F453448

General Info

Members Datasets Scaffolds Average Seq Length
487 264 974 320

Family's Representative Sequence

Representative Sequence 3300014745|Ga0157377_10013327|Ga0157377_100133274
Length 350
Sequence VRYTAPPCFAEIFEVRIDMISVPIFHTAKSAFKILAAAAVMAGWAADASAQPYPARPVTVVVPAPAGGPTDIVGRLVAQMLTETLGQVIVVDNRTGAGLTIGTTYAAKAKPDGYTLTIASPSSHSIAPGLYPNLGYDPIKDFEPITLLVTSPTVLVIHPSLPAKSLKEFIAFARARPGQLNYGSGGNGTTSHLTAELFKTMAKVNIQHIPYKGSAPASTDLLGGQLQKMFHGLHLTLPYITTNRLRALGVTSPQRSAMAPQLPTLDESGLPGFKVNAWYGVMAPAGTPKAIIEQVNAALLRNLNAPGMKQRLANQGMVAVGSTPDELAVVVREELQVWSRVIKESRAKID

Samples

Sample ID Description Type Environment
1 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
61 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
67 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
68 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
72 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
73 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
74 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
75 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
76 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
77 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
80 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
84 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
85 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
86 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
87 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
88 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
89 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
90 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
96 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
97 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
98 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
99 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
101 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
148 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
152 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
153 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
154 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
155 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
156 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
157 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
158 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
159 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
160 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
161 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
162 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
163 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
164 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
165 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
166 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
167 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
168 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
169 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
170 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
171 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
172 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
173 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
174 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
175 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
176 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
177 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
178 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
179 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
180 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
181 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
182 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
183 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
184 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
185 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
186 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
187 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
188 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
189 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
190 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
191 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
192 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
193 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
194 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
195 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
196 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
197 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
198 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
199 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
200 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
201 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
202 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
203 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
204 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
205 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
206 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
207 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
208 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
209 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
210 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
211 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
212 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
213 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
