F453489

General Info

Members Datasets Scaffolds Average Seq Length
487 253 974 110

Family's Representative Sequence

Representative Sequence 3300046461|Ga0495641_0086445|Ga0495641_0086445_487_846
Length 119
Sequence MDVEEALSLSQFEGLPSMRWSLTGLNEEGDETWLIRGIARKLYHCPGCHGDIPVGEEHTVVQYVRRLGGTDHHHWHRRCAEELLLPELGNLKRVPASESSQSRLEERGRRPSGRRDRRR

Samples

Sample ID Description Type Environment
1 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
47 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
48 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
49 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
53 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
60 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
66 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
67 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
68 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
69 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
70 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
71 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
77 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
80 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
128 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
129 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
130 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
131 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
132 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
133 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
134 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
135 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
136 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
137 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
138 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
139 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
140 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
141 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
142 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
143 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
144 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
145 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
146 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
147 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
148 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
149 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
150 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
151 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
152 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
153 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
154 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
155 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
156 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
157 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
158 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
159 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
160 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
161 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
162 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
163 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
164 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
165 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
166 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
167 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
168 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
169 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
170 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
171 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
172 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
173 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
174 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
175 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
176 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
177 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
178 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
179 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
180 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
181 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
182 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
183 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
184 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
185 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
186 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
187 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
188 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
189 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
190 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
191 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
192 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
193 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
194 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
195 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
196 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
197 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
198 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
199 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
200 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
201 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
202 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
