F453477

General Info

Members Datasets Scaffolds Average Seq Length
487 204 975 180

Family's Representative Sequence

Representative Sequence 3300037418|Ga0395900_0133417|Ga0395900_0133417_1841_2413
Length 190
Sequence MTDAAAAIRLPLERIAPDSIRLERTLDAPVTTVWRYLTEAELRSRWFMGGTDATAGGTFELLVDHDRLSDDANVPYPESYAEFKGKTWTEQVVRFEPPRLLETTFQGGKNGTVTYELTAEGERTKLVLTHRGIVSATGAQDFGSGWTSHLTVLEERLAGRGVKNFWALHAKSRETVEKALRLTASLIPVS

Samples

Sample ID Description Type Environment
1 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
4 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
59 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
75 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
76 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
77 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
78 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
86 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
87 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
88 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
141 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
142 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
143 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
144 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
145 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
146 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
147 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
148 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
149 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
150 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
151 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
152 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
153 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
154 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
155 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
156 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
157 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
158 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
159 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
160 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
161 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
162 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
163 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
164 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
165 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
166 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
167 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
168 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
169 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
170 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
171 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
172 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
173 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
174 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
175 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
176 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
177 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
178 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
179 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
180 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
181 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
182 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
183 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
184 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
185 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
186 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
187 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
188 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
189 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
190 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
191 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
192 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
193 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
194 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
195 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
196 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
197 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
198 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
199 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
200 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
201 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
202 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
203 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
204 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.75
Rhizosphere 93.84
Stem 0
Stem Tuber 0
Unclassified 13.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395900_0133417 3300037418 Bacteria 2544
2 JGI24740J21852_10010192 3300001979 Bacteria 3632
3 JGI24740J21852_10012721 3300001979 Bacteria 3164
4 JGI24738J21930_10037231 3300002075 Bacteria 989
5 rootH1_10030977 3300003316 Bacteria 5441
6 rootH1_10030977 3300003323 Bacteria 2986
7 Ga0065712_10413666 3300005290 Bacteria 719
8 Ga0070658_10021315 3300005327 Bacteria 5193
9 Ga0070658_10038119 3300005327 Bacteria 3876
10 Ga0070658_10080699 3300005327 Bacteria 2672
11 Ga0070658_10128367 3300005327 Bacteria 2112
12 Ga0070658_10176557 3300005327 Bacteria 1796
13 Ga0070658_10579855 3300005327 Unclassified 971
14 Ga0070658_10861698 3300005327 Unclassified 787
15 Ga0070658_10917685 3300005327 Unclassified 761
16 Ga0070676_10006071 3300005328 Bacteria 6448
17 Ga0070676_10053535 3300005328 Unclassified 2377