214 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
215 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
216 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
217 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
218 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
219 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
220 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
221 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
222 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
223 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
224 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
225 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
226 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
229 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
231 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
232 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
233 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
234 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
235 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
236 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
237 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
238 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
239 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
240 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
241 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
242 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
243 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
244 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
245 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
246 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
247 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
248 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
249 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
250 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
251 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
252 2855730933 Achromobacter sp. HZ28 Isolate Nodule
253 2855767633 Achromobacter sp. HZ34 Isolate Nodule
254 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
255 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
256 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
257 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
258 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
259 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
260 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
261 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
262 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
263 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
264 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.92
Metatranscriptomes 0
Isolates 3.08

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.85
Nodule 2.67
Rhizoplane 2.67
Rhizosphere 90.76
Stem 0
Stem Tuber 0
Unclassified 2.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157377_10013327 3300014745 Bacteria 4160
2 SwRhRL2b_contig_3674561 2162886007 Bacteria 2283
3 JGI25151J46595_10000131 3300003187 Bacteria 100435
4 Ga0065704_10071136 3300005289 Bacteria 12914
5 Ga0065712_10081871 3300005290 Bacteria 2968
6 Ga0065707_10012311 3300005295 Unclassified 2772
7 Ga0070658_10042530 3300005327 Bacteria 3670
8 Ga0070676_10018985 3300005328 Bacteria 3819
9 Ga0070676_10078517 3300005328 Bacteria 1997
10 Ga0070683_100001833 3300005329 Bacteria 16574
11 Ga0070683_100007690 3300005329 Bacteria 9120
12 Ga0070690_100002169 3300005330 Bacteria 10489
13 Ga0070670_100001901 3300005331 Bacteria 17076
14 Ga0070670_100031787 3300005331 Bacteria 4546
15 Ga0070670_100042773 3300005331 Bacteria 3895
16 Ga0070670_100082581 3300005331 Bacteria 2761
17 Ga0070670_100179796 3300005331 Bacteria 1836
18 Ga0070677_10007204 3300005333 Bacteria 3707
19 Ga0070677_10030796 3300005333 Bacteria 2045
20 Ga0070677_10050593 3300005333 Bacteria 1678
21 Ga0068869_100138904 3300005334 Bacteria 1874
22 Ga0068869_100319676 3300005334 Bacteria 1258
23 Ga0070666_10119675 3300005335 Bacteria 1825
24 Ga0070666_10263540 3300005335 Bacteria 1222
25 Ga0070680_100002670 3300005336 Bacteria 13214
26 Ga0070682_100004844 3300005337 Bacteria 7476
27 Ga0068868_100001179 3300005338 Bacteria 17900
28 Ga0068868_100003144 3300005338 Bacteria 11490
29 Ga0068868_100010045 3300005338 Bacteria 6838
30 Ga0068868_100152880 3300005338 Bacteria 1901
31 Ga0068868_100428297 3300005338 Bacteria 1147
32 Ga0070660_100038055 3300005339 Bacteria 3650
33 Ga0070689_100000619 3300005340 Bacteria 21562
34 Ga0070689_100050572 3300005340 Bacteria 3211
35 Ga0070691_10000287 3300005341 Bacteria 17611
36 Ga0070687_100000135 3300005343 Bacteria 25620
37 Ga0070687_100127338 3300005343 Bacteria 1465
38 Ga0070661_100001142 3300005344 Bacteria 18699
39 Ga0070661_100001344 3300005344 Bacteria 17202
40 Ga0070661_100268942 3300005344 Bacteria 1319
41 Ga0070692_10000037 3300005345 Bacteria 25605
42 Ga0070668_100252911 3300005347 Bacteria 1463
43 Ga0070669_100112986 3300005353 Bacteria 2063
44 Ga0070669_100212001 3300005353 Bacteria 1528
45 Ga0070669_100309208 3300005353 Bacteria 1273
46 Ga0070669_100332902 3300005353 Bacteria 1228
47 Ga0070675_100008536 3300005354 Bacteria 7951
48 Ga0070675_100141136 3300005354 Bacteria 2059
49 Ga0070671_100002371 3300005355 Bacteria 14545
50 Ga0070671_100018386 3300005355 Bacteria 5677
51 Ga0070671_100133019 3300005355 Bacteria 2095
52 Ga0070674_100044657 3300005356 Bacteria 3023
53 Ga0070674_100118654 3300005356 Bacteria 1955
54 Ga0070673_100004880 3300005364 Bacteria 8539