203 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
204 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
205 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
206 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
207 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
208 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
209 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
224 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
225 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
226 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
227 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
228 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
229 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
230 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
231 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
232 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
233 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
234 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
235 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
236 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
237 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
240 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
241 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
242 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
243 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
244 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
245 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
246 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
247 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
248 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
249 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
250 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
251 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
252 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
253 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.59
Metatranscriptomes 0.41
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.82
Nodule 0
Rhizoplane 11.09
Rhizosphere 81.52
Stem 0
Stem Tuber 0
Unclassified 11.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495641_0086445 3300046461 Bacteria 1403
2 JGI24740J21852_10004506 3300001979 Bacteria 5997
3 Ga0070683_100000835 3300005329 Bacteria 22828
4 Ga0070683_100003886 3300005329 Bacteria 12223
5 Ga0070690_100438449 3300005330 Bacteria 966
6 Ga0070666_10040741 3300005335 Bacteria 3101
7 Ga0070666_10067311 3300005335 Bacteria 2432
8 Ga0070682_100000011 3300005337 Bacteria 266253
9 Ga0068868_100004956 3300005338 Bacteria 9351
10 Ga0070689_100128119 3300005340 Bacteria 2033
11 Ga0070691_10000138 3300005341 Bacteria 22836
12 Ga0070691_10756793 3300005341 Bacteria 588
13 Ga0070661_100000058 3300005344 Bacteria 87363
14 Ga0070661_100758942 3300005344 Bacteria 794
15 Ga0070692_10036350 3300005345 Bacteria 2499
16 Ga0070692_10689195 3300005345 Bacteria 686
17 Ga0070668_100089709 3300005347 Bacteria 2422
18 Ga0070668_100120668 3300005347 Bacteria 2095
19 Ga0070668_102019466 3300005347 Unclassified 532
20 Ga0070675_100000036 3300005354 Bacteria 85959
21 Ga0070671_100343162 3300005355 Bacteria 1274
22 Ga0070673_100472745 3300005364 Bacteria 1130
23 Ga0070688_100000171 3300005365 Bacteria 34942
24 Ga0070688_100000360 3300005365 Bacteria 23047
25 Ga0070667_100001076 3300005367 Bacteria 24988
26 Ga0070667_100006751 3300005367 Bacteria 9531
27 Ga0070667_100045073 3300005367 Bacteria 3707
28 Ga0070667_100102665 3300005367 Bacteria 2471
29 Ga0070667_100683926 3300005367 Unclassified 948
30 Ga0070709_11345480 3300005434 Unclassified 577
31 Ga0070714_100094095 3300005435 Bacteria 2630
32 Ga0070714_100566936 3300005435 Unclassified 1088
33 Ga0070714_102312655 3300005435 Unclassified 523
34 Ga0070713_100000047 3300005436 Bacteria 76760
35 Ga0070713_100039662 3300005436 Bacteria 3824
36 Ga0070711_100091636 3300005439 Bacteria 2192
37 Ga0070700_100074280 3300005441 Bacteria 2178
38 Ga0070694_100343819 3300005444 Bacteria 1154
39 Ga0070694_101172337 3300005444 Unclassified 643
40 Ga0070663_100003998 3300005455 Bacteria 8599
41 Ga0070663_100772304 3300005455 Bacteria 822
42 Ga0070681_10621632 3300005458 Bacteria 995
43 Ga0070685_10000019 3300005466 Bacteria 105881
44 Ga0070685_10000020 3300005466 Bacteria 104332
45 Ga0070685_10209781 3300005466 Bacteria 1271
46 Ga0070685_10637005 3300005466 Bacteria 771
47 Ga0070679_100012803 3300005530 Bacteria 8026
48 Ga0070684_100610062 3300005535 Bacteria 1015
49 Ga0070672_100000001 3300005543 Bacteria 204624
50 Ga0070672_101216475 3300005543 Bacteria 671
51 Ga0070695_100322300 3300005545 Unclassified 1149
52 Ga0070693_100926138 3300005547 Unclassified 655
53 Ga0070665_100001462 3300005548 Bacteria 27694
54 Ga0070665_100051392 3300005548 Bacteria 4133
55 Ga0070665_100183823 3300005548 Bacteria 2091
56 Ga0070665_100235741 3300005548 Unclassified 1830
57 Ga0070665_101889954 3300005548 Unclassified 603
58 Ga0070704_100231028 3300005549 Bacteria 1509
59 Ga0068855_100337954 3300005563 Bacteria 1661
60 Ga0070664_100116556 3300005564 Bacteria 2336
61 Ga0068854_100003343 3300005578 Bacteria 9998
62 Ga0068854_101110222 3300005578 Bacteria 705
63 Ga0068856_100003300 3300005614 Bacteria 16401
64 Ga0070702_100020360 3300005615 Bacteria 3474
65 Ga0068852_100000002 3300005616 Bacteria 268221
66 Ga0068852_100044940 3300005616 Bacteria 3754
67 Ga0068866_10065962 3300005718 Bacteria 1895