18 Ga0070676_10158746 3300005328 Bacteria 1454
19 Ga0070676_10431772 3300005328 Bacteria 923
20 Ga0070683_100002352 3300005329 Bacteria 15007
21 Ga0070683_100529300 3300005329 Bacteria 1126
22 Ga0070690_100156590 3300005330 Bacteria 1558
23 Ga0070670_100068907 3300005331 Bacteria 3037
24 Ga0070670_100129558 3300005331 Bacteria 2178
25 Ga0070670_100167400 3300005331 Bacteria 1906
26 Ga0070670_100271913 3300005331 Bacteria 1478
27 Ga0070677_10462240 3300005333 Bacteria 681
28 Ga0068869_100074495 3300005334 Bacteria 2520
29 Ga0068869_100423208 3300005334 Bacteria 1099
30 Ga0070666_10019957 3300005335 Bacteria 4330
31 Ga0070680_100298217 3300005336 Bacteria 1367
32 Ga0070682_100292980 3300005337 Bacteria 1191
33 Ga0068868_100181186 3300005338 Bacteria 1748
34 Ga0068868_100194402 3300005338 Bacteria 1688
35 Ga0068868_100252638 3300005338 Bacteria 1484
36 Ga0068868_100455100 3300005338 Unclassified 1114
37 Ga0070660_100001875 3300005339 Bacteria 14485
38 Ga0070660_100283931 3300005339 Bacteria 1355
39 Ga0070660_100317179 3300005339 Bacteria 1280
40 Ga0070660_100363559 3300005339 Bacteria 1193
41 Ga0070687_100043659 3300005343 Bacteria 2280
42 Ga0070687_100159461 3300005343 Bacteria 1332
43 Ga0070661_100066874 3300005344 Bacteria 2641
44 Ga0070661_100153795 3300005344 Bacteria 1740
45 Ga0070661_100204469 3300005344 Bacteria 1510
46 Ga0070661_100278314 3300005344 Bacteria 1297
47 Ga0070661_100366369 3300005344 Unclassified 1133
48 Ga0070661_100392620 3300005344 Bacteria 1096
49 Ga0070661_100846523 3300005344 Unclassified 752
50 Ga0070668_100012588 3300005347 Bacteria 6299
51 Ga0070668_100677467 3300005347 Unclassified 908
52 Ga0070668_100837687 3300005347 Bacteria 819
53 Ga0070669_100127684 3300005353 Bacteria 1947
54 Ga0070675_100710174 3300005354 Unclassified 916
55 Ga0070671_100002704 3300005355 Bacteria 13757
56 Ga0070674_100077137 3300005356 Bacteria 2371
57 Ga0070674_100126027 3300005356 Bacteria 1902
58 Ga0070673_100095983 3300005364 Bacteria 2432
59 Ga0070673_100105499 3300005364 Bacteria 2328
60 Ga0070673_100106040 3300005364 Bacteria 2323
61 Ga0070673_100328189 3300005364 Bacteria 1353
62 Ga0070688_100533625 3300005365 Bacteria 890
63 Ga0070659_100277898 3300005366 Unclassified 1393
64 Ga0070659_100360773 3300005366 Bacteria 1221
65 Ga0070667_100001342 3300005367 Bacteria 22068
66 Ga0070667_100042464 3300005367 Bacteria 3815
67 Ga0070667_100180348 3300005367 Bacteria 1867
68 Ga0070709_10155268 3300005434 Bacteria 1586
69 Ga0070714_100059875 3300005435 Bacteria 3266
70 Ga0070713_100111820 3300005436 Bacteria 2382
71 Ga0070705_100046371 3300005440 Bacteria 2505
72 Ga0070663_100017328 3300005455 Bacteria 4701
73 Ga0070663_100020325 3300005455 Bacteria 4394
74 Ga0070663_101085366 3300005455 Unclassified 699
75 Ga0070662_100085074 3300005457 Bacteria 2363
76 Ga0070662_100097514 3300005457 Bacteria 2219
77 Ga0070662_100099795 3300005457 Bacteria 2195
78 Ga0070662_100103782 3300005457 Bacteria 2156
79 Ga0070662_100176444 3300005457 Unclassified 1682
80 Ga0070662_100222530 3300005457 Bacteria 1506
81 Ga0070681_10105680 3300005458 Unclassified 2757
82 Ga0068867_100022638 3300005459 Bacteria 4493
83 Ga0068867_100118259 3300005459 Bacteria 2044
84 Ga0068867_100256528 3300005459 Unclassified 1424
85 Ga0068867_100462012 3300005459 Bacteria 1084
86 Ga0070679_100277997 3300005530 Bacteria 1627
87 Ga0070679_101076545 3300005530 Bacteria 748
88 Ga0070684_100041133 3300005535 Bacteria 3983
89 Ga0068853_100075477 3300005539 Unclassified 2942
90 Ga0068853_100181575 3300005539 Bacteria 1908
91 Ga0068853_100247779 3300005539 Unclassified 1634
92 Ga0068853_101611674 3300005539 Bacteria 629
93 Ga0070672_100052434 3300005543 Bacteria 3184
94 Ga0070672_100081694 3300005543 Bacteria 2591
95 Ga0070686_100043105 3300005544 Bacteria 2830
96 Ga0070686_100315819 3300005544 Bacteria 1163
97 Ga0070696_100066610 3300005546 Unclassified 2526
98 Ga0070696_100496297 3300005546 Bacteria 970
99 Ga0070665_100554358 3300005548 Unclassified 1162
100 Ga0070665_100733976 3300005548 Bacteria 1001
101 Ga0068855_100184482 3300005563 Bacteria 2357
102 Ga0068855_100217912 3300005563 Bacteria 2142
103 Ga0068855_100524320 3300005563 Bacteria 1285
104 Ga0068855_101168644 3300005563 Unclassified 801
105 Ga0070664_100020701 3300005564 Bacteria 5419
106 Ga0070664_100048226 3300005564 Bacteria 3599
107 Ga0070664_100049532 3300005564 Bacteria 3553
108 Ga0070664_100067543 3300005564 Bacteria 3055
109 Ga0070664_100162657 3300005564 Bacteria 1976
110 Ga0070664_100166320 3300005564 Bacteria 1954
111 Ga0070664_100226138 3300005564 Bacteria 1676
112 Ga0070664_101003266 3300005564 Unclassified 785
113 Ga0068857_100017571 3300005577 Bacteria 6271
114 Ga0068857_100018744 3300005577 Bacteria 6073
115 Ga0068857_100070650 3300005577 Bacteria 3110
116 Ga0068857_100088322 3300005577 Bacteria 2773
117 Ga0068857_100509821 3300005577 Bacteria 1130
118 Ga0068857_100556997 3300005577 Unclassified 1080
119 Ga0068857_100757586 3300005577 Bacteria 925
120 Ga0068854_100004852 3300005578 Bacteria 8481
121 Ga0068856_100021127 3300005614 Bacteria 6326
122 Ga0068856_100063451 3300005614 Bacteria 3650
123 Ga0068856_100210547 3300005614 Bacteria 1959
124 Ga0068856_100298737 3300005614 Bacteria 1628
125 Ga0068856_101616242 3300005614 Bacteria 661
126 Ga0068852_100004326 3300005616 Bacteria 10023
127 Ga0068852_100014270 3300005616 Bacteria 6109
128 Ga0068852_100119142 3300005616 Bacteria 2413
129 Ga0068852_100124108 3300005616 Unclassified 2368
130 Ga0068852_100423328 3300005616 Unclassified 1314
131 Ga0068852_100427991 3300005616 Bacteria 1307
132 Ga0068852_101254816 3300005616 Bacteria 762
133 Ga0068859_100027869 3300005617 Bacteria 5665