55 Ga0070673_100030333 3300005364 Bacteria 4044
56 Ga0070673_100045503 3300005364 Bacteria 3404
57 Ga0070667_100024257 3300005367 Bacteria 5037
58 Ga0070667_100038460 3300005367 Bacteria 4011
59 Ga0070667_100071381 3300005367 Bacteria 2957
60 Ga0070667_100102511 3300005367 Bacteria 2473
61 Ga0070701_10078415 3300005438 Bacteria 1782
62 Ga0070705_100000022 3300005440 Bacteria 83218
63 Ga0070700_100001465 3300005441 Bacteria 11740
64 Ga0070700_100065415 3300005441 Bacteria 2305
65 Ga0070694_100003705 3300005444 Bacteria 9117
66 Ga0070663_100028135 3300005455 Bacteria 3823
67 Ga0070678_100002707 3300005456 Bacteria 9778
68 Ga0070678_100011282 3300005456 Bacteria 5505
69 Ga0070678_100070233 3300005456 Bacteria 2617
70 Ga0070678_100446177 3300005456 Bacteria 1132
71 Ga0070662_100018005 3300005457 Bacteria 4772
72 Ga0070662_100048841 3300005457 Bacteria 3050
73 Ga0070662_100131164 3300005457 Bacteria 1932
74 Ga0070662_100257598 3300005457 Bacteria 1405
75 Ga0070681_10034551 3300005458 Bacteria 5076
76 Ga0070681_10253064 3300005458 Bacteria 1674
77 Ga0068867_100000740 3300005459 Bacteria 21911
78 Ga0068867_100006691 3300005459 Bacteria 8149
79 Ga0068867_100012415 3300005459 Bacteria 6026
80 Ga0068867_100208451 3300005459 Bacteria 1568
81 Ga0070685_10022567 3300005466 Bacteria 3432
82 Ga0070685_10082847 3300005466 Bacteria 1926
83 Ga0070685_10133992 3300005466 Bacteria 1552
84 Ga0070699_100014816 3300005518 Bacteria 6704
85 Ga0070679_100033757 3300005530 Bacteria 5067
86 Ga0070684_100023500 3300005535 Bacteria 5158
87 Ga0070672_100003898 3300005543 Bacteria 9720
88 Ga0070672_100030852 3300005543 Bacteria 4031
89 Ga0070672_100393112 3300005543 Bacteria 1187
90 Ga0070686_100128947 3300005544 Bacteria 1746
91 Ga0070696_100135616 3300005546 Bacteria 1794
92 Ga0070693_100006118 3300005547 Bacteria 5831
93 Ga0070693_100042011 3300005547 Bacteria 2575
94 Ga0070665_100230112 3300005548 Bacteria 1854
95 Ga0070665_100371481 3300005548 Bacteria 1437
96 Ga0070704_100000009 3300005549 Bacteria 67191
97 Ga0068855_100015108 3300005563 Bacteria 9296
98 Ga0070664_100002397 3300005564 Bacteria 15053
99 Ga0070664_100035181 3300005564 Bacteria 4204
100 Ga0068854_100000468 3300005578 Bacteria 24905
101 Ga0068854_100012858 3300005578 Bacteria 5482
102 Ga0068854_100047685 3300005578 Bacteria 3054
103 Ga0068856_100014811 3300005614 Bacteria 7529
104 Ga0070702_100041538 3300005615 Bacteria 2580
105 Ga0068852_100000221 3300005616 Bacteria 38665
106 Ga0068852_100003572 3300005616 Bacteria 10886
107 Ga0068852_100271349 3300005616 Bacteria 1632
108 Ga0068859_100234700 3300005617 Bacteria 1923
109 Ga0068859_100278821 3300005617 Bacteria 1764
110 Ga0068864_100003124 3300005618 Bacteria 13682
111 Ga0068864_100018958 3300005618 Bacteria 5752
112 Ga0068864_100083186 3300005618 Bacteria 2810
113 Ga0068866_10000096 3300005718 Bacteria 36786
114 Ga0068866_10019551 3300005718 Bacteria 3086
115 Ga0068866_10185836 3300005718 Bacteria 1231
116 Ga0068861_100005253 3300005719 Bacteria 8729
117 Ga0068861_100153034 3300005719 Bacteria 1894
118 Ga0068851_10004198 3300005834 Bacteria 6491
119 Ga0068870_10132750 3300005840 Bacteria 1448
120 Ga0068870_10152421 3300005840 Bacteria 1363
121 Ga0068863_100012827 3300005841 Bacteria 8083
122 Ga0068863_100019807 3300005841 Bacteria 6435
123 Ga0068863_100144788 3300005841 Bacteria 2272
124 Ga0068863_100204812 3300005841 Bacteria 1899
125 Ga0068858_100006948 3300005842 Bacteria 11000
126 Ga0068858_100552905 3300005842 Bacteria 1114
127 Ga0068860_100000285 3300005843 Bacteria 72246
128 Ga0068860_100096985 3300005843 Bacteria 2810
129 Ga0068860_100229700 3300005843 Bacteria 1803
130 Ga0068860_100325651 3300005843 Bacteria 1508
131 Ga0068862_100323832 3300005844 Bacteria 1423
132 Ga0068862_100420115 3300005844 Bacteria 1255
133 Ga0068862_100505769 3300005844 Bacteria 1147
134 Ga0081455_10002509 3300005937 Bacteria 21784
135 Ga0081455_10128424 3300005937 Bacteria 1986
136 Ga0081538_10031087 3300005981 Bacteria 3609
137 Ga0081538_10050768 3300005981 Bacteria 2499
138 Ga0075364_10049824 3300006051 Bacteria 2732
139 Ga0097621_100001017 3300006237 Bacteria 19735
140 Ga0097621_100009118 3300006237 Bacteria 7190
141 Ga0097621_100025869 3300006237 Bacteria 4597
142 Ga0097621_100075359 3300006237 Bacteria 2796
143 Ga0097621_100129793 3300006237 Bacteria 2144
144 Ga0097621_100391757 3300006237 Bacteria 1242
145 Ga0068871_100001130 3300006358 Bacteria 17912
146 Ga0068871_100001363 3300006358 Bacteria 16373
147 Ga0068871_100001889 3300006358 Bacteria 14172
148 Ga0068871_100013831 3300006358 Bacteria 5999
149 Ga0075428_100037742 3300006844 Bacteria 5316
150 Ga0075428_100196797 3300006844 Bacteria 2180
151 Ga0075430_100130267 3300006846 Bacteria 2096
152 Ga0075431_100032928 3300006847 Bacteria 5342
153 Ga0075434_100184124 3300006871 Bacteria 2109
154 Ga0075429_100008362 3300006880 Bacteria 9006
155 Ga0075429_100027743 3300006880 Bacteria 4914
156 Ga0068865_100038245 3300006881 Bacteria 3246
157 Ga0075436_100054455 3300006914 Bacteria 2761
158 Ga0097620_100234707 3300006931 Bacteria 1923
159 Ga0097620_100278830 3300006931 Bacteria 1764
160 Ga0075435_100006817 3300007076 Bacteria 8105
161 Ga0075435_100111272 3300007076 Bacteria 2278
162 Ga0111539_10049365 3300009094 Bacteria 5019
163 Ga0111539_10054034 3300009094 Bacteria 4780
164 Ga0111539_10319506 3300009094 Bacteria 1807
165 Ga0111539_10395340 3300009094 Bacteria 1610
166 Ga0105245_10000086 3300009098 Bacteria 93019
167 Ga0105245_10175531 3300009098 Bacteria 2043
168 Ga0114129_10070003 3300009147 Unclassified 4891
169 Ga0114129_10084534 3300009147 Bacteria 4405