68 Ga0068861_102063091 3300005719 Bacteria 570
69 Ga0068851_10000730 3300005834 Bacteria 14041
70 Ga0068851_10000911 3300005834 Bacteria 12735
71 Ga0068863_100029512 3300005841 Bacteria 5235
72 Ga0068863_101512984 3300005841 Unclassified 680
73 Ga0068860_100143302 3300005843 Bacteria 2298
74 Ga0068862_100000943 3300005844 Bacteria 28026
75 Ga0068862_100510751 3300005844 Bacteria 1142
76 Ga0081455_10029831 3300005937 Bacteria 4967
77 Ga0081455_10038488 3300005937 Bacteria 4235
78 Ga0081455_10046721 3300005937 Bacteria 3754
79 Ga0081455_10931649 3300005937 Unclassified 539
80 Ga0081540_1000100 3300005983 Bacteria 91640
81 Ga0081539_10002227 3300005985 Bacteria 28283
82 Ga0070712_100007821 3300006175 Bacteria 6695
83 Ga0097621_102405544 3300006237 Bacteria 504
84 Ga0068871_100301341 3300006358 Bacteria 1407
85 Ga0075430_100125903 3300006846 Bacteria 2136
86 Ga0075433_10000421 3300006852 Bacteria 27102
87 Ga0068865_100000013 3300006881 Bacteria 141352
88 Ga0105240_11019158 3300009093 Unclassified 884
89 Ga0105245_10000125 3300009098 Bacteria 73764
90 Ga0105245_10052008 3300009098 Bacteria 3673
91 Ga0105247_10001978 3300009101 Bacteria 14224
92 Ga0105247_10134859 3300009101 Bacteria 1612
93 Ga0105243_10024723 3300009148 Bacteria 4584
94 Ga0105241_10065255 3300009174 Bacteria 2813
95 Ga0105242_10000117 3300009176 Bacteria 57885
96 Ga0105242_10000931 3300009176 Bacteria 22774
97 Ga0105242_12072945 3300009176 Bacteria 612
98 Ga0105248_10000020 3300009177 Bacteria 284637
99 Ga0105237_11807037 3300009545 Unclassified 619
100 Ga0105249_10003509 3300009553 Bacteria 13564
101 Ga0105249_10311451 3300009553 Bacteria 1583
102 Ga0105239_10515909 3300010375 Bacteria 1359
103 Ga0105239_10819182 3300010375 Bacteria 1067
104 Ga0105239_12347614 3300010375 Bacteria 621
105 Ga0105246_12261120 3300011119 Unclassified 530
106 Ga0157373_11248404 3300013100 Bacteria 561
107 Ga0157371_10043297 3300013102 Bacteria 3207
108 Ga0157370_10002971 3300013104 Bacteria 20162
109 Ga0157370_10580794 3300013104 Bacteria 1027
110 Ga0157369_10000307 3300013105 Bacteria 65486
111 Ga0157369_10796624 3300013105 Bacteria 971
112 Ga0157369_12215560 3300013105 Unclassified 557
113 Ga0157374_10671340 3300013296 Bacteria 1049
114 Ga0157374_12755937 3300013296 Unclassified 519
115 Ga0157378_10003176 3300013297 Bacteria 14588
116 Ga0157378_10031397 3300013297 Bacteria 4693
117 Ga0157378_10118701 3300013297 Bacteria 2435
118 Ga0163162_13467411 3300013306 Bacteria 502
119 Ga0157372_10000053 3300013307 Bacteria 128824
120 Ga0157372_10658337 3300013307 Bacteria 1219
121 Ga0157375_10001535 3300013308 Bacteria 19883
122 Ga0157375_10324303 3300013308 Bacteria 1705
123 Ga0157375_12133748 3300013308 Unclassified 667
124 Ga0163163_13212907 3300014325 Unclassified 510
125 Ga0163163_13236525 3300014325 Unclassified 508
126 Ga0157380_10000016 3300014326 Bacteria 126029
127 Ga0157380_10244106 3300014326 Bacteria 1621
128 Ga0157380_10444701 3300014326 Unclassified 1243
129 Ga0157377_11032762 3300014745 Bacteria 625
130 Ga0157379_10011155 3300014968 Bacteria 7832
131 Ga0157379_11384530 3300014968 Bacteria 681
132 Ga0157376_10022880 3300014969 Bacteria 4880
133 Ga0157376_10056914 3300014969 Bacteria 3269
134 Ga0206356_11093252 3300020070 Bacteria 1017
135 Ga0224712_10555524 3300022467 Unclassified 558
136 Ga0207656_10000211 3300025321 Bacteria 20768
137 Ga0207656_10004794 3300025321 Bacteria 4747
138 Ga0207642_10046848 3300025899 Bacteria 1929
139 Ga0207710_10000821 3300025900 Bacteria 16775
140 Ga0207710_10080177 3300025900 Bacteria 1513
141 Ga0207680_10036448 3300025903 Bacteria 2833
142 Ga0207680_10080560 3300025903 Bacteria 2045
143 Ga0207699_10547634 3300025906 Bacteria 839
144 Ga0207654_10047296 3300025911 Bacteria 2457
145 Ga0207707_10095334 3300025912 Bacteria 2600
146 Ga0207695_10705369 3300025913 Bacteria 889
147 Ga0207671_10394191 3300025914 Bacteria 1101
148 Ga0207671_10588962 3300025914 Unclassified 886
149 Ga0207693_10049045 3300025915 Bacteria 3316
150 Ga0207663_10062835 3300025916 Bacteria 2362
151 Ga0207649_10000283 3300025920 Bacteria 39628
152 Ga0207649_10690246 3300025920 Bacteria 791
153 Ga0207652_10008840 3300025921 Bacteria 8115
154 Ga0207694_10860681 3300025924 Bacteria 766
155 Ga0207659_10000013 3300025926 Bacteria 172742
156 Ga0207687_10000017 3300025927 Bacteria 237310
157 Ga0207687_10030407 3300025927 Bacteria 3641
158 Ga0207700_10000033 3300025928 Bacteria 123113
159 Ga0207664_10102186 3300025929 Bacteria 2370
160 Ga0207664_10859952 3300025929 Unclassified 815
161 Ga0207664_11498908 3300025929 Bacteria 596
162 Ga0207644_10923133 3300025931 Bacteria 732
163 Ga0207686_10000254 3300025934 Bacteria 40780
164 Ga0207686_10002477 3300025934 Bacteria 10029
165 Ga0207686_11230270 3300025934 Bacteria 613
166 Ga0207709_10006143 3300025935 Bacteria 6765
167 Ga0207670_10098140 3300025936 Bacteria 2087
168 Ga0207669_10068491 3300025937 Bacteria 2217
169 Ga0207669_10334328 3300025937 Bacteria 1164
170 Ga0207704_10000040 3300025938 Bacteria 90178
171 Ga0207704_10384276 3300025938 Bacteria 1103
172 Ga0207691_10000017 3300025940 Bacteria 134441
173 Ga0207711_10000006 3300025941 Bacteria 792692
174 Ga0207661_10000198 3300025944 Bacteria 39018
175 Ga0207661_10002675 3300025944 Bacteria 12265
176 Ga0207679_10071973 3300025945 Bacteria 2610
177 Ga0207679_10093327 3300025945 Bacteria 2334
178 Ga0207667_10104473 3300025949 Bacteria 2922
179 Ga0207667_10781886 3300025949 Bacteria 952
180 Ga0207651_10607967 3300025960 Bacteria 956
181 Ga0207712_10011490 3300025961 Bacteria 5642