134 Ga0068859_100056691 3300005617 Bacteria 3944
135 Ga0068859_100152643 3300005617 Bacteria 2385
136 Ga0068859_100676763 3300005617 Bacteria 1123
137 Ga0068864_100008895 3300005618 Bacteria 8276
138 Ga0068864_100031435 3300005618 Bacteria 4504
139 Ga0068864_100053876 3300005618 Bacteria 3471
140 Ga0068866_10004364 3300005718 Bacteria 5808
141 Ga0068866_10737870 3300005718 Unclassified 679
142 Ga0068851_10066720 3300005834 Bacteria 1854
143 Ga0068851_10073104 3300005834 Bacteria 1778
144 Ga0068851_10170834 3300005834 Bacteria 1200
145 Ga0068851_10247490 3300005834 Bacteria 1010
146 Ga0068863_100012099 3300005841 Bacteria 8335
147 Ga0068863_100015195 3300005841 Bacteria 7397
148 Ga0068863_100035258 3300005841 Bacteria 4766
149 Ga0068858_100029542 3300005842 Bacteria 5090
150 Ga0068858_100123808 3300005842 Bacteria 2420
151 Ga0068860_100035919 3300005843 Bacteria 4752
152 Ga0068860_100092748 3300005843 Bacteria 2878
153 Ga0068860_101450693 3300005843 Bacteria 708
154 Ga0068862_100009029 3300005844 Bacteria 8249
155 Ga0070716_100219354 3300006173 Bacteria 1277
156 Ga0070712_100615899 3300006175 Bacteria 920
157 Ga0097621_100133110 3300006237 Bacteria 2118
158 Ga0068871_100019700 3300006358 Bacteria 5155
159 Ga0068871_100077926 3300006358 Bacteria 2740
160 Ga0068871_100232846 3300006358 Bacteria 1599
161 Ga0068865_100123461 3300006881 Bacteria 1929
162 Ga0068865_100137898 3300006881 Bacteria 1836
163 Ga0097620_100027868 3300006931 Bacteria 5665
164 Ga0097620_100056691 3300006931 Bacteria 3944
165 Ga0097620_100152659 3300006931 Bacteria 2385
166 Ga0097620_100676819 3300006931 Bacteria 1123
167 Ga0105240_10119034 3300009093 Bacteria 3182
168 Ga0105245_10007438 3300009098 Bacteria 9592
169 Ga0105243_10839650 3300009148 Unclassified 909
170 Ga0105241_11329691 3300009174 Bacteria 685
171 Ga0105242_10014499 3300009176 Bacteria 6107
172 Ga0105248_10057377 3300009177 Bacteria 4370
173 Ga0105237_10137152 3300009545 Bacteria 2441
174 Ga0105238_10668367 3300009551 Bacteria 1050
175 Ga0105249_10034805 3300009553 Bacteria 4565
176 Ga0105239_10109343 3300010375 Bacteria 3063
177 Ga0105239_10824480 3300010375 Bacteria 1063
178 Ga0105246_11054911 3300011119 Bacteria 739
179 Ga0157373_10029127 3300013100 Unclassified 3980
180 Ga0157373_10081058 3300013100 Bacteria 2288
181 Ga0157373_10114579 3300013100 Bacteria 1895
182 Ga0157373_10176759 3300013100 Bacteria 1503
183 Ga0157373_10490026 3300013100 Bacteria 887
184 Ga0157371_10059882 3300013102 Unclassified 2700
185 Ga0157371_10099651 3300013102 Bacteria 2060
186 Ga0157371_10227254 3300013102 Bacteria 1341
187 Ga0157371_10296998 3300013102 Unclassified 1169
188 Ga0157371_10636226 3300013102 Bacteria 795
189 Ga0157370_10035588 3300013104 Bacteria 4837
190 Ga0157370_10489426 3300013104 Bacteria 1130
191 Ga0157370_10494759 3300013104 Unclassified 1123
192 Ga0157369_10000141 3300013105 Bacteria 102055
193 Ga0157369_10105449 3300013105 Bacteria 3001
194 Ga0157369_10280453 3300013105 Bacteria 1735
195 Ga0157369_10315068 3300013105 Bacteria 1626
196 Ga0157369_10376698 3300013105 Bacteria 1473
197 Ga0157374_10564287 3300013296 Bacteria 1147
198 Ga0157378_11240102 3300013297 Unclassified 786
199 Ga0163162_10170616 3300013306 Bacteria 2300
200 Ga0163162_11575756 3300013306 Unclassified 749
201 Ga0157372_10693056 3300013307 Bacteria 1185
202 Ga0157372_10774033 3300013307 Bacteria 1116
203 Ga0157375_10177145 3300013308 Bacteria 2282
204 Ga0157375_11172342 3300013308 Bacteria 901
205 Ga0163163_10020793 3300014325 Bacteria 6187
206 Ga0182008_10032106 3300014497 Bacteria 2639
207 Ga0157379_10003380 3300014968 Bacteria 13508
208 Ga0157376_10268925 3300014969 Bacteria 1600
209 Ga0207697_10024758 3300025315 Bacteria 2456
210 Ga0207697_10052251 3300025315 Bacteria 1690
211 Ga0207656_10218585 3300025321 Unclassified 925
212 Ga0207656_10274502 3300025321 Bacteria 830
213 Ga0207680_10281144 3300025903 Bacteria 1156
214 Ga0207647_10003288 3300025904 Bacteria 12136
215 Ga0207647_10030196 3300025904 Bacteria 3499
216 Ga0207647_10148801 3300025904 Bacteria 1369
217 Ga0207647_10221556 3300025904 Bacteria 1090
218 Ga0207699_10144170 3300025906 Bacteria 1568
219 Ga0207645_10004643 3300025907 Bacteria 10116
220 Ga0207645_10113470 3300025907 Unclassified 1756
221 Ga0207645_10172706 3300025907 Bacteria 1417
222 Ga0207705_10012438 3300025909 Bacteria 6148
223 Ga0207705_10055501 3300025909 Bacteria 2856
224 Ga0207705_10143576 3300025909 Bacteria 1784
225 Ga0207705_10247670 3300025909 Bacteria 1358
226 Ga0207654_10940041 3300025911 Unclassified 627
227 Ga0207707_10175924 3300025912 Bacteria 1870
228 Ga0207707_11037847 3300025912 Bacteria 671
229 Ga0207695_10025087 3300025913 Bacteria 6687
230 Ga0207693_10225356 3300025915 Bacteria 1472
231 Ga0207660_10893375 3300025917 Unclassified 725
232 Ga0207660_10925525 3300025917 Bacteria 711
233 Ga0207662_10108623 3300025918 Bacteria 1727
234 Ga0207657_10003240 3300025919 Bacteria 17421
235 Ga0207657_10017023 3300025919 Bacteria 6993
236 Ga0207657_10057576 3300025919 Bacteria 3349
237 Ga0207657_10057702 3300025919 Bacteria 3345
238 Ga0207657_10516131 3300025919 Bacteria 935
239 Ga0207649_10179187 3300025920 Bacteria 1482
240 Ga0207649_10207945 3300025920 Unclassified 1387
241 Ga0207649_10664212 3300025920 Bacteria 806
242 Ga0207652_10132989 3300025921 Bacteria 2220
243 Ga0207652_10242606 3300025921 Bacteria 1624
244 Ga0207681_10042183 3300025923 Bacteria 3046
245 Ga0207681_10105014 3300025923 Bacteria 2044
246 Ga0207650_10040281 3300025925 Bacteria 3418
247 Ga0207650_10185839 3300025925 Bacteria 1658
248 Ga0207650_10251967 3300025925 Bacteria 1429
249 Ga0207659_10568662 3300025926 Unclassified 965