170 Ga0114129_10121335 3300009147 Bacteria 3597
171 Ga0105243_10000900 3300009148 Bacteria 27936
172 Ga0105241_10012582 3300009174 Bacteria 6208
173 Ga0105242_10001502 3300009176 Bacteria 18346
174 Ga0105242_10169475 3300009176 Bacteria 1918
175 Ga0105248_10086985 3300009177 Bacteria 3517
176 Ga0105248_10129352 3300009177 Unclassified 2848
177 Ga0105248_10148371 3300009177 Bacteria 2646
178 Ga0105248_10602124 3300009177 Bacteria 1240
179 Ga0105249_10085091 3300009553 Bacteria 2946
180 Ga0105249_10375427 3300009553 Bacteria 1446
181 Ga0105239_10034543 3300010375 Bacteria 5553
182 Ga0157371_10085522 3300013102 Bacteria 2234
183 Ga0157374_10003525 3300013296 Bacteria 13162
184 Ga0157374_10012957 3300013296 Bacteria 7269
185 Ga0157378_10001516 3300013297 Bacteria 21037
186 Ga0157378_10034102 3300013297 Bacteria 4502
187 Ga0157378_10150049 3300013297 Bacteria 2171
188 Ga0157378_10182606 3300013297 Bacteria 1974
189 Ga0163162_10012041 3300013306 Bacteria 8436
190 Ga0163162_10096248 3300013306 Bacteria 3048
191 Ga0163162_10195135 3300013306 Bacteria 2153
192 Ga0163162_10477818 3300013306 Bacteria 1378
193 Ga0157375_10004665 3300013308 Bacteria 11918
194 Ga0157375_10017440 3300013308 Bacteria 6480
195 Ga0157375_10056516 3300013308 Bacteria 3875
196 Ga0157375_10168428 3300013308 Bacteria 2337
197 Ga0163163_10069027 3300014325 Bacteria 3518
198 Ga0163163_10202863 3300014325 Unclassified 2031
199 Ga0157380_10015263 3300014326 Bacteria 5642
200 Ga0157380_10168090 3300014326 Bacteria 1913
201 Ga0157377_10054733 3300014745 Bacteria 2260
202 Ga0157379_10086917 3300014968 Bacteria 2803
203 Ga0157376_10014092 3300014969 Bacteria 5988
204 Ga0157376_10017583 3300014969 Bacteria 5460
205 Ga0157376_10108602 3300014969 Bacteria 2438
206 Ga0163161_10086176 3300017792 Bacteria 2318
207 Ga0163161_10244079 3300017792 Bacteria 1398
208 Ga0209455_1000532 3300025272 Bacteria 26493
209 Ga0209025_1000028 3300025294 Bacteria 490678
210 Ga0207697_10007537 3300025315 Bacteria 4845
211 Ga0207656_10004026 3300025321 Bacteria 5098
212 Ga0207653_10024006 3300025885 Bacteria 1945
213 Ga0207682_10002790 3300025893 Bacteria 7724
214 Ga0207682_10003695 3300025893 Bacteria 6593
215 Ga0207682_10039301 3300025893 Bacteria 1923
216 Ga0207682_10052428 3300025893 Bacteria 1691
217 Ga0207642_10106722 3300025899 Bacteria 1418
218 Ga0207688_10006774 3300025901 Bacteria 6237
219 Ga0207688_10040287 3300025901 Bacteria 2596
220 Ga0207688_10167861 3300025901 Bacteria 1304
221 Ga0207680_10012453 3300025903 Bacteria 4331
222 Ga0207680_10086725 3300025903 Bacteria 1980
223 Ga0207680_10090525 3300025903 Bacteria 1945
224 Ga0207645_10009136 3300025907 Bacteria 6874
225 Ga0207645_10023149 3300025907 Bacteria 4038
226 Ga0207645_10023207 3300025907 Bacteria 4032
227 Ga0207645_10069038 3300025907 Bacteria 2260
228 Ga0207643_10016102 3300025908 Bacteria 4075
229 Ga0207643_10030227 3300025908 Bacteria 3013
230 Ga0207643_10182024 3300025908 Bacteria 1272
231 Ga0207707_10193836 3300025912 Bacteria 1772
232 Ga0207660_10002252 3300025917 Bacteria 12748
233 Ga0207662_10000288 3300025918 Bacteria 23284
234 Ga0207649_10015354 3300025920 Bacteria 4303
235 Ga0207652_10135518 3300025921 Bacteria 2199
236 Ga0207681_10061588 3300025923 Bacteria 2580
237 Ga0207681_10182880 3300025923 Bacteria 1598
238 Ga0207650_10000547 3300025925 Bacteria 30646
239 Ga0207650_10001311 3300025925 Bacteria 18007
240 Ga0207650_10004236 3300025925 Bacteria 9793
241 Ga0207650_10067661 3300025925 Bacteria 2680
242 Ga0207650_10109300 3300025925 Bacteria 2138
243 Ga0207650_10148635 3300025925 Bacteria 1847
244 Ga0207659_10000792 3300025926 Bacteria 18688
245 Ga0207659_10008965 3300025926 Bacteria 6236
246 Ga0207687_10305685 3300025927 Bacteria 1282
247 Ga0207644_10001469 3300025931 Bacteria 15200
248 Ga0207644_10004546 3300025931 Bacteria 9016
249 Ga0207644_10106963 3300025931 Bacteria 2109
250 Ga0207706_10017636 3300025933 Bacteria 6433
251 Ga0207706_10036835 3300025933 Bacteria 4345
252 Ga0207706_10194560 3300025933 Bacteria 1779
253 Ga0207706_10288854 3300025933 Bacteria 1430
254 Ga0207686_10000595 3300025934 Bacteria 22559
255 Ga0207686_10243264 3300025934 Bacteria 1310
256 Ga0207709_10001099 3300025935 Bacteria 19845
257 Ga0207670_10001960 3300025936 Bacteria 10797
258 Ga0207670_10116825 3300025936 Bacteria 1932
259 Ga0207670_10235805 3300025936 Bacteria 1407
260 Ga0207669_10147331 3300025937 Bacteria 1643
261 Ga0207704_10000193 3300025938 Bacteria 31520
262 Ga0207691_10000276 3300025940 Bacteria 50778
263 Ga0207691_10001030 3300025940 Bacteria 27614
264 Ga0207691_10057789 3300025940 Bacteria 3529
265 Ga0207691_10167919 3300025940 Bacteria 1922
266 Ga0207711_10130619 3300025941 Bacteria 2252
267 Ga0207711_10145629 3300025941 Bacteria 2134
268 Ga0207689_10000246 3300025942 Bacteria 48497
269 Ga0207689_10115512 3300025942 Bacteria 2206
270 Ga0207689_10129045 3300025942 Bacteria 2080
271 Ga0207661_10001694 3300025944 Bacteria 15026
272 Ga0207661_10096841 3300025944 Bacteria 2469
273 Ga0207679_10001570 3300025945 Bacteria 14281
274 Ga0207679_10002649 3300025945 Bacteria 11049
275 Ga0207679_10099899 3300025945 Bacteria 2267
276 Ga0207667_10008141 3300025949 Bacteria 12483
277 Ga0207651_10003905 3300025960 Bacteria 7401
278 Ga0207651_10057336 3300025960 Bacteria 2686
279 Ga0207651_10129769 3300025960 Bacteria 1927
280 Ga0207651_10206960 3300025960 Bacteria 1576
281 Ga0207712_10159842 3300025961 Bacteria 1750
282 Ga0207640_10000657 3300025981 Bacteria 20214
283 Ga0207640_10004162 3300025981 Bacteria 7825
284 Ga0207658_10055814 3300025986 Bacteria 2929
285 Ga0207658_10080732 3300025986 Bacteria 2492