182 Ga0207668_10031903 3300025972 Bacteria 3475
183 Ga0207668_10099769 3300025972 Bacteria 2155
184 Ga0207640_10000370 3300025981 Bacteria 29030
185 Ga0207658_10003877 3300025986 Bacteria 10532
186 Ga0207658_10087929 3300025986 Bacteria 2400
187 Ga0207658_10104027 3300025986 Bacteria 2230
188 Ga0207658_10182475 3300025986 Bacteria 1738
189 Ga0207677_10002708 3300026023 Bacteria 9342
190 Ga0207639_10118502 3300026041 Bacteria 2171
191 Ga0207678_10047722 3300026067 Bacteria 3702
192 Ga0207708_10201180 3300026075 Bacteria 1589
193 Ga0207702_10002446 3300026078 Bacteria 17589
194 Ga0207702_10706766 3300026078 Bacteria 993
195 Ga0207702_11390603 3300026078 Bacteria 696
196 Ga0207641_10043814 3300026088 Bacteria 3760
197 Ga0207641_10351086 3300026088 Bacteria 1406
198 Ga0207641_10425831 3300026088 Bacteria 1279
199 Ga0207641_11447646 3300026088 Unclassified 688
200 Ga0207674_11121611 3300026116 Bacteria 756
201 Ga0207698_10000004 3300026142 Bacteria 313614
202 Ga0207698_10038394 3300026142 Bacteria 3538
203 Ga0268266_10000601 3300028379 Bacteria 49250
204 Ga0268266_10001254 3300028379 Bacteria 31003
205 Ga0268266_10026262 3300028379 Bacteria 4956
206 Ga0268266_10161379 3300028379 Bacteria 2028
207 Ga0268266_10314156 3300028379 Unclassified 1465
208 Ga0268266_10737825 3300028379 Unclassified 950
209 Ga0268266_11109158 3300028379 Bacteria 765
210 Ga0268266_11461450 3300028379 Unclassified 659
211 Ga0268265_10004453 3300028380 Bacteria 9721
212 Ga0268265_11319361 3300028380 Bacteria 722
213 Ga0268264_10464896 3300028381 Bacteria 1228
214 Ga0268264_10511974 3300028381 Bacteria 1172
215 Ga0265319_1000014 3300028563 Bacteria 177623
216 Ga0265334_10047765 3300028573 Bacteria 1650
217 Ga0265338_10000244 3300028800 Bacteria 100528
218 Ga0265324_10045813 3300029957 Bacteria 1506
219 Ga0265313_10239623 3300031595 Bacteria 743
220 Ga0307416_101430708 3300032002 Unclassified 797
221 Ga0307415_100240361 3300032126 Bacteria 1464
222 Ga0316583_10046322 3300032133 Bacteria 1535
223 Ga0373955_0437768 3300035172 Unclassified 796
224 Ga0373937_0734533 3300036401 Bacteria 934
225 Ga0316582_0605817 3300036647 Bacteria 754
226 Ga0451800_0374107 3300041459 Unclassified 671
227 Ga0451802_1290304 3300041460 Unclassified 548
228 Ga0451807_1434009 3300041486 Bacteria 1428
229 Ga0451807_1892530 3300041486 Bacteria 546
230 Ga0451835_0389310 3300041492 Bacteria 578
231 Ga0451849_0058156 3300041505 Unclassified 754
232 Ga0451849_1214696 3300041505 Unclassified 1660
233 Ga0451853_1746024 3300041512 Bacteria 935
234 Ga0466963_0523116 3300044694 Bacteria 838
235 Ga0466967_0000001 3300045976 Bacteria 229823
236 Ga0466967_0175529 3300045976 Bacteria 2019
237 Ga0466967_1714654 3300045976 Unclassified 626
238 Ga0495592_0371965 3300046454 Bacteria 911
239 Ga0495592_0425435 3300046454 Bacteria 837
240 Ga0495629_0000260 3300046459 Bacteria 46062
241 Ga0495629_0000487 3300046459 Bacteria 33176
242 Ga0495629_0010874 3300046459 Bacteria 6617
243 Ga0495638_0029338 3300046460 Bacteria 3547
244 Ga0495641_0023225 3300046461 Bacteria 3086
245 Ga0495641_0088313 3300046461 Bacteria 1387
246 Ga0495651_0076881 3300046462 Bacteria 2528
247 Ga0495651_0100543 3300046462 Bacteria 2154
248 Ga0495651_0185936 3300046462 Bacteria 1466
249 Ga0495653_0270457 3300046463 Bacteria 1119
250 Ga0495662_0013837 3300046476 Bacteria 3926
251 Ga0495664_0184458 3300046477 Unclassified 1265
252 Ga0495664_0681916 3300046477 Unclassified 608
253 Ga0495594_0000089 3300046499 Bacteria 41876
254 Ga0495606_0000040 3300046507 Bacteria 223500
255 Ga0495608_0000007 3300046511 Bacteria 313495
256 Ga0495608_0549812 3300046511 Bacteria 696
257 Ga0495618_0150995 3300046514 Bacteria 1484
258 Ga0495618_0161212 3300046514 Bacteria 1430
259 Ga0495628_0000859 3300046516 Bacteria 28076
260 Ga0495628_0123737 3300046516 Bacteria 1982
261 Ga0495630_0000014 3300046517 Bacteria 217229
262 Ga0495630_0000256 3300046517 Bacteria 42987
263 Ga0495630_0054889 3300046517 Bacteria 2985
264 Ga0495630_0333418 3300046517 Bacteria 1160
265 Ga0495652_0000010 3300046529 Bacteria 261584
266 Ga0495652_0003765 3300046529 Bacteria 14828
267 Ga0495640_0363851 3300046533 Bacteria 891
268 Ga0495587_0000618 3300046536 Bacteria 24150
269 Ga0495587_0128483 3300046536 Unclassified 1449
270 Ga0495587_0181367 3300046536 Bacteria 1194
271 Ga0495587_0511353 3300046536 Bacteria 664
272 Ga0495587_0656834 3300046536 Bacteria 576
273 Ga0495645_0223416 3300046543 Bacteria 1265
274 Ga0495645_0252907 3300046543 Bacteria 1170
275 Ga0495622_0000218 3300046557 Bacteria 45469
276 Ga0495667_0000020 3300046559 Bacteria 180876
277 Ga0495667_0282586 3300046559 Bacteria 1053
278 Ga0495634_0002567 3300046642 Bacteria 14991
279 Ga0495634_0017341 3300046642 Bacteria 5141
280 Ga0495634_0061993 3300046642 Bacteria 2484
281 Ga0495625_0000688 3300046660 Bacteria 48233
282 Ga0495635_0386765 3300046663 Bacteria 930
283 Ga0495588_0000338 3300046674 Bacteria 30480
284 Ga0495657_0000001 3300046675 Bacteria 445641
285 Ga0495657_0176745 3300046675 Bacteria 1312
286 Ga0495647_0001982 3300046681 Bacteria 6392
287 Ga0495647_0200061 3300046681 Bacteria 876
288 Ga0495658_0003808 3300046683 Bacteria 7472
289 Ga0495658_0117560 3300046683 Unclassified 1605
290 Ga0495613_0000041 3300046689 Bacteria 130784
291 Ga0495624_0000671 3300046690 Bacteria 26768
292 Ga0495604_0000239 3300047317 Bacteria 49113
293 Ga0495604_0105915 3300047317 Bacteria 2057
294 Ga0495674_0002248 3300047319 Bacteria 18976
295 Ga0495672_0214273 3300047320 Bacteria 955
296 Ga0495672_0214623 3300047320 Bacteria 953