250 Ga0207687_10131872 3300025927 Bacteria 1885
251 Ga0207700_10082847 3300025928 Bacteria 2509
252 Ga0207664_10405393 3300025929 Bacteria 1213
253 Ga0207644_10009330 3300025931 Bacteria 6442
254 Ga0207644_10031946 3300025931 Bacteria 3671
255 Ga0207690_10067943 3300025932 Bacteria 2446
256 Ga0207690_10100281 3300025932 Bacteria 2066
257 Ga0207690_10105081 3300025932 Bacteria 2024
258 Ga0207690_10955016 3300025932 Unclassified 712
259 Ga0207706_10005019 3300025933 Bacteria 12357
260 Ga0207706_10164872 3300025933 Bacteria 1947
261 Ga0207706_10179212 3300025933 Bacteria 1861
262 Ga0207706_10209089 3300025933 Unclassified 1711
263 Ga0207706_10403147 3300025933 Bacteria 1186
264 Ga0207706_10485101 3300025933 Bacteria 1068
265 Ga0207686_10259592 3300025934 Bacteria 1273
266 Ga0207669_10071171 3300025937 Bacteria 2183
267 Ga0207669_10160281 3300025937 Bacteria 1588
268 Ga0207704_10025212 3300025938 Bacteria 3241
269 Ga0207704_10089598 3300025938 Bacteria 2016
270 Ga0207691_10003509 3300025940 Bacteria 15253
271 Ga0207691_10077676 3300025940 Bacteria 2990
272 Ga0207711_10005792 3300025941 Bacteria 10439
273 Ga0207711_10105428 3300025941 Bacteria 2500
274 Ga0207711_10648806 3300025941 Bacteria 985
275 Ga0207689_10089745 3300025942 Bacteria 2525
276 Ga0207689_10116840 3300025942 Bacteria 2193
277 Ga0207689_10294630 3300025942 Bacteria 1344
278 Ga0207661_10035813 3300025944 Bacteria 3870
279 Ga0207661_10040988 3300025944 Bacteria 3643
280 Ga0207679_10000876 3300025945 Bacteria 19206
281 Ga0207679_10025802 3300025945 Bacteria 4046
282 Ga0207679_10079995 3300025945 Bacteria 2494
283 Ga0207679_10099556 3300025945 Bacteria 2270
284 Ga0207679_11247268 3300025945 Bacteria 682
285 Ga0207667_10006957 3300025949 Bacteria 13671
286 Ga0207667_10075111 3300025949 Bacteria 3510
287 Ga0207667_10134369 3300025949 Bacteria 2547
288 Ga0207651_10017117 3300025960 Bacteria 4272
289 Ga0207651_10025604 3300025960 Bacteria 3670
290 Ga0207651_10395678 3300025960 Bacteria 1174
291 Ga0207651_10716453 3300025960 Bacteria 882
292 Ga0207668_10000417 3300025972 Bacteria 26845
293 Ga0207640_10005308 3300025981 Bacteria 7017
294 Ga0207658_10008028 3300025986 Bacteria 7192
295 Ga0207658_10040890 3300025986 Bacteria 3354
296 Ga0207658_10166539 3300025986 Unclassified 1811
297 Ga0207677_10018183 3300026023 Bacteria 4213
298 Ga0207677_10304520 3300026023 Bacteria 1318
299 Ga0207677_10527848 3300026023 Unclassified 1025
300 Ga0207703_10031928 3300026035 Bacteria 4166
301 Ga0207703_10110472 3300026035 Bacteria 2345
302 Ga0207703_10161210 3300026035 Bacteria 1964
303 Ga0207639_10027246 3300026041 Bacteria 4161
304 Ga0207639_10046715 3300026041 Bacteria 3268
305 Ga0207639_10143407 3300026041 Bacteria 1993
306 Ga0207639_10268206 3300026041 Bacteria 1496
307 Ga0207639_11251258 3300026041 Unclassified 696
308 Ga0207678_10009020 3300026067 Bacteria 8780
309 Ga0207678_10009736 3300026067 Bacteria 8450
310 Ga0207678_10019855 3300026067 Bacteria 5906
311 Ga0207678_10290115 3300026067 Bacteria 1405
312 Ga0207702_10004836 3300026078 Bacteria 11862
313 Ga0207702_10006382 3300026078 Bacteria 10181
314 Ga0207702_10006660 3300026078 Bacteria 9935
315 Ga0207702_10268518 3300026078 Bacteria 1608
316 Ga0207702_10468670 3300026078 Bacteria 1224
317 Ga0207702_11152855 3300026078 Bacteria 769
318 Ga0207641_10025327 3300026088 Bacteria 4891
319 Ga0207641_10055972 3300026088 Bacteria 3350
320 Ga0207641_10073202 3300026088 Bacteria 2952
321 Ga0207648_10002532 3300026089 Bacteria 19611
322 Ga0207648_10004072 3300026089 Bacteria 15153
323 Ga0207648_10454592 3300026089 Bacteria 1167
324 Ga0207676_10007368 3300026095 Bacteria 7804
325 Ga0207676_10017996 3300026095 Bacteria 5130
326 Ga0207676_10051099 3300026095 Bacteria 3226
327 Ga0207676_10475398 3300026095 Bacteria 1182
328 Ga0207674_10000344 3300026116 Bacteria 59855
329 Ga0207674_10004400 3300026116 Bacteria 16980
330 Ga0207674_10036750 3300026116 Bacteria 5099
331 Ga0207674_10062213 3300026116 Bacteria 3770
332 Ga0207674_10065310 3300026116 Bacteria 3668
333 Ga0207674_10121755 3300026116 Bacteria 2576
334 Ga0207683_10001784 3300026121 Bacteria 19038
335 Ga0207698_10016729 3300026142 Bacteria 4955
336 Ga0207698_10042310 3300026142 Bacteria 3402
337 Ga0207698_10104458 3300026142 Bacteria 2357
338 Ga0207698_10373533 3300026142 Bacteria 1354
339 Ga0207698_10734177 3300026142 Bacteria 985
340 Ga0268266_10160625 3300028379 Bacteria 2032
341 Ga0268265_10021618 3300028380 Bacteria 4510
342 Ga0268264_10013746 3300028381 Bacteria 6658
343 Ga0268264_10144919 3300028381 Bacteria 2122
344 Ga0307413_10007321 3300031824 Bacteria 5116
345 Ga0307410_10006962 3300031852 Bacteria 6151
346 Ga0307410_10102735 3300031852 Bacteria 2051
347 Ga0307406_10011585 3300031901 Bacteria 5009
348 Ga0307406_10200212 3300031901 Bacteria 1469
349 Ga0307406_10625676 3300031901 Unclassified 890
350 Ga0307407_10014873 3300031903 Bacteria 3825
351 Ga0307412_10012265 3300031911 Bacteria 4990
352 Ga0307412_10096538 3300031911 Bacteria 2080
353 Ga0307409_100001864 3300031995 Bacteria 10729
354 Ga0307416_100029242 3300032002 Unclassified 4112
355 Ga0307416_100945366 3300032002 Bacteria 963
356 Ga0307414_10032857 3300032004 Bacteria 3421
357 Ga0307411_10030747 3300032005 Unclassified 3295
358 Ga0307415_100011783 3300032126 Bacteria 5022
359 Ga0373940_0020031 3300035088 Unclassified 1696
360 Ga0373931_0130747 3300035691 Bacteria 1445
361 Ga0395899_0010963 3300037312 Bacteria 6943
362 Ga0395899_0039330 3300037312 Bacteria 3540
363 Ga0395899_0045110 3300037312 Bacteria 3284
364 Ga0395899_0133587 3300037312 Bacteria 1770
365 Ga0395899_0143032 3300037312 Bacteria 1701
366 Ga0395899_0248604 3300037312 Bacteria 1221
367 Ga0395900_0021186 3300037418 Bacteria 6645