286 Ga0207658_10092468 3300025986 Bacteria 2350
287 Ga0207658_10109025 3300025986 Bacteria 2185
288 Ga0207658_10160792 3300025986 Bacteria 1840
289 Ga0207677_10000888 3300026023 Bacteria 16831
290 Ga0207677_10001059 3300026023 Bacteria 15082
291 Ga0207677_10003535 3300026023 Bacteria 8282
292 Ga0207677_10083865 3300026023 Bacteria 2295
293 Ga0207703_10165117 3300026035 Bacteria 1942
294 Ga0207703_10257665 3300026035 Bacteria 1575
295 Ga0207678_10368247 3300026067 Bacteria 1241
296 Ga0207708_10000346 3300026075 Bacteria 36321
297 Ga0207708_10015904 3300026075 Bacteria 5649
298 Ga0207708_10051638 3300026075 Bacteria 3131
299 Ga0207702_10099001 3300026078 Bacteria 2570
300 Ga0207641_10009543 3300026088 Bacteria 7995
301 Ga0207641_10037686 3300026088 Bacteria 4039
302 Ga0207641_10049563 3300026088 Bacteria 3549
303 Ga0207641_10100076 3300026088 Bacteria 2552
304 Ga0207648_10000145 3300026089 Bacteria 70734
305 Ga0207648_10011175 3300026089 Bacteria 8469
306 Ga0207648_10018599 3300026089 Bacteria 6288
307 Ga0207648_10054903 3300026089 Bacteria 3478
308 Ga0207648_10108425 3300026089 Bacteria 2438
309 Ga0207676_10000711 3300026095 Bacteria 26137
310 Ga0207676_10016549 3300026095 Bacteria 5340
311 Ga0207676_10189805 3300026095 Bacteria 1807
312 Ga0207675_100001564 3300026118 Bacteria 22950
313 Ga0207675_100046179 3300026118 Bacteria 4068
314 Ga0207675_100406497 3300026118 Bacteria 1342
315 Ga0207683_10000759 3300026121 Bacteria 29341
316 Ga0207683_10015948 3300026121 Bacteria 6396
317 Ga0207683_10017802 3300026121 Bacteria 6060
318 Ga0207683_10065370 3300026121 Bacteria 3207
319 Ga0207698_10000566 3300026142 Bacteria 21574
320 Ga0207698_10013639 3300026142 Bacteria 5371
321 Ga0207698_10320530 3300026142 Bacteria 1451
322 Ga0207428_10016172 3300027907 Bacteria 6425
323 Ga0207428_10227973 3300027907 Bacteria 1395
324 Ga0268266_10047069 3300028379 Bacteria 3693
325 Ga0268266_10163878 3300028379 Bacteria 2013
326 Ga0268266_10280094 3300028379 Bacteria 1550
327 Ga0268265_10001212 3300028380 Bacteria 22414
328 Ga0268265_10351896 3300028380 Bacteria 1345
329 Ga0268264_10051975 3300028381 Bacteria 3416
330 Ga0268264_10166525 3300028381 Bacteria 1990
331 Ga0265318_10006553 3300028577 Bacteria 5346
332 Ga0265318_10024480 3300028577 Bacteria 2393
333 Ga0265338_10139773 3300028800 Bacteria 1899
334 Ga0265330_10007204 3300031235 Bacteria 5444
335 Ga0265332_10000735 3300031238 Bacteria 20401
336 Ga0265332_10003598 3300031238 Bacteria 7433
337 Ga0265332_10092510 3300031238 Bacteria 1278
338 Ga0265328_10005143 3300031239 Bacteria 5625
339 Ga0265328_10025493 3300031239 Bacteria 2227
340 Ga0265320_10021392 3300031240 Bacteria 3480
341 Ga0265320_10072348 3300031240 Bacteria 1622
342 Ga0265329_10002359 3300031242 Bacteria 8624
343 Ga0265340_10003954 3300031247 Bacteria 8335
344 Ga0265339_10002711 3300031249 Bacteria 12591
345 Ga0265331_10000832 3300031250 Bacteria 25166
346 Ga0265331_10012568 3300031250 Bacteria 4578
347 Ga0265331_10023080 3300031250 Bacteria 3166
348 Ga0265316_10023082 3300031344 Bacteria 5231
349 Ga0307408_100040828 3300031548 Bacteria 3287
350 Ga0265314_10002632 3300031711 Bacteria 18095
351 Ga0265314_10009702 3300031711 Bacteria 8097
352 Ga0265314_10039770 3300031711 Bacteria 3383
353 Ga0265314_10086938 3300031711 Bacteria 2045
354 Ga0265342_10000092 3300031712 Bacteria 99040
355 Ga0265342_10003929 3300031712 Bacteria 11935
356 Ga0307405_10013809 3300031731 Bacteria 4319
357 Ga0307413_10007421 3300031824 Bacteria 5093
358 Ga0307413_10038147 3300031824 Bacteria 2782
359 Ga0307413_10039136 3300031824 Bacteria 2755
360 Ga0307410_10004671 3300031852 Bacteria 7118
361 Ga0307407_10046002 3300031903 Bacteria 2469
362 Ga0307407_10143515 3300031903 Bacteria 1543
363 Ga0307412_10045725 3300031911 Bacteria 2864
364 Ga0307412_10156162 3300031911 Bacteria 1689
365 Ga0307409_100039707 3300031995 Bacteria 3495
366 Ga0307409_100050551 3300031995 Bacteria 3175
367 Ga0307409_100408656 3300031995 Bacteria 1299
368 Ga0307416_100192487 3300032002 Bacteria 1925
369 Ga0307414_10006140 3300032004 Bacteria 6674
370 Ga0307414_10201230 3300032004 Bacteria 1620
371 Ga0307414_10242962 3300032004 Bacteria 1491
372 Ga0307411_10026326 3300032005 Bacteria 3501
373 Ga0307411_10155383 3300032005 Bacteria 1706
374 Ga0307411_10306530 3300032005 Bacteria 1276
375 Ga0373950_0016982 3300034818 Bacteria 1250
376 Ga0373926_0004813 3300035083 Bacteria 4439
377 Ga0373940_0005327 3300035088 Unclassified 2778
378 Ga0373944_0001696 3300035089 Bacteria 5573
379 Ga0373949_0004742 3300035090 Unclassified 3085
380 Ga0373951_0017082 3300035091 Unclassified 1640
381 Ga0373952_0009972 3300035092 Unclassified 1829
382 Ga0373932_0004303 3300035112 Bacteria 3377
383 Ga0373936_0004368 3300035113 Bacteria 5345
384 Ga0373936_0048540 3300035113 Bacteria 1713
385 Ga0373939_0025008 3300035114 Unclassified 1669
386 Ga0373945_0014482 3300035116 Bacteria 2643
387 Ga0373943_0005171 3300035170 Bacteria 5872
388 Ga0373943_0011481 3300035170 Bacteria 3985
389 Ga0373946_0000679 3300035171 Bacteria 11419
390 Ga0373946_0057643 3300035171 Bacteria 1643
391 Ga0373942_0005658 3300035207 Unclassified 2896
392 Ga0373931_0121141 3300035691 Bacteria 1495
393 Ga0373935_0005822 3300035692 Bacteria 7299
394 Ga0373935_0021034 3300035692 Bacteria 3992
395 Ga0373927_0006898 3300035695 Bacteria 7718
396 Ga0373927_0029328 3300035695 Bacteria 3585
397 Ga0373947_0006482 3300035725 Bacteria 6797
398 Ga0373947_0020088 3300035725 Bacteria 3855
399 Ga0373925_0011389 3300037068 Bacteria 6446
400 Ga0373925_0027144 3300037068 Bacteria 4193
401 Ga0395900_0027735 3300037418 Bacteria 5802