297 Ga0495676_0001364 3300047321 Bacteria 21008
298 Ga0495676_0137244 3300047321 Bacteria 1757
299 Ga0495676_0397158 3300047321 Bacteria 915
300 Ga0495676_0852702 3300047321 Unclassified 585
301 Ga0495680_0002541 3300047322 Bacteria 18636
302 Ga0495680_0126650 3300047322 Bacteria 1880
303 Ga0495675_0000300 3300047444 Bacteria 35530
304 Ga0495675_0298925 3300047444 Unclassified 956
305 Ga0495684_0185521 3300047471 Bacteria 1540
306 Ga0495684_0301749 3300047471 Bacteria 1150
307 Ga0495684_0323656 3300047471 Bacteria 1102
308 Ga0495684_0540874 3300047471 Bacteria 795
309 Ga0495686_0090480 3300047472 Bacteria 1858
310 Ga0495593_0072470 3300047673 Bacteria 1788
311 Ga0495593_0111770 3300047673 Bacteria 1395
312 Ga0495602_0000007 3300048088 Bacteria 273212
313 Ga0495602_0000611 3300048088 Bacteria 33553
314 Ga0495602_0267802 3300048088 Bacteria 1264
315 Ga0495602_0761977 3300048088 Bacteria 652
316 Ga0495602_1149475 3300048088 Unclassified 507
317 Ga0496100_0000001 3300048903 Bacteria 530179
318 Ga0496101_0000004 3300048904 Bacteria 331599
319 Ga0496101_0829407 3300048904 Bacteria 729
320 Ga0496102_0000294 3300048905 Bacteria 64001
321 Ga0496102_0061178 3300048905 Bacteria 3445
322 Ga0496102_0370462 3300048905 Bacteria 1348
323 Ga0496102_0677577 3300048905 Bacteria 954
324 Ga0496103_0000159 3300048906 Bacteria 71148
325 Ga0496103_0209260 3300048906 Bacteria 1254
326 Ga0496103_0982565 3300048906 Unclassified 526
327 Ga0496104_0000015 3300048907 Bacteria 374530
328 Ga0496104_0000765 3300048907 Bacteria 27516
329 Ga0496104_0033800 3300048907 Bacteria 4766
330 Ga0496104_0039152 3300048907 Bacteria 4438
331 Ga0496104_0491021 3300048907 Bacteria 1139
332 Ga0496105_0000004 3300048908 Bacteria 475798
333 Ga0496105_0007927 3300048908 Bacteria 8252
334 Ga0496105_0063371 3300048908 Bacteria 3050
335 Ga0496105_0618973 3300048908 Unclassified 838
336 Ga0496105_0909849 3300048908 Bacteria 663
337 Ga0496106_0000056 3300048909 Bacteria 90682
338 Ga0496106_0738163 3300048909 Unclassified 783
339 Ga0496107_0000005 3300048910 Bacteria 281747
340 Ga0496107_0022168 3300048910 Bacteria 4488
341 Ga0496108_0000063 3300048911 Bacteria 118950
342 Ga0496108_0004943 3300048911 Bacteria 10771
343 Ga0496109_0000012 3300048912 Bacteria 229699
344 Ga0496109_0000173 3300048912 Bacteria 63867
345 Ga0496109_0586198 3300048912 Unclassified 1051
346 Ga0496109_0749907 3300048912 Bacteria 914
347 Ga0496109_1182980 3300048912 Unclassified 701
348 Ga0496110_0002711 3300048913 Bacteria 13381
349 Ga0496110_0089639 3300048913 Bacteria 2749
350 Ga0496110_0442927 3300048913 Bacteria 1184
351 Ga0496110_1829347 3300048913 Bacteria 517
352 Ga0496111_0000035 3300048914 Bacteria 54459
353 Ga0496111_0320516 3300048914 Bacteria 1148
354 Ga0496111_0428058 3300048914 Bacteria 977
355 Ga0496112_1064189 3300048915 Unclassified 728
356 Ga0496113_0000026 3300048916 Bacteria 63999
357 Ga0496113_0101237 3300048916 Bacteria 2233
358 Ga0496113_0452755 3300048916 Bacteria 1031
359 Ga0496113_1089310 3300048916 Bacteria 627
360 Ga0496114_0000039 3300048917 Bacteria 138486
361 Ga0496114_0092100 3300048917 Bacteria 2575
362 Ga0496114_0520470 3300048917 Unclassified 1052
363 Ga0496114_0862453 3300048917 Bacteria 786
364 Ga0496115_0000011 3300048918 Bacteria 222529
365 Ga0496115_0003457 3300048918 Bacteria 11348
366 Ga0496115_0014195 3300048918 Bacteria 6026
367 Ga0496116_0000331 3300048919 Bacteria 76536
368 Ga0496117_0036733 3300048920 Bacteria 3661
369 Ga0496117_0348858 3300048920 Bacteria 765
370 Ga0496118_0003934 3300048921 Bacteria 18170
371 Ga0496118_0217295 3300048921 Bacteria 1116
372 Ga0496118_0221043 3300048921 Bacteria 1102
373 Ga0496119_0002281 3300048922 Bacteria 21246
374 Ga0496119_0005810 3300048922 Bacteria 11668
375 Ga0496119_0008997 3300048922 Bacteria 8667
376 Ga0496119_0060355 3300048922 Bacteria 2271
377 Ga0496120_0001336 3300048923 Bacteria 30395
378 Ga0496120_0133608 3300048923 Bacteria 1268
379 Ga0496120_0401930 3300048923 Bacteria 605
380 Ga0496121_0036049 3300048924 Bacteria 4416
381 Ga0496121_0052194 3300048924 Bacteria 3436
382 Ga0496121_0142675 3300048924 Bacteria 1774
383 Ga0496121_0247902 3300048924 Bacteria 1237
384 Ga0496121_0758154 3300048924 Unclassified 576
385 Ga0496124_0235077 3300048927 Unclassified 1367
386 Ga0496124_0988472 3300048927 Unclassified 502
387 Ga0496125_0056943 3300048928 Bacteria 3170
388 Ga0496125_0071876 3300048928 Bacteria 2700
389 Ga0496126_0248123 3300048929 Bacteria 1484
390 Ga0496126_0529883 3300048929 Bacteria 937
391 Ga0496126_0548679 3300048929 Bacteria 917
392 Ga0496126_0702768 3300048929 Bacteria 785
393 Ga0496126_0728322 3300048929 Bacteria 768
394 Ga0496126_0835098 3300048929 Bacteria 704
395 Ga0501031_0000188 3300049568 Bacteria 34790
396 Ga0501031_0376171 3300049568 Bacteria 919
397 Ga0501032_0001031 3300049569 Bacteria 22377
398 Ga0501032_0256976 3300049569 Unclassified 1133
399 Ga0501032_0457125 3300049569 Bacteria 818
400 Ga0501033_0000554 3300049570 Bacteria 34825
401 Ga0501034_0002861 3300049571 Bacteria 20083
402 Ga0501034_1694566 3300049571 Bacteria 504
403 Ga0501036_0000336 3300049572 Bacteria 32902
404 Ga0501036_1630796 3300049572 Bacteria 520
405 Ga0501037_0000425 3300049573 Bacteria 34779
406 Ga0501038_0001384 3300049574 Bacteria 22160
407 Ga0501039_0016759 3300049575 Bacteria 5615
408 Ga0501040_0013286 3300049576 Bacteria 5415
409 Ga0501042_0023712 3300049578 Bacteria 4297
410 Ga0501042_0058343 3300049578 Bacteria 2755
411 Ga0501043_0000516 3300049579 Bacteria 34780
412 Ga0501046_0000439 3300049580 Bacteria 41871
