F453495

General Info

Members Datasets Scaffolds Average Seq Length
487 290 974 431

Family's Representative Sequence

Representative Sequence 3300047472|Ga0495686_0012946|Ga0495686_0012946_1800_3293
Length 497
Sequence VGCLQGRSEISEKGGIIYAASGLERNTLFNHPKIPLWSGITREIITMRHALTAILAATSFSSIAFAQTTPVPAVAAPAAQNEIGAAVAKDMDGLMTLYRDLHANPELSLQEVNTAAKLAKRLKALKFDVTEKVGGTGVVAVMKNGSGPTLLIRADMDGLPVVEQTGLAFASKVRTKTPEGVETGVMHACGHDTHMTAVIETAKLLAARKADWKGTLVMILQPAEEVGKGARDMLEDGLYTRFPKPTHAIAFHDAANLGAGQIGYTPGYALANVDSVDVLVKGLGGHGAYPQTTRDPIVLASRIVTTLQTLVSREQDPQDPAVVTVGSFQAGAKHNIIPDEAKLLLTIRSYSDETRAKLIEGIRRISRGEAIAAGVPEDKMPVVTVKDEFTPSTFNPPEFAEQMATLLKGHFPDGRVVKTPAVMGGEDFGRFYRADKSINSFIFWVGGVPADKLAAAQAGQGNLPSLHSPFWAPEADKVIATASEAMTFLALDILKKN

Samples

Sample ID Description Type Environment
1 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
4 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
5 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
6 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
7 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
8 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
9 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
10 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
11 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
12 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
13 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
14 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
15 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
16 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
17 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
18 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
19 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
20 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
21 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
22 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
23 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
24 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
25 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
26 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
27 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
28 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
29 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
30 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
31 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
32 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
38 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
55 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
56 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
57 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
58 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
64 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
72 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
80 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
82 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
83 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
84 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
85 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
86 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
87 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
88 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
89 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
90 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
92 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
93 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
95 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
128 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
133 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
134 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
135 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
136 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
137 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
138 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
139 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
140 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
141 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
142 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
143 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
144 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
145 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
146 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
147 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
148 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
149 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
150 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