368 Ga0395900_0048858 3300037418 Bacteria 4357
369 Ga0395900_0051750 3300037418 Bacteria 4229
370 Ga0395900_0065268 3300037418 Bacteria 3739
371 Ga0395900_0098775 3300037418 Bacteria 2999
372 Ga0395900_0232026 3300037418 Bacteria 1855
373 Ga0395900_0393584 3300037418 Bacteria 1351
374 Ga0395900_0401312 3300037418 Bacteria 1335
375 Ga0395900_0436430 3300037418 Bacteria 1268
376 Ga0395900_0473131 3300037418 Bacteria 1206
377 Ga0395898_0009249 3300037466 Bacteria 10365
378 Ga0395898_0011538 3300037466 Bacteria 9179
379 Ga0395898_0024906 3300037466 Bacteria 6032
380 Ga0395898_0042581 3300037466 Bacteria 4479
381 Ga0395898_1040317 3300037466 Unclassified 754
382 Ga0395905_0017567 3300037471 Bacteria 6789
383 Ga0395905_0018988 3300037471 Bacteria 6519
384 Ga0395905_0100371 3300037471 Bacteria 2718
385 Ga0395905_0131565 3300037471 Bacteria 2353
386 Ga0395905_0185420 3300037471 Bacteria 1953
387 Ga0395905_0561578 3300037471 Bacteria 1043
388 Ga0395905_0647564 3300037471 Bacteria 958
389 Ga0395901_0011742 3300038443 Bacteria 8879
390 Ga0395901_0021993 3300038443 Bacteria 6537
391 Ga0395901_0065506 3300038443 Bacteria 3783
392 Ga0395901_0087378 3300038443 Bacteria 3260
393 Ga0395901_0105181 3300038443 Bacteria 2962
394 Ga0395901_0149987 3300038443 Bacteria 2450
395 Ga0395901_0224755 3300038443 Bacteria 1961
396 Ga0395901_0493195 3300038443 Bacteria 1248
397 Ga0395901_0880020 3300038443 Unclassified 879
398 Ga0395901_0945639 3300038443 Unclassified 841
399 Ga0395901_1054253 3300038443 Unclassified 786
400 Ga0395901_1252017 3300038443 Unclassified 705
401 Ga0395901_1349681 3300038443 Unclassified 673
402 Ga0439448_0090150 3300042005 Bacteria 1035
403 Ga0439432_014661 3300042006 Unclassified 2652
404 Ga0439449_0037702 3300042007 Unclassified 1798
405 Ga0439458_0005141 3300042157 Bacteria 2950
406 Ga0466969_0138140 3300044656 Unclassified 1127
407 Ga0466969_0162382 3300044656 Unclassified 1026
408 Ga0466972_0044488 3300044658 Bacteria 2153
409 Ga0466972_0144469 3300044658 Bacteria 1119
410 Ga0466965_0068171 3300044683 Bacteria 1786
411 Ga0466966_0028684 3300044684 Bacteria 3623
412 Ga0466966_0068888 3300044684 Bacteria 2220
413 Ga0466966_0142796 3300044684 Bacteria 1462
414 Ga0466966_0378505 3300044684 Unclassified 850
415 Ga0466961_0012986 3300044693 Bacteria 5328
416 Ga0466961_0038374 3300044693 Bacteria 3072
417 Ga0466961_0050864 3300044693 Bacteria 2646
418 Ga0466961_0094768 3300044693 Bacteria 1883
419 Ga0466963_0033707 3300044694 Bacteria 3327
420 Ga0466963_0163438 3300044694 Bacteria 1550
421 Ga0466964_0010242 3300044706 Bacteria 3536
422 Ga0466971_0018981 3300044719 Bacteria 3050
423 Ga0466971_0035985 3300044719 Bacteria 2220
424 Ga0466968_0110391 3300044735 Bacteria 1236
425 Ga0466970_0031811 3300044765 Bacteria 2787
426 Ga0466970_0041978 3300044765 Bacteria 2432
427 Ga0466970_0132785 3300044765 Unclassified 1368
428 Ga0466970_0282728 3300044765 Bacteria 933
429 Ga0466957_0089162 3300044842 Bacteria 1930
430 Ga0466960_0018633 3300044901 Bacteria 3046
431 Ga0466960_0045138 3300044901 Bacteria 2104
432 Ga0466960_0225006 3300044901 Unclassified 1034
433 Ga0466959_0005664 3300045049 Bacteria 8595
434 Ga0466959_0064017 3300045049 Bacteria 2670
435 Ga0466959_0157507 3300045049 Bacteria 1597
436 Ga0466959_0195824 3300045049 Bacteria 1408
437 Ga0466958_0117988 3300045836 Bacteria 1659
438 Ga0466958_0213416 3300045836 Bacteria 1230
439 Ga0466967_0194035 3300045976 Unclassified 1920
440 Ga0466967_0410368 3300045976 Bacteria 1319
441 Ga0466967_0449965 3300045976 Bacteria 1258
442 Ga0495669_0324681 3300046684 Bacteria 743
443 Ga0495677_0001983 3300047445 Bacteria 8168
444 Ga0496101_0091755 3300048904 Bacteria 2261
445 Ga0496102_0134370 3300048905 Bacteria 2317
446 Ga0496103_0022162 3300048906 Bacteria 3824
447 Ga0496104_0090115 3300048907 Bacteria 2930
448 Ga0496104_0117649 3300048907 Bacteria 2551
449 Ga0496104_0620660 3300048907 Unclassified 991
450 Ga0496105_0026106 3300048908 Bacteria 4761
451 Ga0496105_0076090 3300048908 Bacteria 2772
452 Ga0496105_0182934 3300048908 Bacteria 1716
453 Ga0496106_0041699 3300048909 Bacteria 3440
454 Ga0496106_0148391 3300048909 Bacteria 1849
455 Ga0496107_0013979 3300048910 Bacteria 5616
456 Ga0496107_0032036 3300048910 Bacteria 3755
457 Ga0496108_0021445 3300048911 Bacteria 5311
458 Ga0496109_0023995 3300048912 Bacteria 5417
459 Ga0496109_0040087 3300048912 Bacteria 4241
460 Ga0496109_0374169 3300048912 Bacteria 1345
461 Ga0496109_0888270 3300048912 Unclassified 829
462 Ga0496110_0034196 3300048913 Bacteria 4401
463 Ga0496110_0150183 3300048913 Bacteria 2109
464 Ga0496111_0041717 3300048914 Bacteria 3293
465 Ga0496111_0109345 3300048914 Bacteria 2035
466 Ga0496111_0142313 3300048914 Bacteria 1777
467 Ga0496112_0035997 3300048915 Bacteria 4825
468 Ga0496112_0060443 3300048915 Bacteria 3734
469 Ga0496113_0006362 3300048916 Bacteria 7473
470 Ga0496113_0040986 3300048916 Bacteria 3414
471 Ga0496113_0087737 3300048916 Bacteria 2392
472 Ga0496121_0091246 3300048924 Bacteria 2379
473 Ga0501199_014795 3300049650 Bacteria 869
474 Ga0501201_020608 3300049651 Unclassified 697
475 Ga0501227_104832 3300049665 Unclassified 754
476 Ga0501233_010615 3300049668 Bacteria 1818
477 Ga0501235_016438 3300049669 Bacteria 1634
478 Ga0501257_052589 3300049686 Unclassified 1018
479 Ga0501221_026501 3300049704 Bacteria 1179
480 Ga0501225_0058755 3300049705 Bacteria 1080
481 Ga0501245_101088 3300049708 Unclassified 584
482 Ga0501241_069016 3300049758 Bacteria 720
483 Ga0501262_002582 3300049759 Unclassified 2050
484 Ga0501268_006023 3300049765 Bacteria 1764
485 Ga0501271_003028 3300049768 Bacteria 1534
486 Ga0466962_0005348 3300061719 Bacteria 6173