413 Ga0501046_0485676 3300049580 Bacteria 886
414 Ga0501047_0000706 3300049581 Bacteria 34791
415 Ga0501047_0121419 3300049581 Bacteria 2494
416 Ga0501047_0177613 3300049581 Bacteria 1996
417 Ga0501047_0196535 3300049581 Bacteria 1879
418 Ga0501047_1376910 3300049581 Bacteria 520
419 Ga0501048_0000269 3300049582 Bacteria 34831
420 Ga0501067_0070728 3300049583 Bacteria 1932
421 Ga0501068_0009015 3300049584 Bacteria 5568
422 Ga0501069_0009766 3300049585 Bacteria 5071
423 Ga0501069_0010469 3300049585 Bacteria 4909
424 Ga0501070_0000649 3300049586 Bacteria 31969
425 Ga0501070_0005184 3300049586 Bacteria 11101
426 Ga0501070_0025917 3300049586 Bacteria 4919
427 Ga0501070_0073221 3300049586 Bacteria 2834
428 Ga0501070_0272674 3300049586 Bacteria 1381
429 Ga0501071_0140445 3300049587 Unclassified 1798
430 Ga0501071_0212161 3300049587 Bacteria 1456
431 Ga0501072_0002921 3300049588 Bacteria 12861
432 Ga0501073_0001545 3300049589 Bacteria 17056
433 Ga0501074_0020000 3300049590 Bacteria 4865
434 Ga0501074_0029244 3300049590 Bacteria 3991
435 Ga0501074_0086676 3300049590 Bacteria 2243
436 Ga0501076_0038909 3300049592 Bacteria 3733
437 Ga0501076_0640433 3300049592 Bacteria 877
438 Ga0501077_0903394 3300049593 Bacteria 568
439 Ga0501079_0012584 3300049741 Bacteria 6462
440 Ga0501079_0123609 3300049741 Bacteria 2013
441 Ga0501079_0225971 3300049741 Bacteria 1462
442 Ga0501080_0004448 3300049742 Bacteria 12472
443 Ga0501080_0025778 3300049742 Bacteria 5461
444 Ga0501081_0382196 3300049743 Bacteria 1041
445 Ga0501083_0000794 3300049744 Bacteria 20751
446 Ga0501083_0019501 3300049744 Bacteria 4724
447 Ga0501083_0025968 3300049744 Bacteria 4052
448 Ga0501083_0510457 3300049744 Bacteria 782
449 Ga0501035_0000754 3300049822 Bacteria 34845
450 Ga0501035_1150344 3300049822 Bacteria 604
451 Ga0501044_0000947 3300049823 Bacteria 34821
452 Ga0501044_0014304 3300049823 Bacteria 8566
453 Ga0501044_0126652 3300049823 Bacteria 2551
454 Ga0501044_0822281 3300049823 Unclassified 807
455 Ga0501045_0028359 3300049824 Bacteria 4038
456 Ga0501045_0556455 3300049824 Bacteria 851
457 Ga0501045_0667490 3300049824 Bacteria 768
458 nmdc:mga0qj67_68306_c1 3300050509 Bacteria 2832
459 nmdc:mga0a205_19_c2 3300050515 Bacteria 74147
460 Ga0495601_0001218 3300053077 Bacteria 14090
461 Ga0495601_0058448 3300053077 Bacteria 2444
462 Ga0495601_0116715 3300053077 Bacteria 1731
463 Ga0495601_0140554 3300053077 Bacteria 1575
464 Ga0495601_0151757 3300053077 Unclassified 1512
465 Ga0495601_0229846 3300053077 Bacteria 1211
466 Ga0495601_0248761 3300053077 Bacteria 1161
467 Ga0495612_0001807 3300053078 Bacteria 8762
468 Ga0495612_0003434 3300053078 Bacteria 6569
469 Ga0495612_0525849 3300053078 Bacteria 544
470 Ga0495655_0000002 3300053083 Bacteria 312752
471 Ga0495655_0019360 3300053083 Bacteria 1510
472 Ga0495655_0108754 3300053083 Bacteria 830
473 Ga0495595_0000002 3300053084 Bacteria 445641
474 Ga0495595_0167431 3300053084 Bacteria 1086
475 Ga0495619_0000102 3300053085 Bacteria 64345
476 Ga0495619_0000268 3300053085 Bacteria 37980
477 Ga0495619_0005581 3300053085 Bacteria 7983
478 Ga0495619_0011332 3300053085 Bacteria 5612
479 Ga0495619_0094497 3300053085 Bacteria 2028
480 Ga0495619_0409924 3300053085 Bacteria 935
481 Ga0500566_0000683 3300053094 Bacteria 19070
482 Ga0500641_0000831 3300053096 Bacteria 11108
483 Ga0500572_255035 3300053111 Bacteria 570
484 Ga0500628_000001 3300053129 Bacteria 564074
485 Ga0501084_0212730 3300054114 Bacteria 1631
486 Ga0501082_0002303 3300060353 Bacteria 16703
487 Ga0530510_1103456 3300061734 Bacteria 608
488 Ga0495641_0086445
489 JGI24740J21852_10004506
490 Ga0070683_100000835
491 Ga0070683_100003886
492 Ga0070690_100438449
493 Ga0070666_10040741
494 Ga0070666_10067311
495 Ga0070682_100000011
496 Ga0068868_100004956
497 Ga0070689_100128119
498 Ga0070691_10000138
499 Ga0070691_10756793
500 Ga0070661_100000058
501 Ga0070661_100758942
502 Ga0070692_10036350
503 Ga0070692_10689195
504 Ga0070668_100089709
505 Ga0070668_100120668
506 Ga0070668_102019466
507 Ga0070675_100000036
508 Ga0070671_100343162
509 Ga0070673_100472745
510 Ga0070688_100000171
511 Ga0070688_100000360
512 Ga0070667_100001076
513 Ga0070667_100006751
514 Ga0070667_100045073
515 Ga0070667_100102665
516 Ga0070667_100683926
517 Ga0070709_11345480
518 Ga0070714_100094095
519 Ga0070714_100566936
520 Ga0070714_102312655
521 Ga0070713_100000047
522 Ga0070713_100039662
523 Ga0070711_100091636
524 Ga0070700_100074280
525 Ga0070694_100343819
526 Ga0070694_101172337
527 Ga0070663_100003998
528 Ga0070663_100772304
529 Ga0070681_10621632
530 Ga0070685_10000019
531 Ga0070685_10000020
532 Ga0070685_10209781
533 Ga0070685_10637005
534 Ga0070679_100012803
535 Ga0070684_100610062
536 Ga0070672_100000001
537 Ga0070672_101216475
538 Ga0070695_100322300
539 Ga0070693_100926138
540 Ga0070665_100001462
541 Ga0070665_100051392
542 Ga0070665_100183823
543 Ga0070665_100235741
544 Ga0070665_101889954
545 Ga0070704_100231028
546 Ga0068855_100337954
547 Ga0070664_100116556
548 Ga0068854_100003343
549 Ga0068854_101110222
550 Ga0068856_100003300
551 Ga0070702_100020360
552 Ga0068852_100000002
553 Ga0068852_100044940
554 Ga0068866_10065962
555 Ga0068861_102063091
556 Ga0068851_10000730
557 Ga0068851_10000911
558 Ga0068863_100029512
559 Ga0068863_101512984
560 Ga0068860_100143302
561 Ga0068862_100000943
562 Ga0068862_100510751
563 Ga0081455_10029831
564 Ga0081455_10038488
565 Ga0081455_10046721
566 Ga0081455_10931649
567 Ga0081540_1000100
568 Ga0081539_10002227
569 Ga0070712_100007821