151 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
152 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
153 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
154 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
155 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
156 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
157 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
158 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
159 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
160 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
161 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
162 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
163 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
164 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
165 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
166 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
167 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
168 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
169 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
170 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
171 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
172 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
173 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
174 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
175 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
176 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
177 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
178 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
179 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
180 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
181 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
182 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
183 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
184 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
185 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
186 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
187 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
188 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
189 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
190 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
191 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
192 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
193 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
194 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
195 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
196 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
197 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
198 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
199 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
200 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
201 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
202 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
203 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
214 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
215 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
216 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
217 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
218 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
219 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
220 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
221 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
222 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
223 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
224 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
225 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
228 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
229 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
230 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
231 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
232 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
233 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
234 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
235 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
236 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
237 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
238 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
239 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
240 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
241 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
242 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
243 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
244 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
245 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
246 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
247 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
248 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
249 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
250 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
251 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
252 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
253 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
254 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
255 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
256 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
257 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
258 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
259 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
260 2510917021 Novosphingobium sp. AP12 Isolate Rhizosphere
261 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere
262 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
263 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
264 2643221560 Sphingopyxis sp. Root1497 Isolate Unclassified
265 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
266 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
267 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
268 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
269 2643221622 Sphingomonas sp. Root241 Isolate Unclassified
270 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
271 2739367664 Novosphingobium sp. GV002 Isolate Unclassified
272 2739367756 Asticcacaulis sp. CF398 Isolate Unclassified
273 2739367865 Novosphingobium sp. GV013 Isolate Unclassified
274 2775507255 Sphingobium indicum B90A Isolate Rhizosphere
275 2808606401 Sphingobium sp. AEW010 Isolate Rhizosphere
276 2808606404 Sphingobium sp. AEW013 Isolate Rhizosphere
277 2808606405 Sphingobium sp. AEW001 Isolate Rhizosphere
278 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
279 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
280 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere
281 2852680915 Sphingopyxis sp. JAI128 Isolate Rhizosphere
282 2866552031 Saccharopolyspora rhizosphaerae H219 Isolate Unclassified
283 2879163058 Sphingomonas pokkalii L3B27 Isolate Rhizosphere
284 2880518877 Sphingobium sp. JAI105 Isolate Rhizosphere
285 2882806704 Pelagerythrobacter rhizovicinus AY-3R Isolate Rhizosphere
286 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified
287 2928027323 Sphingomonas sp. 1185 Isolate Unclassified
288 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
289 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
290 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.43
Metatranscriptomes 0.21
Isolates 6.37

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 21.77
Nodule 0
Rhizoplane 1.85
Rhizosphere 65.09
Stem 0
Stem Tuber 0
Unclassified 0.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495686_0012946 3300047472 Bacteria 5815
2 SwRhRL2b_contig_261670 2162886007 Bacteria 4460
3 SwRhRL2b_contig_351495 2162886007 Bacteria 17555
4 JGI24736J21556_1003293 3300001904 Bacteria 2811
5 JGI24741J21665_1001320 3300001915 Bacteria 7258
6 JGI24752J21851_1000349 3300001976 Bacteria 6440
7 JGI24740J21852_10004199 3300001979 Bacteria 6223
8 JGI24739J22299_10003506 3300001989 Bacteria 5986
9 JGI25162J39368_1000546 3300002737 Bacteria 27810
10 JGI25164J39214_1001169 3300002772 Bacteria 7275
11 JGI25150J39212_1001016 3300002774 Bacteria 8671
12 JGI25165J46597_1001143 3300003214 Bacteria 16599
13 JGI25153J46596_10000108 3300003215 Bacteria 94715
14 rootH2_10050636 3300003320 Bacteria 12115
15 rootH2_10074499 3300003320 Bacteria 4406
16 rootH1_10002072 3300003323 Bacteria 48496
17 rootH1_10005483 3300003323 Bacteria 12785
18 rootH1_10151529 3300003323 Bacteria 3648
19 Ga0055526_1012944 3300003771 Bacteria 3578
20 Ga0055537_1000859 3300003773 Bacteria 14743
21 Ga0055537_1004731 3300003773 Bacteria 3821
22 Ga0055524_1000103 3300003775 Bacteria 105196
23 Ga0055536_1000935 3300003781 Bacteria 18795
24 Ga0055536_1001355 3300003781 Bacteria 14922
25 Ga0055536_1002340 3300003781 Bacteria 10731
26 Ga0055536_1008140 3300003781 Bacteria 4564
27 Ga0055536_1015742 3300003781 Bacteria 2570
28 Ga0055534_1006719 3300003784 Bacteria 2853
29 Ga0055530_10000024 3300003791 Bacteria 135706
30 Ga0055540_1001811 3300003792 Bacteria 12120
31 Ga0055531_10000083 3300003794 Bacteria 102626
32 Ga0055531_10000164 3300003794 Bacteria 75390
33 Ga0055531_10002827 3300003794 Bacteria 11362
34 Ga0055531_10007299 3300003794 Bacteria 6062
35 Ga0065165_1002485 3300005262 Bacteria 15496