487 Ga0466962_0044778 3300061719 Bacteria 2116
488 Ga0466962_0314730 3300061719 Bacteria 776
489 Ga0395900_0133417
490 JGI24740J21852_10010192
491 JGI24740J21852_10012721
492 JGI24738J21930_10037231
493 rootH1_10030977
494 Ga0065712_10413666
495 Ga0070658_10021315
496 Ga0070658_10038119
497 Ga0070658_10080699
498 Ga0070658_10128367
499 Ga0070658_10176557
500 Ga0070658_10579855
501 Ga0070658_10861698
502 Ga0070658_10917685
503 Ga0070676_10006071
504 Ga0070676_10053535
505 Ga0070676_10158746
506 Ga0070676_10431772
507 Ga0070683_100002352
508 Ga0070683_100529300
509 Ga0070690_100156590
510 Ga0070670_100068907
511 Ga0070670_100129558
512 Ga0070670_100167400
513 Ga0070670_100271913
514 Ga0070677_10462240
515 Ga0068869_100074495
516 Ga0068869_100423208
517 Ga0070666_10019957
518 Ga0070680_100298217
519 Ga0070682_100292980
520 Ga0068868_100181186
521 Ga0068868_100194402
522 Ga0068868_100252638
523 Ga0068868_100455100
524 Ga0070660_100001875
525 Ga0070660_100283931
526 Ga0070660_100317179
527 Ga0070660_100363559
528 Ga0070687_100043659
529 Ga0070687_100159461
530 Ga0070661_100066874
531 Ga0070661_100153795
532 Ga0070661_100204469
533 Ga0070661_100278314
534 Ga0070661_100366369
535 Ga0070661_100392620
536 Ga0070661_100846523
537 Ga0070668_100012588
538 Ga0070668_100677467
539 Ga0070668_100837687
540 Ga0070669_100127684
541 Ga0070675_100710174
542 Ga0070671_100002704
543 Ga0070674_100077137
544 Ga0070674_100126027
545 Ga0070673_100095983
546 Ga0070673_100105499
547 Ga0070673_100106040
548 Ga0070673_100328189
549 Ga0070688_100533625
550 Ga0070659_100277898
551 Ga0070659_100360773
552 Ga0070667_100001342
553 Ga0070667_100042464
554 Ga0070667_100180348
555 Ga0070709_10155268
556 Ga0070714_100059875
557 Ga0070713_100111820
558 Ga0070705_100046371
559 Ga0070663_100017328
560 Ga0070663_100020325
561 Ga0070663_101085366
562 Ga0070662_100085074
563 Ga0070662_100097514
564 Ga0070662_100099795
565 Ga0070662_100103782
566 Ga0070662_100176444
567 Ga0070662_100222530
568 Ga0070681_10105680
569 Ga0068867_100022638
570 Ga0068867_100118259
571 Ga0068867_100256528
572 Ga0068867_100462012
573 Ga0070679_100277997
574 Ga0070679_101076545
575 Ga0070684_100041133
576 Ga0068853_100075477
577 Ga0068853_100181575
578 Ga0068853_100247779
579 Ga0068853_101611674
580 Ga0070672_100052434
581 Ga0070672_100081694
582 Ga0070686_100043105
583 Ga0070686_100315819
584 Ga0070696_100066610
585 Ga0070696_100496297
586 Ga0070665_100554358
587 Ga0070665_100733976
588 Ga0068855_100184482
589 Ga0068855_100217912
590 Ga0068855_100524320
591 Ga0068855_101168644
592 Ga0070664_100020701
593 Ga0070664_100048226
594 Ga0070664_100049532
595 Ga0070664_100067543
596 Ga0070664_100162657
597 Ga0070664_100166320
598 Ga0070664_100226138
599 Ga0070664_101003266
600 Ga0068857_100017571
601 Ga0068857_100018744
602 Ga0068857_100070650
603 Ga0068857_100088322
604 Ga0068857_100509821
605 Ga0068857_100556997
606 Ga0068857_100757586
607 Ga0068854_100004852
608 Ga0068856_100021127
609 Ga0068856_100063451
610 Ga0068856_100210547
611 Ga0068856_100298737
612 Ga0068856_101616242
613 Ga0068852_100004326
614 Ga0068852_100014270
615 Ga0068852_100119142
616 Ga0068852_100124108
617 Ga0068852_100423328
618 Ga0068852_100427991
619 Ga0068852_101254816
620 Ga0068859_100027869
621 Ga0068859_100056691
622 Ga0068859_100152643
623 Ga0068859_100676763
624 Ga0068864_100008895
625 Ga0068864_100031435
626 Ga0068864_100053876
627 Ga0068866_10004364
628 Ga0068866_10737870
629 Ga0068851_10066720
630 Ga0068851_10073104
631 Ga0068851_10170834
632 Ga0068851_10247490
633 Ga0068863_100012099
634 Ga0068863_100015195
635 Ga0068863_100035258
636 Ga0068858_100029542
637 Ga0068858_100123808
638 Ga0068860_100035919
639 Ga0068860_100092748
640 Ga0068860_101450693
641 Ga0068862_100009029
642 Ga0070716_100219354
643 Ga0070712_100615899
644 Ga0097621_100133110
645 Ga0068871_100019700
646 Ga0068871_100077926
647 Ga0068871_100232846
648 Ga0068865_100123461
649 Ga0068865_100137898
650 Ga0097620_100027868
651 Ga0097620_100056691
652 Ga0097620_100152659
653 Ga0097620_100676819
654 Ga0105240_10119034
655 Ga0105245_10007438
656 Ga0105243_10839650
657 Ga0105241_11329691
658 Ga0105242_10014499
659 Ga0105248_10057377
660 Ga0105237_10137152
661 Ga0105238_10668367
662 Ga0105249_10034805
663 Ga0105239_10109343
664 Ga0105239_10824480
665 Ga0105246_11054911
666 Ga0157373_10029127
667 Ga0157373_10081058
668 Ga0157373_10114579
669 Ga0157373_10176759
670 Ga0157373_10490026
671 Ga0157371_10059882
672 Ga0157371_10099651
673 Ga0157371_10227254
674 Ga0157371_10296998
675 Ga0157371_10636226
676 Ga0157370_10035588
677 Ga0157370_10489426
678 Ga0157370_10494759
679 Ga0157369_10000141
680 Ga0157369_10105449
681 Ga0157369_10280453
682 Ga0157369_10315068
683 Ga0157369_10376698
684 Ga0157374_10564287
685 Ga0157378_11240102
686 Ga0163162_10170616
687 Ga0163162_11575756
688 Ga0157372_10693056
689 Ga0157372_10774033
690 Ga0157375_10177145
691 Ga0157375_11172342
692 Ga0163163_10020793
693 Ga0182008_10032106
694 Ga0157379_10003380
695 Ga0157376_10268925
696 Ga0207697_10024758
697 Ga0207697_10052251
698 Ga0207656_10218585
699 Ga0207656_10274502
700 Ga0207680_10281144
701 Ga0207647_10003288
702 Ga0207647_10030196
703 Ga0207647_10148801
704 Ga0207647_10221556
705 Ga0207699_10144170
706 Ga0207645_10004643
707 Ga0207645_10113470
708 Ga0207645_10172706
709 Ga0207705_10012438
710 Ga0207705_10055501
711 Ga0207705_10143576
712 Ga0207705_10247670
713 Ga0207654_10940041
714 Ga0207707_10175924
715 Ga0207707_11037847
716 Ga0207695_10025087
717 Ga0207693_10225356
718 Ga0207660_10893375
719 Ga0207660_10925525
720 Ga0207662_10108623
721 Ga0207657_10003240
722 Ga0207657_10017023
723 Ga0207657_10057576