570 Ga0097621_102405544
571 Ga0068871_100301341
572 Ga0075430_100125903
573 Ga0075433_10000421
574 Ga0068865_100000013
575 Ga0105240_11019158
576 Ga0105245_10000125
577 Ga0105245_10052008
578 Ga0105247_10001978
579 Ga0105247_10134859
580 Ga0105243_10024723
581 Ga0105241_10065255
582 Ga0105242_10000117
583 Ga0105242_10000931
584 Ga0105242_12072945
585 Ga0105248_10000020
586 Ga0105237_11807037
587 Ga0105249_10003509
588 Ga0105249_10311451
589 Ga0105239_10515909
590 Ga0105239_10819182
591 Ga0105239_12347614
592 Ga0105246_12261120
593 Ga0157373_11248404
594 Ga0157371_10043297
595 Ga0157370_10002971
596 Ga0157370_10580794
597 Ga0157369_10000307
598 Ga0157369_10796624
599 Ga0157369_12215560
600 Ga0157374_10671340
601 Ga0157374_12755937
602 Ga0157378_10003176
603 Ga0157378_10031397
604 Ga0157378_10118701
605 Ga0163162_13467411
606 Ga0157372_10000053
607 Ga0157372_10658337
608 Ga0157375_10001535
609 Ga0157375_10324303
610 Ga0157375_12133748
611 Ga0163163_13212907
612 Ga0163163_13236525
613 Ga0157380_10000016
614 Ga0157380_10244106
615 Ga0157380_10444701
616 Ga0157377_11032762
617 Ga0157379_10011155
618 Ga0157379_11384530
619 Ga0157376_10022880
620 Ga0157376_10056914
621 Ga0206356_11093252
622 Ga0224712_10555524
623 Ga0207656_10000211
624 Ga0207656_10004794
625 Ga0207642_10046848
626 Ga0207710_10000821
627 Ga0207710_10080177
628 Ga0207680_10036448
629 Ga0207680_10080560
630 Ga0207699_10547634
631 Ga0207654_10047296
632 Ga0207707_10095334
633 Ga0207695_10705369
634 Ga0207671_10394191
635 Ga0207671_10588962
636 Ga0207693_10049045
637 Ga0207663_10062835
638 Ga0207649_10000283
639 Ga0207649_10690246
640 Ga0207652_10008840
641 Ga0207694_10860681
642 Ga0207659_10000013
643 Ga0207687_10000017
644 Ga0207687_10030407
645 Ga0207700_10000033
646 Ga0207664_10102186
647 Ga0207664_10859952
648 Ga0207664_11498908
649 Ga0207644_10923133
650 Ga0207686_10000254
651 Ga0207686_10002477
652 Ga0207686_11230270
653 Ga0207709_10006143
654 Ga0207670_10098140
655 Ga0207669_10068491
656 Ga0207669_10334328
657 Ga0207704_10000040
658 Ga0207704_10384276
659 Ga0207691_10000017
660 Ga0207711_10000006
661 Ga0207661_10000198
662 Ga0207661_10002675
663 Ga0207679_10071973
664 Ga0207679_10093327
665 Ga0207667_10104473
666 Ga0207667_10781886
667 Ga0207651_10607967
668 Ga0207712_10011490
669 Ga0207668_10031903
670 Ga0207668_10099769
671 Ga0207640_10000370
672 Ga0207658_10003877
673 Ga0207658_10087929
674 Ga0207658_10104027
675 Ga0207658_10182475
676 Ga0207677_10002708
677 Ga0207639_10118502
678 Ga0207678_10047722
679 Ga0207708_10201180
680 Ga0207702_10002446
681 Ga0207702_10706766
682 Ga0207702_11390603
683 Ga0207641_10043814
684 Ga0207641_10351086
685 Ga0207641_10425831
686 Ga0207641_11447646
687 Ga0207674_11121611
688 Ga0207698_10000004
689 Ga0207698_10038394
690 Ga0268266_10000601
691 Ga0268266_10001254
692 Ga0268266_10026262
693 Ga0268266_10161379
694 Ga0268266_10314156
695 Ga0268266_10737825
696 Ga0268266_11109158
697 Ga0268266_11461450
698 Ga0268265_10004453
699 Ga0268265_11319361
700 Ga0268264_10464896
701 Ga0268264_10511974
702 Ga0265319_1000014
703 Ga0265334_10047765
704 Ga0265338_10000244
705 Ga0265324_10045813
706 Ga0265313_10239623
707 Ga0307416_101430708
708 Ga0307415_100240361
709 Ga0316583_10046322
710 Ga0373955_0437768
711 Ga0373937_0734533
712 Ga0316582_0605817
713 Ga0451800_0374107
714 Ga0451802_1290304
715 Ga0451807_1434009
716 Ga0451807_1892530
717 Ga0451835_0389310
718 Ga0451849_0058156
719 Ga0451849_1214696
720 Ga0451853_1746024
721 Ga0466963_0523116
722 Ga0466967_0000001
723 Ga0466967_0175529
724 Ga0466967_1714654
725 Ga0495592_0371965
726 Ga0495592_0425435
727 Ga0495629_0000260
728 Ga0495629_0000487
729 Ga0495629_0010874
730 Ga0495638_0029338
731 Ga0495641_0023225
732 Ga0495641_0088313
733 Ga0495651_0076881
734 Ga0495651_0100543
735 Ga0495651_0185936
736 Ga0495653_0270457
737 Ga0495662_0013837
738 Ga0495664_0184458
739 Ga0495664_0681916
740 Ga0495594_0000089
741 Ga0495606_0000040
742 Ga0495608_0000007
743 Ga0495608_0549812
744 Ga0495618_0150995
745 Ga0495618_0161212
746 Ga0495628_0000859
747 Ga0495628_0123737
748 Ga0495630_0000014
749 Ga0495630_0000256
750 Ga0495630_0054889
751 Ga0495630_0333418
752 Ga0495652_0000010
753 Ga0495652_0003765
754 Ga0495640_0363851
755 Ga0495587_0000618
756 Ga0495587_0128483
757 Ga0495587_0181367
758 Ga0495587_0511353
759 Ga0495587_0656834
760 Ga0495645_0223416
761 Ga0495645_0252907
762 Ga0495622_0000218
763 Ga0495667_0000020
764 Ga0495667_0282586
765 Ga0495634_0002567
766 Ga0495634_0017341
767 Ga0495634_0061993
768 Ga0495625_0000688
769 Ga0495635_0386765
770 Ga0495588_0000338
771 Ga0495657_0000001
772 Ga0495657_0176745
773 Ga0495647_0001982
774 Ga0495647_0200061
775 Ga0495658_0003808
776 Ga0495658_0117560
777 Ga0495613_0000041
778 Ga0495624_0000671
779 Ga0495604_0000239
780 Ga0495604_0105915
781 Ga0495674_0002248
782 Ga0495672_0214273
783 Ga0495672_0214623
784 Ga0495676_0001364
785 Ga0495676_0137244
786 Ga0495676_0397158
787 Ga0495676_0852702
788 Ga0495680_0002541
789 Ga0495680_0126650
790 Ga0495675_0000300
791 Ga0495675_0298925
792 Ga0495684_0185521
793 Ga0495684_0301749
794 Ga0495684_0323656
795 Ga0495684_0540874
796 Ga0495686_0090480
797 Ga0495593_0072470
798 Ga0495593_0111770
799 Ga0495602_0000007
800 Ga0495602_0000611
801 Ga0495602_0267802
802 Ga0495602_0761977
803 Ga0495602_1149475
804 Ga0496100_0000001
805 Ga0496101_0000004
806 Ga0496101_0829407
807 Ga0496102_0000294
808 Ga0496102_0061178
809 Ga0496102_0370462
810 Ga0496102_0677577
811 Ga0496103_0000159
812 Ga0496103_0209260