36 Ga0065165_1025133 3300005262 Bacteria 1987
37 Ga0065704_10001637 3300005289 Bacteria 7146
38 Ga0065704_10070447 3300005289 Bacteria 24411
39 Ga0065707_10082388 3300005295 Bacteria 15766
40 Ga0070683_100003962 3300005329 Bacteria 12119
41 Ga0070670_100002999 3300005331 Bacteria 13978
42 Ga0070670_100008358 3300005331 Bacteria 8824
43 Ga0070666_10000182 3300005335 Bacteria 43137
44 Ga0070666_10110671 3300005335 Bacteria 1899
45 Ga0068868_100030594 3300005338 Bacteria 4128
46 Ga0070660_100028955 3300005339 Bacteria 4147
47 Ga0070660_100213921 3300005339 Bacteria 1565
48 Ga0070668_100000035 3300005347 Bacteria 82135
49 Ga0070668_100004541 3300005347 Bacteria 10297
50 Ga0070669_100000001 3300005353 Bacteria 537589
51 Ga0070669_100030985 3300005353 Bacteria 3861
52 Ga0070671_100000002 3300005355 Bacteria 292733
53 Ga0070671_100002027 3300005355 Bacteria 15597
54 Ga0070671_100005166 3300005355 Bacteria 10392
55 Ga0070673_100195671 3300005364 Bacteria 1739
56 Ga0070659_100001348 3300005366 Bacteria 17669
57 Ga0070659_100048539 3300005366 Bacteria 3335
58 Ga0070667_100000053 3300005367 Bacteria 151974
59 Ga0070667_100000104 3300005367 Bacteria 106938
60 Ga0070667_100000130 3300005367 Bacteria 95182
61 Ga0070667_100001918 3300005367 Bacteria 18453
62 Ga0070667_100002900 3300005367 Bacteria 14733
63 Ga0070667_100059282 3300005367 Bacteria 3238
64 Ga0070705_100009564 3300005440 Bacteria 4824
65 Ga0070708_100056175 3300005445 Bacteria 3501
66 Ga0070707_100209249 3300005468 Bacteria 1901
67 Ga0070665_100000007 3300005548 Bacteria 649878
68 Ga0070665_100149366 3300005548 Bacteria 2340
69 Ga0070704_100151230 3300005549 Bacteria 1825
70 Ga0070664_100018989 3300005564 Bacteria 5652
71 Ga0070664_100068683 3300005564 Bacteria 3030
72 Ga0068857_100011641 3300005577 Bacteria 7651
73 Ga0068856_100041462 3300005614 Bacteria 4524
74 Ga0070702_100037902 3300005615 Bacteria 2680
75 Ga0068852_100086135 3300005616 Bacteria 2800
76 Ga0068859_100001571 3300005617 Bacteria 23275
77 Ga0068859_100005840 3300005617 Bacteria 12496
78 Ga0068859_100016548 3300005617 Bacteria 7404
79 Ga0068859_100028791 3300005617 Bacteria 5570
80 Ga0068864_100000800 3300005618 Bacteria 26375
81 Ga0068864_100002866 3300005618 Bacteria 14249
82 Ga0068861_100000147 3300005719 Bacteria 36347
83 Ga0068861_100001285 3300005719 Bacteria 15689
84 Ga0068863_100000029 3300005841 Bacteria 177191
85 Ga0068863_100007211 3300005841 Bacteria 10903
86 Ga0068863_100008270 3300005841 Bacteria 10164
87 Ga0068863_100012450 3300005841 Bacteria 8213
88 Ga0068863_100026289 3300005841 Bacteria 5553
89 Ga0068863_100124342 3300005841 Bacteria 2461
90 Ga0068858_100001601 3300005842 Bacteria 23108
91 Ga0068858_100007582 3300005842 Bacteria 10483
92 Ga0068860_100000197 3300005843 Bacteria 96240
93 Ga0068860_100000344 3300005843 Bacteria 62777
94 Ga0068860_100017565 3300005843 Bacteria 6970
95 Ga0068860_100113332 3300005843 Bacteria 2593
96 Ga0068862_100000301 3300005844 Bacteria 54214
97 Ga0068862_100001039 3300005844 Bacteria 26612
98 Ga0075368_10000406 3300006042 Bacteria 12615
99 Ga0075364_10002279 3300006051 Bacteria 10746
100 Ga0075367_10001156 3300006178 Bacteria 11018
101 Ga0075369_10041365 3300006186 Bacteria 1973
102 Ga0075366_10003956 3300006195 Bacteria 7907
103 Ga0097620_100001571 3300006931 Bacteria 23275
104 Ga0097620_100005840 3300006931 Bacteria 12496
105 Ga0097620_100016547 3300006931 Bacteria 7404
106 Ga0097620_100028791 3300006931 Bacteria 5570
107 Ga0105240_10000193 3300009093 Bacteria 124087
108 Ga0105240_10065447 3300009093 Bacteria 4512
109 Ga0111539_10010815 3300009094 Bacteria 11488
110 Ga0105245_10329679 3300009098 Bacteria 1506
111 Ga0105247_10028363 3300009101 Bacteria 3387
112 Ga0105241_10006942 3300009174 Bacteria 8336
113 Ga0105241_10015311 3300009174 Bacteria 5617
114 Ga0105248_10000637 3300009177 Bacteria 39844
115 Ga0105248_10043207 3300009177 Bacteria 5054
116 Ga0105248_10087142 3300009177 Bacteria 3514
117 Ga0105237_10000417 3300009545 Bacteria 60658
118 Ga0105237_10010588 3300009545 Bacteria 9796
119 Ga0105237_10013111 3300009545 Bacteria 8701
120 Ga0105237_10024387 3300009545 Bacteria 6188
121 Ga0105238_10083291 3300009551 Bacteria 3187
122 Ga0105238_10196564 3300009551 Bacteria 1993
123 Ga0105249_10000134 3300009553 Bacteria 97994
124 Ga0105249_10015277 3300009553 Bacteria 6795
125 Ga0105249_10058795 3300009553 Bacteria 3524
126 Ga0105148_100188 3300009978 Bacteria 9081
127 Ga0105239_10000095 3300010375 Bacteria 124330
128 Ga0105239_10000482 3300010375 Bacteria 58131
129 Ga0105246_10087755 3300011119 Bacteria 2233
130 Ga0157373_10000089 3300013100 Bacteria 78449
131 Ga0157378_10015228 3300013297 Bacteria 6735