402 Ga0395898_0043684 3300037466 Bacteria 4415
403 Ga0395905_0036366 3300037471 Bacteria 4624
404 Ga0451853_4038841 3300041512 Bacteria 1555
405 Ga0451577_0265590 3300042876 Bacteria 1554
406 Ga0451577_0732474 3300042876 Bacteria 895
407 Ga0466961_0067392 3300044693 Bacteria 2274
408 Ga0453684_0558773 3300044712 Bacteria 1260
409 Ga0451576_0031504 3300045051 Bacteria 5651
410 Ga0495603_0013602 3300046455 Bacteria 4924
411 Ga0495580_0002245 3300046472 Bacteria 16878
412 Ga0495582_0037819 3300046473 Bacteria 2655
413 Ga0495605_0074406 3300046474 Bacteria 1599
414 Ga0495665_0032852 3300046531 Bacteria 2776
415 Ga0495586_0003755 3300046535 Bacteria 8138
416 Ga0495633_0000926 3300046558 Bacteria 24805
417 Ga0495656_0012687 3300046615 Bacteria 3116
418 Ga0495656_0071982 3300046615 Bacteria 1538
419 Ga0495658_0001257 3300046683 Bacteria 13318
420 Ga0495658_0023385 3300046683 Bacteria 3280
421 Ga0495676_0030171 3300047321 Bacteria 4608
422 Ga0496102_0085148 3300048905 Bacteria 2918
423 Ga0496106_0040101 3300048909 Bacteria 3506
424 Ga0496106_0415453 3300048909 Bacteria 1081
425 Ga0496108_0008167 3300048911 Bacteria 8490
426 Ga0496108_0132458 3300048911 Bacteria 2142
427 Ga0496109_0024935 3300048912 Bacteria 5324
428 Ga0496109_0131358 3300048912 Bacteria 2337
429 Ga0496109_0364043 3300048912 Bacteria 1366
430 Ga0496110_0014434 3300048913 Bacteria 6560
431 Ga0496110_0054872 3300048913 Bacteria 3505
432 Ga0496111_0272659 3300048914 Bacteria 1255
433 Ga0496112_0573674 3300048915 Bacteria 1061
434 Ga0496114_0159296 3300048917 Bacteria 1961
435 Ga0496116_0010833 3300048919 Bacteria 7605
436 Ga0496118_0019291 3300048921 Bacteria 6100
437 Ga0496119_0095601 3300048922 Bacteria 1678
438 Ga0496121_0005309 3300048924 Bacteria 16570
439 Ga0496122_0004199 3300048925 Bacteria 18120
440 Ga0496122_0023593 3300048925 Bacteria 5414
441 Ga0496123_0098199 3300048926 Bacteria 1713
442 Ga0496126_0116879 3300048929 Bacteria 2318
443 Ga0501039_0051989 3300049575 Bacteria 3170
444 Ga0501040_0100588 3300049576 Bacteria 2016
445 Ga0501042_0197091 3300049578 Bacteria 1452
446 Ga0501048_0170695 3300049582 Bacteria 1541
447 Ga0501072_0000464 3300049588 Bacteria 29314
448 Ga0501075_0028335 3300049591 Bacteria 4134
449 Ga0501076_0097103 3300049592 Bacteria 2373
450 Ga0501079_0254963 3300049741 Bacteria 1371
451 Ga0501081_0062527 3300049743 Bacteria 2582
452 Ga0501081_0237567 3300049743 Bacteria 1328
453 nmdc:mga00v17_161465_c1 3300050491 Unclassified 1443
454 nmdc:mga05p37_185_c1 3300050507 Bacteria 61269
455 nmdc:mga09592_6056_c1 3300050508 Bacteria 9862
456 nmdc:mga0qj67_65216_c1 3300050509 Bacteria 2899
457 nmdc:mga06r32_237410_c1 3300050510 Bacteria 1811
458 nmdc:mga08y16_192897_c1 3300050511 Bacteria 2113
459 nmdc:mga08y16_27924_c1 3300050511 Bacteria 5950
460 nmdc:mga08y16_369507_c1 3300050511 Unclassified 1471
461 nmdc:mga08y16_515986_c1 3300050511 Bacteria 1213
462 nmdc:mga0n895_194730_c1 3300050512 Bacteria 2058
463 nmdc:mga0rr50_215890_c1 3300050513 Bacteria 1582
464 nmdc:mga0rr50_42668_c1 3300050513 Bacteria 3314
465 Ga0500644_0001546 3300053088 Bacteria 6047
466 Ga0500583_0130424 3300053092 Bacteria 1247
467 Ga0500593_000654 3300053117 Bacteria 13223
468 Ga0500590_025986 3300053148 Bacteria 3039
469 Ga0501084_0219748 3300054114 Bacteria 1603
470 Ga0501082_0258304 3300060353 Bacteria 1515
471 Ga0530510_0030871 3300061734 Bacteria 3851
472 Ga0530510_0046651 3300061734 Bacteria 3130
473 2508693028 2508501042 Bacteria 8719808
474 2515630093 2515154112 Bacteria 8294334
475 2855731768 2855730933 Bacteria 7047938
476 2855768474 2855767633 Bacteria 7049357
477 2881414918 2881412998 Bacteria 6492157
478 2935700832 2935694250 Bacteria 9291695
479 2935981858 2935975950 Bacteria 8347125
480 2939633961 2939631187 Bacteria 6118131
481 8016584535 8016583857 Bacteria 10421953
482 8019620947 8019619141 Bacteria 9218857
483 8019629604 8019629233 Bacteria 8687553
484 8019648294 8019638758 Bacteria 9062356
485 8019659746 8019659431 Bacteria 8577854
486 8019669205 8019668869 Bacteria 8791617
487 8019678275 8019678201 Bacteria 8863603
488 Ga0157377_10013327
489 SwRhRL2b_contig_3674561
490 JGI25151J46595_10000131
491 Ga0065704_10071136
492 Ga0065712_10081871
493 Ga0065707_10012311
494 Ga0070658_10042530
495 Ga0070676_10018985
496 Ga0070676_10078517
497 Ga0070683_100001833
498 Ga0070683_100007690
499 Ga0070690_100002169
500 Ga0070670_100001901
501 Ga0070670_100031787
502 Ga0070670_100042773
503 Ga0070670_100082581
504 Ga0070670_100179796
505 Ga0070677_10007204
506 Ga0070677_10030796
507 Ga0070677_10050593
508 Ga0068869_100138904
509 Ga0068869_100319676
510 Ga0070666_10119675
511 Ga0070666_10263540
512 Ga0070680_100002670
513 Ga0070682_100004844
514 Ga0068868_100001179
515 Ga0068868_100003144
516 Ga0068868_100010045
517 Ga0068868_100152880
518 Ga0068868_100428297
519 Ga0070660_100038055
520 Ga0070689_100000619
521 Ga0070689_100050572
522 Ga0070691_10000287
523 Ga0070687_100000135
524 Ga0070687_100127338
525 Ga0070661_100001142
526 Ga0070661_100001344
527 Ga0070661_100268942
528 Ga0070692_10000037
529 Ga0070668_100252911
530 Ga0070669_100112986
531 Ga0070669_100212001
532 Ga0070669_100309208
533 Ga0070669_100332902
534 Ga0070675_100008536
535 Ga0070675_100141136
536 Ga0070671_100002371
537 Ga0070671_100018386
538 Ga0070671_100133019
539 Ga0070674_100044657
540 Ga0070674_100118654
541 Ga0070673_100004880
542 Ga0070673_100030333
543 Ga0070673_100045503
544 Ga0070667_100024257
545 Ga0070667_100038460
546 Ga0070667_100071381
547 Ga0070667_100102511
548 Ga0070701_10078415
549 Ga0070705_100000022
550 Ga0070700_100001465
551 Ga0070700_100065415
552 Ga0070694_100003705
