ga0265355_1000051
840 Ga0268266_10000003
841 Ga0268266_10006369
842 Ga0268266_10070212
843 Ga0268266_10083112
844 Ga0268266_10250866
845 Ga0268266_10466121
846 Ga0268265_10018878
847 Ga0268265_10279803
848 Ga0268265_10467925
849 Ga0268265_11150395
850 Ga0268265_11429999
851 Ga0268264_10020885
852 Ga0268264_10064486
853 Ga0268264_10145420
854 Ga0268264_10499058
855 Ga0265318_10000614
856 Ga0307511_10025379
857 Ga0265770_1001679
858 Ga0265328_10214507
859 Ga0265320_10000189
860 Ga0265320_10166262
861 Ga0265325_10034789
862 Ga0265325_10043493
863 Ga0265325_10054326
864 Ga0265325_10066840
865 Ga0265329_10000655
866 Ga0265340_10050326
867 Ga0265339_10005239
868 Ga0265339_10214276
869 Ga0265331_10000021
870 Ga0265331_10066907
871 Ga0265316_10002339
872 Ga0307513_10023721
873 Ga0307513_10058003
874 Ga0307513_10078076
875 Ga0307513_10176715
876 Ga0265313_10005141
877 Ga0265313_10008542
878 Ga0265342_10000032
879 Ga0373943_0080570
880 Ga0373955_0071759
881 Ga0373933_0109615
882 Ga0373947_0504057
883 Ga0373937_0159985
884 Ga0373937_0191590
885 Ga0373937_0803826
886 Ga0436365_0619737
887 Ga0436363_0659851
888 Ga0436363_1322193
889 Ga0439436_0139674
890 Ga0439465_0070806
891 Ga0451793_1112945
892 Ga0451802_0216574
893 Ga0451853_3382773
894 Ga0466972_0145235
895 Ga0466970_0449474
896 Ga0451576_0080406
897 Ga0466967_0059051
898 Ga0495592_0569589
899 Ga0495629_0036502
900 Ga0495638_0000343
901 Ga0495638_0019931
902 Ga0495650_0003718
903 Ga0495580_0310981
904 Ga0495639_0184032
905 Ga0495585_0139986
906 Ga0495585_0336364
907 Ga0495606_0000242
908 Ga0495632_0192200
909 Ga0495642_0053105
910 Ga0495621_0108607
911 Ga0495668_0197585
912 Ga0495634_0225102
913 Ga0495625_0055247
914 Ga0495625_0066673
915 Ga0495625_0099782
916 Ga0495625_0250149
917 Ga0495658_0607482
918 Ga0495613_0779347
919 Ga0495649_0002991
920 Ga0495649_0288357
921 Ga0495674_0143474
922 Ga0495676_0781973
923 Ga0495684_0144625
924 Ga0495686_0001451
925 Ga0496102_0237535
926 Ga0496104_0089270
927 Ga0496104_0512599
928 Ga0496104_0529909
929 Ga0496104_1230833
930 Ga0496108_0001499
931 Ga0496108_0462234
932 Ga0496109_0000247
933 Ga0496109_0234410
934 Ga0496109_0280082
935 Ga0496110_0000506
936 Ga0496110_0375914
937 Ga0496111_0010383
938 Ga0496112_0000062
939 Ga0496113_0000663
940 Ga0496115_0000177
941 Ga0496115_0032053
942 Ga0496115_0103707
943 Ga0496115_0140780
944 Ga0496115_0704788
945 Ga0496121_0005151
946 Ga0496121_0080183
947 Ga0496122_0000062
948 Ga0496123_0000253
949 Ga0496124_0138612
950 Ga0496124_0448093
951 Ga0496126_0008515
952 Ga0496126_0025191
953 Ga0496126_0030874
954 Ga0496126_0136467
955 Ga0496126_0270493
956 Ga0495682_0039427
957 Ga0501043_0005167
958 Ga0501047_0022093
959 Ga0501044_0091072
960 nmdc:mga03683_511846_c1
961 nmdc:mga0k408_223732_c1
962 nmdc:mga07m45_31627_c1
963 nmdc:mga08y16_257473_c1
964 nmdc:mga08y16_31_c1
965 nmdc:mga0a205_727379_c1
966 Ga0495619_0228442
967 Ga0500643_000682
968 Ga0500595_055992
969 Ga0500597_001914
970 Ga0500658_0223818
971 Ga0500559_0000012
972 Ga0500622_0026033
973 Ga0587062_034735
974 2739730341

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF16694

Cytochrome_P460

Cytochrome P460

77

206

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
2je2-assembly1.cif.gz_A cytochrome p460 from nitrosomonas europaea - probable nonphysiological oxidized form 0.81 44 164
8gar-assembly1.cif.gz_A nitrosomonas europaea cytochrome p460 arg44ala 0.8066 44 164
6hiu-assembly1.cif.gz_A cytochrome p460 from methylococcus capsulatus (bath) 0.7737 33 178
6hiu-assembly1.cif.gz_A cytochrome p460 from methylococcus capsulatus (bath) 0.755 33 178
7zs4-assembly1.cif.gz_A f32v cytochrome c prime beta from methylococcus capsulatus (bath) 0.719 42 166
ID Description Score Start End Superfamily
2je3A00 Alpha Beta;3-Layer(bba) Sandwich;Chalcone isomerase;Cytochrome P460 0.8037 44 164 3.50.70.20
2r5vB01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.652 40 65 3.10.180.10
af_Q7Z9H9_1_84_3.30.310.10 Alpha Beta;2-Layer Sandwich;TATA-Binding Protein;TATA-Binding Protein 0.6369 115 155 3.30.310.10
af_P91634_344_513_2.60.40.150 Mainly Beta;Sandwich;Immunoglobulin-like;C2 domain 0.6246 85 126 2.60.40.150
af_A2CGB3_201_312_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.6041 50 97 2.30.29.30
ID Description Score Start End GO Terms
AF-A0A2V2R107-F1-model_v4 deleted 0.8785 26 178
AF-A0A2V7MFV7-F1-model_v4 Cytochrome P460 0.8776 28 178
AF-A0A1Q6X022-F1-model_v4 Cytochrome P460 0.8666 14 178
AF-A0A2N2GAF9-F1-model_v4 Cytochrome p460 0.8601 26 178
AF-A0A2V7MFV7-F1-model_v4 Cytochrome P460 0.8408 28 178

Map