724 Ga0207657_10057702
725 Ga0207657_10516131
726 Ga0207649_10179187
727 Ga0207649_10207945
728 Ga0207649_10664212
729 Ga0207652_10132989
730 Ga0207652_10242606
731 Ga0207681_10042183
732 Ga0207681_10105014
733 Ga0207650_10040281
734 Ga0207650_10185839
735 Ga0207650_10251967
736 Ga0207659_10568662
737 Ga0207687_10131872
738 Ga0207700_10082847
739 Ga0207664_10405393
740 Ga0207644_10009330
741 Ga0207644_10031946
742 Ga0207690_10067943
743 Ga0207690_10100281
744 Ga0207690_10105081
745 Ga0207690_10955016
746 Ga0207706_10005019
747 Ga0207706_10164872
748 Ga0207706_10179212
749 Ga0207706_10209089
750 Ga0207706_10403147
751 Ga0207706_10485101
752 Ga0207686_10259592
753 Ga0207669_10071171
754 Ga0207669_10160281
755 Ga0207704_10025212
756 Ga0207704_10089598
757 Ga0207691_10003509
758 Ga0207691_10077676
759 Ga0207711_10005792
760 Ga0207711_10105428
761 Ga0207711_10648806
762 Ga0207689_10089745
763 Ga0207689_10116840
764 Ga0207689_10294630
765 Ga0207661_10035813
766 Ga0207661_10040988
767 Ga0207679_10000876
768 Ga0207679_10025802
769 Ga0207679_10079995
770 Ga0207679_10099556
771 Ga0207679_11247268
772 Ga0207667_10006957
773 Ga0207667_10075111
774 Ga0207667_10134369
775 Ga0207651_10017117
776 Ga0207651_10025604
777 Ga0207651_10395678
778 Ga0207651_10716453
779 Ga0207668_10000417
780 Ga0207640_10005308
781 Ga0207658_10008028
782 Ga0207658_10040890
783 Ga0207658_10166539
784 Ga0207677_10018183
785 Ga0207677_10304520
786 Ga0207677_10527848
787 Ga0207703_10031928
788 Ga0207703_10110472
789 Ga0207703_10161210
790 Ga0207639_10027246
791 Ga0207639_10046715
792 Ga0207639_10143407
793 Ga0207639_10268206
794 Ga0207639_11251258
795 Ga0207678_10009020
796 Ga0207678_10009736
797 Ga0207678_10019855
798 Ga0207678_10290115
799 Ga0207702_10004836
800 Ga0207702_10006382
801 Ga0207702_10006660
802 Ga0207702_10268518
803 Ga0207702_10468670
804 Ga0207702_11152855
805 Ga0207641_10025327
806 Ga0207641_10055972
807 Ga0207641_10073202
808 Ga0207648_10002532
809 Ga0207648_10004072
810 Ga0207648_10454592
811 Ga0207676_10007368
812 Ga0207676_10017996
813 Ga0207676_10051099
814 Ga0207676_10475398
815 Ga0207674_10000344
816 Ga0207674_10004400
817 Ga0207674_10036750
818 Ga0207674_10062213
819 Ga0207674_10065310
820 Ga0207674_10121755
821 Ga0207683_10001784
822 Ga0207698_10016729
823 Ga0207698_10042310
824 Ga0207698_10104458
825 Ga0207698_10373533
826 Ga0207698_10734177
827 Ga0268266_10160625
828 Ga0268265_10021618
829 Ga0268264_10013746
830 Ga0268264_10144919
831 Ga0307413_10007321
832 Ga0307410_10006962
833 Ga0307410_10102735
834 Ga0307406_10011585
835 Ga0307406_10200212
836 Ga0307406_10625676
837 Ga0307407_10014873
838 Ga0307412_10012265
839 Ga0307412_10096538
840 Ga0307409_100001864
841 Ga0307416_100029242
842 Ga0307416_100945366
843 Ga0307414_10032857
844 Ga0307411_10030747
845 Ga0307415_100011783
846 Ga0373940_0020031
847 Ga0373931_0130747
848 Ga0395899_0010963
849 Ga0395899_0039330
850 Ga0395899_0045110
851 Ga0395899_0133587
852 Ga0395899_0143032
853 Ga0395899_0248604
854 Ga0395900_0021186
855 Ga0395900_0048858
856 Ga0395900_0051750
857 Ga0395900_0065268
858 Ga0395900_0098775
859 Ga0395900_0232026
860 Ga0395900_0393584
861 Ga0395900_0401312
862 Ga0395900_0436430
863 Ga0395900_0473131
864 Ga0395898_0009249
865 Ga0395898_0011538
866 Ga0395898_0024906
867 Ga0395898_0042581
868 Ga0395898_1040317
869 Ga0395905_0017567
870 Ga0395905_0018988
871 Ga0395905_0100371
872 Ga0395905_0131565
873 Ga0395905_0185420
874 Ga0395905_0561578
875 Ga0395905_0647564
876 Ga0395901_0011742
877 Ga0395901_0021993
878 Ga0395901_0065506
879 Ga0395901_0087378
880 Ga0395901_0105181
881 Ga0395901_0149987
882 Ga0395901_0224755
883 Ga0395901_0493195
884 Ga0395901_0880020
885 Ga0395901_0945639
886 Ga0395901_1054253
887 Ga0395901_1252017
888 Ga0395901_1349681
889 Ga0439448_0090150
890 Ga0439432_014661
891 Ga0439449_0037702
892 Ga0439458_0005141
893 Ga0466969_0138140
894 Ga0466969_0162382
895 Ga0466972_0044488
896 Ga0466972_0144469
897 Ga0466965_0068171
898 Ga0466966_0028684
899 Ga0466966_0068888
900 Ga0466966_0142796
901 Ga0466966_0378505
902 Ga0466961_0012986
903 Ga0466961_0038374
904 Ga0466961_0050864
905 Ga0466961_0094768
906 Ga0466963_0033707
907 Ga0466963_0163438
908 Ga0466964_0010242
909 Ga0466971_0018981
910 Ga0466971_0035985
911 Ga0466968_0110391
912 Ga0466970_0031811
913 Ga0466970_0041978
914 Ga0466970_0132785
915 Ga0466970_0282728
916 Ga0466957_0089162
917 Ga0466960_0018633
918 Ga0466960_0045138
919 Ga0466960_0225006
920 Ga0466959_0005664
921 Ga0466959_0064017
922 Ga0466959_0157507
923 Ga0466959_0195824
924 Ga0466958_0117988
925 Ga0466958_0213416
926 Ga0466967_0194035
927 Ga0466967_0410368
928 Ga0466967_0449965
929 Ga0495669_0324681
930 Ga0495677_0001983
931 Ga0496101_0091755
932 Ga0496102_0134370
933 Ga0496103_0022162
934 Ga0496104_0090115
935 Ga0496104_0117649
936 Ga0496104_0620660
937 Ga0496105_0026106
938 Ga0496105_0076090
939 Ga0496105_0182934
940 Ga0496106_0041699
941 Ga0496106_0148391
942 Ga0496107_0013979
943 Ga0496107_0032036
944 Ga0496108_0021445
945 Ga0496109_0023995
946 Ga0496109_0040087
947 Ga0496109_0374169
948 Ga0496109_0888270
949 Ga0496110_0034196
950 Ga0496110_0150183
951 Ga0496111_0041717
952 Ga0496111_0109345
953 Ga0496111_0142313
954 Ga0496112_0035997
955 Ga0496112_0060443
956 Ga0496113_0006362
957 Ga0496113_0040986
958 Ga0496113_0087737
959 Ga0496121_0091246
960 Ga0501199_014795
961 Ga0501201_020608
962 Ga0501227_104832
963 Ga0501233_010615
964 Ga0501235_016438
965 Ga0501257_052589
966 Ga0501221_026501
967 Ga0501225_0058755
968 Ga0501245_101088
969 Ga0501241_069016
970 Ga0501262_002582
971 Ga0501268_006023
972 Ga0501271_003028
973 Ga0466962_0005348
974 Ga0466962_0044778
975 Ga0466962_0314730