553 Ga0070663_100028135
554 Ga0070678_100002707
555 Ga0070678_100011282
556 Ga0070678_100070233
557 Ga0070678_100446177
558 Ga0070662_100018005
559 Ga0070662_100048841
560 Ga0070662_100131164
561 Ga0070662_100257598
562 Ga0070681_10034551
563 Ga0070681_10253064
564 Ga0068867_100000740
565 Ga0068867_100006691
566 Ga0068867_100012415
567 Ga0068867_100208451
568 Ga0070685_10022567
569 Ga0070685_10082847
570 Ga0070685_10133992
571 Ga0070699_100014816
572 Ga0070679_100033757
573 Ga0070684_100023500
574 Ga0070672_100003898
575 Ga0070672_100030852
576 Ga0070672_100393112
577 Ga0070686_100128947
578 Ga0070696_100135616
579 Ga0070693_100006118
580 Ga0070693_100042011
581 Ga0070665_100230112
582 Ga0070665_100371481
583 Ga0070704_100000009
584 Ga0068855_100015108
585 Ga0070664_100002397
586 Ga0070664_100035181
587 Ga0068854_100000468
588 Ga0068854_100012858
589 Ga0068854_100047685
590 Ga0068856_100014811
591 Ga0070702_100041538
592 Ga0068852_100000221
593 Ga0068852_100003572
594 Ga0068852_100271349
595 Ga0068859_100234700
596 Ga0068859_100278821
597 Ga0068864_100003124
598 Ga0068864_100018958
599 Ga0068864_100083186
600 Ga0068866_10000096
601 Ga0068866_10019551
602 Ga0068866_10185836
603 Ga0068861_100005253
604 Ga0068861_100153034
605 Ga0068851_10004198
606 Ga0068870_10132750
607 Ga0068870_10152421
608 Ga0068863_100012827
609 Ga0068863_100019807
610 Ga0068863_100144788
611 Ga0068863_100204812
612 Ga0068858_100006948
613 Ga0068858_100552905
614 Ga0068860_100000285
615 Ga0068860_100096985
616 Ga0068860_100229700
617 Ga0068860_100325651
618 Ga0068862_100323832
619 Ga0068862_100420115
620 Ga0068862_100505769
621 Ga0081455_10002509
622 Ga0081455_10128424
623 Ga0081538_10031087
624 Ga0081538_10050768
625 Ga0075364_10049824
626 Ga0097621_100001017
627 Ga0097621_100009118
628 Ga0097621_100025869
629 Ga0097621_100075359
630 Ga0097621_100129793
631 Ga0097621_100391757
632 Ga0068871_100001130
633 Ga0068871_100001363
634 Ga0068871_100001889
635 Ga0068871_100013831
636 Ga0075428_100037742
637 Ga0075428_100196797
638 Ga0075430_100130267
639 Ga0075431_100032928
640 Ga0075434_100184124
641 Ga0075429_100008362
642 Ga0075429_100027743
643 Ga0068865_100038245
644 Ga0075436_100054455
645 Ga0097620_100234707
646 Ga0097620_100278830
647 Ga0075435_100006817
648 Ga0075435_100111272
649 Ga0111539_10049365
650 Ga0111539_10054034
651 Ga0111539_10319506
652 Ga0111539_10395340
653 Ga0105245_10000086
654 Ga0105245_10175531
655 Ga0114129_10070003
656 Ga0114129_10084534
657 Ga0114129_10121335
658 Ga0105243_10000900
659 Ga0105241_10012582
660 Ga0105242_10001502
661 Ga0105242_10169475
662 Ga0105248_10086985
663 Ga0105248_10129352
664 Ga0105248_10148371
665 Ga0105248_10602124
666 Ga0105249_10085091
667 Ga0105249_10375427
668 Ga0105239_10034543
669 Ga0157371_10085522
670 Ga0157374_10003525
671 Ga0157374_10012957
672 Ga0157378_10001516
673 Ga0157378_10034102
674 Ga0157378_10150049
675 Ga0157378_10182606
676 Ga0163162_10012041
677 Ga0163162_10096248
678 Ga0163162_10195135
679 Ga0163162_10477818
680 Ga0157375_10004665
681 Ga0157375_10017440
682 Ga0157375_10056516
683 Ga0157375_10168428
684 Ga0163163_10069027
685 Ga0163163_10202863
686 Ga0157380_10015263
687 Ga0157380_10168090
688 Ga0157377_10054733
689 Ga0157379_10086917
690 Ga0157376_10014092
691 Ga0157376_10017583
692 Ga0157376_10108602
693 Ga0163161_10086176
694 Ga0163161_10244079
695 Ga0209455_1000532
696 Ga0209025_1000028
697 Ga0207697_10007537
698 Ga0207656_10004026
699 Ga0207653_10024006
700 Ga0207682_10002790
701 Ga0207682_10003695
702 Ga0207682_10039301
703 Ga0207682_10052428
704 Ga0207642_10106722
705 Ga0207688_10006774
706 Ga0207688_10040287
707 Ga0207688_10167861
708 Ga0207680_10012453
709 Ga0207680_10086725
710 Ga0207680_10090525
711 Ga0207645_10009136
712 Ga0207645_10023149
713 Ga0207645_10023207
714 Ga0207645_10069038
715 Ga0207643_10016102
716 Ga0207643_10030227
717 Ga0207643_10182024
718 Ga0207707_10193836
719 Ga0207660_10002252
720 Ga0207662_10000288
721 Ga0207649_10015354
722 Ga0207652_10135518
723 Ga0207681_10061588
724 Ga0207681_10182880
725 Ga0207650_10000547
726 Ga0207650_10001311
727 Ga0207650_10004236
728 Ga0207650_10067661
729 Ga0207650_10109300
730 Ga0207650_10148635
731 Ga0207659_10000792
732 Ga0207659_10008965
733 Ga0207687_10305685
734 Ga0207644_10001469
735 Ga0207644_10004546
736 Ga0207644_10106963
737 Ga0207706_10017636
738 Ga0207706_10036835
739 Ga0207706_10194560
740 Ga0207706_10288854
741 Ga0207686_10000595
742 Ga0207686_10243264
743 Ga0207709_10001099
744 Ga0207670_10001960
745 Ga0207670_10116825
746 Ga0207670_10235805
747 Ga0207669_10147331
748 Ga0207704_10000193
749 Ga0207691_10000276
750 Ga0207691_10001030
751 Ga0207691_10057789
752 Ga0207691_10167919
753 Ga0207711_10130619
754 Ga0207711_10145629
755 Ga0207689_10000246
756 Ga0207689_10115512
757 Ga0207689_10129045
758 Ga0207661_10001694
759 Ga0207661_10096841
760 Ga0207679_10001570
761 Ga0207679_10002649
762 Ga0207679_10099899
763 Ga0207667_10008141
764 Ga0207651_10003905
765 Ga0207651_10057336
766 Ga0207651_10129769
767 Ga0207651_10206960
768 Ga0207712_10159842
769 Ga0207640_10000657
770 Ga0207640_10004162
771 Ga0207658_10055814
772 Ga0207658_10080732
773 Ga0207658_10092468
774 Ga0207658_10109025
775 Ga0207658_10160792
776 Ga0207677_10000888
777 Ga0207677_10001059
778 Ga0207677_10003535
779 Ga0207677_10083865
780 Ga0207703_10165117
781 Ga0207703_10257665
782 Ga0207678_10368247
783 Ga0207708_10000346
784 Ga0207708_10015904
785 Ga0207708_10051638
786 Ga0207702_10099001
787 Ga0207641_10009543
788 Ga0207641_10037686
789 Ga0207641_10049563
790 Ga0207641_10100076
791 Ga0207648_10000145
792 Ga0207648_10011175