813 Ga0496103_0982565
814 Ga0496104_0000015
815 Ga0496104_0000765
816 Ga0496104_0033800
817 Ga0496104_0039152
818 Ga0496104_0491021
819 Ga0496105_0000004
820 Ga0496105_0007927
821 Ga0496105_0063371
822 Ga0496105_0618973
823 Ga0496105_0909849
824 Ga0496106_0000056
825 Ga0496106_0738163
826 Ga0496107_0000005
827 Ga0496107_0022168
828 Ga0496108_0000063
829 Ga0496108_0004943
830 Ga0496109_0000012
831 Ga0496109_0000173
832 Ga0496109_0586198
833 Ga0496109_0749907
834 Ga0496109_1182980
835 Ga0496110_0002711
836 Ga0496110_0089639
837 Ga0496110_0442927
838 Ga0496110_1829347
839 Ga0496111_0000035
840 Ga0496111_0320516
841 Ga0496111_0428058
842 Ga0496112_1064189
843 Ga0496113_0000026
844 Ga0496113_0101237
845 Ga0496113_0452755
846 Ga0496113_1089310
847 Ga0496114_0000039
848 Ga0496114_0092100
849 Ga0496114_0520470
850 Ga0496114_0862453
851 Ga0496115_0000011
852 Ga0496115_0003457
853 Ga0496115_0014195
854 Ga0496116_0000331
855 Ga0496117_0036733
856 Ga0496117_0348858
857 Ga0496118_0003934
858 Ga0496118_0217295
859 Ga0496118_0221043
860 Ga0496119_0002281
861 Ga0496119_0005810
862 Ga0496119_0008997
863 Ga0496119_0060355
864 Ga0496120_0001336
865 Ga0496120_0133608
866 Ga0496120_0401930
867 Ga0496121_0036049
868 Ga0496121_0052194
869 Ga0496121_0142675
870 Ga0496121_0247902
871 Ga0496121_0758154
872 Ga0496124_0235077
873 Ga0496124_0988472
874 Ga0496125_0056943
875 Ga0496125_0071876
876 Ga0496126_0248123
877 Ga0496126_0529883
878 Ga0496126_0548679
879 Ga0496126_0702768
880 Ga0496126_0728322
881 Ga0496126_0835098
882 Ga0501031_0000188
883 Ga0501031_0376171
884 Ga0501032_0001031
885 Ga0501032_0256976
886 Ga0501032_0457125
887 Ga0501033_0000554
888 Ga0501034_0002861
889 Ga0501034_1694566
890 Ga0501036_0000336
891 Ga0501036_1630796
892 Ga0501037_0000425
893 Ga0501038_0001384
894 Ga0501039_0016759
895 Ga0501040_0013286
896 Ga0501042_0023712
897 Ga0501042_0058343
898 Ga0501043_0000516
899 Ga0501046_0000439
900 Ga0501046_0485676
901 Ga0501047_0000706
902 Ga0501047_0121419
903 Ga0501047_0177613
904 Ga0501047_0196535
905 Ga0501047_1376910
906 Ga0501048_0000269
907 Ga0501067_0070728
908 Ga0501068_0009015
909 Ga0501069_0009766
910 Ga0501069_0010469
911 Ga0501070_0000649
912 Ga0501070_0005184
913 Ga0501070_0025917
914 Ga0501070_0073221
915 Ga0501070_0272674
916 Ga0501071_0140445
917 Ga0501071_0212161
918 Ga0501072_0002921
919 Ga0501073_0001545
920 Ga0501074_0020000
921 Ga0501074_0029244
922 Ga0501074_0086676
923 Ga0501076_0038909
924 Ga0501076_0640433
925 Ga0501077_0903394
926 Ga0501079_0012584
927 Ga0501079_0123609
928 Ga0501079_0225971
929 Ga0501080_0004448
930 Ga0501080_0025778
931 Ga0501081_0382196
932 Ga0501083_0000794
933 Ga0501083_0019501
934 Ga0501083_0025968
935 Ga0501083_0510457
936 Ga0501035_0000754
937 Ga0501035_1150344
938 Ga0501044_0000947
939 Ga0501044_0014304
940 Ga0501044_0126652
941 Ga0501044_0822281
942 Ga0501045_0028359
943 Ga0501045_0556455
944 Ga0501045_0667490
945 nmdc:mga0qj67_68306_c1
946 nmdc:mga0a205_19_c2
947 Ga0495601_0001218
948 Ga0495601_0058448
949 Ga0495601_0116715
950 Ga0495601_0140554
951 Ga0495601_0151757
952 Ga0495601_0229846
953 Ga0495601_0248761
954 Ga0495612_0001807
955 Ga0495612_0003434
956 Ga0495612_0525849
957 Ga0495655_0000002
958 Ga0495655_0019360
959 Ga0495655_0108754
960 Ga0495595_0000002
961 Ga0495595_0167431
962 Ga0495619_0000102
963 Ga0495619_0000268
964 Ga0495619_0005581
965 Ga0495619_0011332
966 Ga0495619_0094497
967 Ga0495619_0409924
968 Ga0500566_0000683
969 Ga0500641_0000831
970 Ga0500572_255035
971 Ga0500628_000001
972 Ga0501084_0212730
973 Ga0501082_0002303
974 Ga0530510_1103456

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
1uw0-assembly1.cif.gz_A solution structure of the zinc-finger domain from dna ligase iiia 0.8134 29 79
4opx-assembly1.cif.gz_A structure of human parp-1 bound to a dna double strand break in complex with (2r)-5-fluoro-2-methyl-2,3-dihydro-1-benzofuran-7-carboxamide 0.7982 31 79
3oda-assembly4.cif.gz_G human parp-1 zinc finger 1 (zn1) bound to dna 0.7965 31 78
7s6h-assembly2.cif.gz_C human parp1 deltav687-e688 bound to nad+ analog eb-47 and to a dna double strand break. 0.7958 31 78
7s6h-assembly1.cif.gz_A human parp1 deltav687-e688 bound to nad+ analog eb-47 and to a dna double strand break. 0.7958 31 78
ID Description Score Start End Superfamily
af_Q21275_7_107_3.30.1740.10 Alpha Beta;2-Layer Sandwich;first zn-finger domain of poly(adp-ribose) polymerase-1;Zinc finger, PARP-type 0.8595 29 79 3.30.1740.10
af_Q54XI2_1_101_3.30.1740.10 Alpha Beta;2-Layer Sandwich;first zn-finger domain of poly(adp-ribose) polymerase-1;Zinc finger, PARP-type 0.8342 31 74 3.30.1740.10
af_Q54E19_1_108_3.30.1740.10 Alpha Beta;2-Layer Sandwich;first zn-finger domain of poly(adp-ribose) polymerase-1;Zinc finger, PARP-type 0.8333 31 77 3.30.1740.10
af_P35875_106_207_3.30.1740.10 Alpha Beta;2-Layer Sandwich;first zn-finger domain of poly(adp-ribose) polymerase-1;Zinc finger, PARP-type 0.8312 31 78 3.30.1740.10
af_P35875_2_105_3.30.1740.10 Alpha Beta;2-Layer Sandwich;first zn-finger domain of poly(adp-ribose) polymerase-1;Zinc finger, PARP-type 0.8279 29 78 3.30.1740.10
ID Description Score Start End GO Terms
AF-A0A7J9X108-F1-model_v4 Uncharacterized protein 0.9611 11 90
AF-A0A0F8YC83-F1-model_v4 PARP-type domain-containing protein 0.9329 29 77 GO:0003677
GO:0008270
AF-A0A0F9VL24-F1-model_v4 PARP-type domain-containing protein 0.9276 29 77 GO:0003677
GO:0008270
AF-A0A7K0A0J8-F1-model_v4 ATP/GTP-binding protein 0.9258 11 83
AF-A0A537YMM2-F1-model_v4 Uncharacterized protein 0.9215 4 111

Map