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08327

AHSA1

Activator of Hsp90 ATPase homolog 1-like protein

27

158

0.81

PF10604

Polyketide_cyc2

Polyketide cyclase / dehydrase and lipid transport

17

160

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
2k5g-assembly1.cif.gz_A solution nmr structure of protein encoded by gene bpp1335 from bordetella parapertussis: northeast structural genomics target bpr195 0.8077 14 179
3q6a-assembly1.cif.gz_A x-ray crystal structure of the protein ssp2350 from staphylococcus saprophyticus, northeast structural genomics consortium target syr116 0.8031 19 161
3q6a-assembly1.cif.gz_D x-ray crystal structure of the protein ssp2350 from staphylococcus saprophyticus, northeast structural genomics consortium target syr116 0.8006 19 161
6v04-assembly1.cif.gz_A dynu16 crystal structure, a putative protein in the dynemicin biosynthetic locus 0.7908 16 160
2m89-assembly1.cif.gz_B solution structure of the aha1 dimer from colwellia psychrerythraea 0.7818 19 156
ID Description Score Start End Superfamily
2k5gA01 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8077 14 179 3.30.530.20
af_Q8BK64_207_336_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8014 19 158 3.30.530.20
af_Q8N9S3_197_326_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.7959 19 157 3.30.530.20
af_Q9V9Q4_218_347_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.7951 19 158 3.30.530.20
3q6aA00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.7864 21 161 3.30.530.20
ID Description Score Start End GO Terms
AF-A0A318BG46-F1-model_v4 deleted 0.9728 12 178
AF-A0A7G5Z911-F1-model_v4 SRPBCC family protein 0.9722 11 180
AF-A0A4Q5TGW0-F1-model_v4 ATPase 0.9691 61 180
AF-A0A397ND35-F1-model_v4 Uncharacterized protein YndB with AHSA1/START domain 0.9617 18 175
AF-A0A7G5Z911-F1-model_v4 SRPBCC family protein 0.9557 11 180

Map