793 Ga0207648_10018599
794 Ga0207648_10054903
795 Ga0207648_10108425
796 Ga0207676_10000711
797 Ga0207676_10016549
798 Ga0207676_10189805
799 Ga0207675_100001564
800 Ga0207675_100046179
801 Ga0207675_100406497
802 Ga0207683_10000759
803 Ga0207683_10015948
804 Ga0207683_10017802
805 Ga0207683_10065370
806 Ga0207698_10000566
807 Ga0207698_10013639
808 Ga0207698_10320530
809 Ga0207428_10016172
810 Ga0207428_10227973
811 Ga0268266_10047069
812 Ga0268266_10163878
813 Ga0268266_10280094
814 Ga0268265_10001212
815 Ga0268265_10351896
816 Ga0268264_10051975
817 Ga0268264_10166525
818 Ga0265318_10006553
819 Ga0265318_10024480
820 Ga0265338_10139773
821 Ga0265330_10007204
822 Ga0265332_10000735
823 Ga0265332_10003598
824 Ga0265332_10092510
825 Ga0265328_10005143
826 Ga0265328_10025493
827 Ga0265320_10021392
828 Ga0265320_10072348
829 Ga0265329_10002359
830 Ga0265340_10003954
831 Ga0265339_10002711
832 Ga0265331_10000832
833 Ga0265331_10012568
834 Ga0265331_10023080
835 Ga0265316_10023082
836 Ga0307408_100040828
837 Ga0265314_10002632
838 Ga0265314_10009702
839 Ga0265314_10039770
840 Ga0265314_10086938
841 Ga0265342_10000092
842 Ga0265342_10003929
843 Ga0307405_10013809
844 Ga0307413_10007421
845 Ga0307413_10038147
846 Ga0307413_10039136
847 Ga0307410_10004671
848 Ga0307407_10046002
849 Ga0307407_10143515
850 Ga0307412_10045725
851 Ga0307412_10156162
852 Ga0307409_100039707
853 Ga0307409_100050551
854 Ga0307409_100408656
855 Ga0307416_100192487
856 Ga0307414_10006140
857 Ga0307414_10201230
858 Ga0307414_10242962
859 Ga0307411_10026326
860 Ga0307411_10155383
861 Ga0307411_10306530
862 Ga0373950_0016982
863 Ga0373926_0004813
864 Ga0373940_0005327
865 Ga0373944_0001696
866 Ga0373949_0004742
867 Ga0373951_0017082
868 Ga0373952_0009972
869 Ga0373932_0004303
870 Ga0373936_0004368
871 Ga0373936_0048540
872 Ga0373939_0025008
873 Ga0373945_0014482
874 Ga0373943_0005171
875 Ga0373943_0011481
876 Ga0373946_0000679
877 Ga0373946_0057643
878 Ga0373942_0005658
879 Ga0373931_0121141
880 Ga0373935_0005822
881 Ga0373935_0021034
882 Ga0373927_0006898
883 Ga0373927_0029328
884 Ga0373947_0006482
885 Ga0373947_0020088
886 Ga0373925_0011389
887 Ga0373925_0027144
888 Ga0395900_0027735
889 Ga0395898_0043684
890 Ga0395905_0036366
891 Ga0451853_4038841
892 Ga0451577_0265590
893 Ga0451577_0732474
894 Ga0466961_0067392
895 Ga0453684_0558773
896 Ga0451576_0031504
897 Ga0495603_0013602
898 Ga0495580_0002245
899 Ga0495582_0037819
900 Ga0495605_0074406
901 Ga0495665_0032852
902 Ga0495586_0003755
903 Ga0495633_0000926
904 Ga0495656_0012687
905 Ga0495656_0071982
906 Ga0495658_0001257
907 Ga0495658_0023385
908 Ga0495676_0030171
909 Ga0496102_0085148
910 Ga0496106_0040101
911 Ga0496106_0415453
912 Ga0496108_0008167
913 Ga0496108_0132458
914 Ga0496109_0024935
915 Ga0496109_0131358
916 Ga0496109_0364043
917 Ga0496110_0014434
918 Ga0496110_0054872
919 Ga0496111_0272659
920 Ga0496112_0573674
921 Ga0496114_0159296
922 Ga0496116_0010833
923 Ga0496118_0019291
924 Ga0496119_0095601
925 Ga0496121_0005309
926 Ga0496122_0004199
927 Ga0496122_0023593
928 Ga0496123_0098199
929 Ga0496126_0116879
930 Ga0501039_0051989
931 Ga0501040_0100588
932 Ga0501042_0197091
933 Ga0501048_0170695
934 Ga0501072_0000464
935 Ga0501075_0028335
936 Ga0501076_0097103
937 Ga0501079_0254963
938 Ga0501081_0062527
939 Ga0501081_0237567
940 nmdc:mga00v17_161465_c1
941 nmdc:mga05p37_185_c1
942 nmdc:mga09592_6056_c1
943 nmdc:mga0qj67_65216_c1
944 nmdc:mga06r32_237410_c1
945 nmdc:mga08y16_192897_c1
946 nmdc:mga08y16_27924_c1
947 nmdc:mga08y16_369507_c1
948 nmdc:mga08y16_515986_c1
949 nmdc:mga0n895_194730_c1
950 nmdc:mga0rr50_215890_c1
951 nmdc:mga0rr50_42668_c1
952 Ga0500644_0001546
953 Ga0500583_0130424
954 Ga0500593_000654
955 Ga0500590_025986
956 Ga0501084_0219748
957 Ga0501082_0258304
958 Ga0530510_0030871
959 Ga0530510_0046651
960 2508693028
961 2515630093
962 2855731768
963 2855768474
964 2881414918
965 2935700832
966 2935981858
967 2939633961
968 8016584535
969 8019620947
970 8019629604
971 8019648294
972 8019659746
973 8019669205
974 8019678275

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03401

TctC

Tripartite tricarboxylate transporter family receptor

73

346

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
2qpq-assembly3.cif.gz_C structure of bug27 from bordetella pertussis 0.9558 2 277
2qpq-assembly3.cif.gz_C structure of bug27 from bordetella pertussis 0.9491 2 277
2qpq-assembly2.cif.gz_B structure of bug27 from bordetella pertussis 0.9459 2 277
2qpq-assembly2.cif.gz_B structure of bug27 from bordetella pertussis 0.9393 2 277
8hk9-assembly2.cif.gz_A apo-form of periplasmic terephthalate binding protein (tbp) from ideonella sakaiensis 0.9291 2 274
ID Description Score Start End Superfamily
4x9tA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9571 80 197 3.40.190.10
2dvzA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9433 79 201 3.40.190.10
6hkeC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9405 80 202 3.40.190.10
2f5xC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9266 81 202 3.40.190.10
6hkeC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9262 80 202 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A3A3FMR4-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.9749 2 277
AF-A0A261UKM0-F1-model_v4 ABC transporter substrate-binding protein 0.974 2 277
AF-A0A1F4DK31-F1-model_v4 LacI family transcriptional regulator 0.9732 2 277
AF-A0A4R3USR2-F1-model_v4 Tripartite-type tricarboxylate transporter receptor subunit TctC 0.9728 2 277
AF-A0A2G4JA32-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.9726 2 277

Map