132 Ga0157378_10215497 3300013297 Bacteria 1823
133 Ga0163162_10014276 3300013306 Bacteria 7761
134 Ga0163162_10154038 3300013306 Bacteria 2417
135 Ga0157372_10449703 3300013307 Bacteria 1501
136 Ga0157375_10005101 3300013308 Bacteria 11398
137 Ga0163163_10005212 3300014325 Bacteria 11213
138 Ga0163163_10023643 3300014325 Bacteria 5834
139 Ga0157379_10008410 3300014968 Bacteria 8970
140 Ga0163161_10005717 3300017792 Bacteria 8619
141 Ga0163161_10060893 3300017792 Bacteria 2748
142 Ga0209147_100655 3300025229 Bacteria 18037
143 Ga0207427_100091 3300025231 Bacteria 133410
144 Ga0209437_100026 3300025233 Bacteria 542698
145 Ga0207425_1000098 3300025245 Bacteria 83892
146 Ga0209026_1000991 3300025250 Bacteria 14111
147 Ga0209129_1008686 3300025258 Bacteria 2790
148 Ga0209233_1000111 3300025261 Bacteria 260262
149 Ga0209565_1000011 3300025263 Bacteria 637062
150 Ga0209565_1000214 3300025263 Bacteria 66404
151 Ga0209673_1005960 3300025273 Bacteria 6003
152 Ga0209675_1000025 3300025291 Bacteria 294102
153 Ga0209675_1005671 3300025291 Bacteria 5158
154 Ga0209676_1000085 3300025292 Bacteria 273425
155 Ga0209676_1000148 3300025292 Bacteria 172161
156 Ga0209676_1000238 3300025292 Bacteria 117732
157 Ga0209676_1009943 3300025292 Bacteria 4030
158 Ga0209025_1000413 3300025294 Bacteria 85984
159 Ga0209025_1017658 3300025294 Bacteria 4100
160 Ga0209758_1000019 3300025297 Bacteria 743682
161 Ga0209758_1005664 3300025297 Bacteria 9452
162 Ga0209050_1000047 3300025298 Bacteria 380561
163 Ga0209050_1000051 3300025298 Bacteria 353153
164 Ga0209050_1000217 3300025298 Bacteria 128833
165 Ga0209050_1000746 3300025298 Bacteria 46836
166 Ga0209050_1001423 3300025298 Bacteria 25844
167 Ga0209050_1013624 3300025298 Bacteria 3592
168 Ga0209256_1000016 3300025299 Bacteria 599092
169 Ga0209051_1006692 3300025303 Bacteria 6446
170 Ga0209257_1000028 3300025304 Bacteria 699493
171 Ga0209257_1000076 3300025304 Bacteria 324617
172 Ga0209257_1000329 3300025304 Bacteria 99531
173 Ga0209257_1001016 3300025304 Bacteria 37745
174 Ga0209257_1001081 3300025304 Bacteria 35775
175 Ga0209257_1003208 3300025304 Bacteria 14472
176 Ga0209257_1005761 3300025304 Bacteria 8462
177 Ga0207710_10004451 3300025900 Bacteria 6115
178 Ga0207680_10000033 3300025903 Bacteria 77177
179 Ga0207680_10191453 3300025903 Bacteria 1389
180 Ga0207654_10010192 3300025911 Bacteria 4784
181 Ga0207695_10000013 3300025913 Bacteria 821265
182 Ga0207671_10001597 3300025914 Bacteria 25752
183 Ga0207671_10005967 3300025914 Bacteria 11039
184 Ga0207671_10009833 3300025914 Bacteria 7958
185 Ga0207657_10002548 3300025919 Bacteria 19708
186 Ga0207646_10193312 3300025922 Bacteria 1838
187 Ga0207681_10000002 3300025923 Bacteria 985597
188 Ga0207681_10022283 3300025923 Bacteria 4039
189 Ga0207694_10043980 3300025924 Bacteria 3448
190 Ga0207650_10008660 3300025925 Bacteria 6950
191 Ga0207650_10086894 3300025925 Bacteria 2381
192 Ga0207650_10159596 3300025925 Bacteria 1786
193 Ga0207650_10166476 3300025925 Bacteria 1749
194 Ga0207644_10000002 3300025931 Bacteria 942221
195 Ga0207644_10001067 3300025931 Bacteria 17527
196 Ga0207644_10090332 3300025931 Bacteria 2282
197 Ga0207644_10221926 3300025931 Unclassified 1498
198 Ga0207690_10001050 3300025932 Bacteria 17671
199 Ga0207706_10060751 3300025933 Bacteria 3328
200 Ga0207670_10024346 3300025936 Bacteria 3783
201 Ga0207711_10002161 3300025941 Bacteria 17683
202 Ga0207661_10009755 3300025944 Bacteria 6896
203 Ga0207661_10141665 3300025944 Bacteria 2070
204 Ga0207667_10000504 3300025949 Bacteria 51526
205 Ga0207651_10037826 3300025960 Bacteria 3165
206 Ga0207712_10002209 3300025961 Bacteria 12676
207 Ga0207712_10150219 3300025961 Bacteria 1799
208 Ga0207668_10000017 3300025972 Bacteria 158934
209 Ga0207668_10001089 3300025972 Bacteria 16167
210 Ga0207668_10002721 3300025972 Bacteria 10348
211 Ga0207668_10027302 3300025972 Bacteria 3717
212 Ga0207640_10062529 3300025981 Bacteria 2470
213 Ga0207658_10000100 3300025986 Bacteria 95179
214 Ga0207658_10000363 3300025986 Bacteria 44647
215 Ga0207658_10000662 3300025986 Bacteria 30083
216 Ga0207658_10021507 3300025986 Bacteria 4480
217 Ga0207658_10065647 3300025986 Bacteria 2727
218 Ga0207703_10019468 3300026035 Bacteria 5305
219 Ga0207703_10085373 3300026035 Bacteria 2641
220 Ga0207678_10004444 3300026067 Bacteria 12612
221 Ga0207702_10039175 3300026078 Bacteria 3970
222 Ga0207641_10000049 3300026088 Bacteria 177222
223 Ga0207641_10000725 3300026088 Bacteria 35411
224 Ga0207641_10001638 3300026088 Bacteria 21820
225 Ga0207641_10002603 3300026088 Bacteria 16561
226 Ga0207641_10003191 3300026088 Bacteria 14682
227 Ga0207641_10004422 3300026088 Bacteria 12179
228 Ga0207641_10008204 3300026088 Bacteria 8634
229 Ga0207676_10000922 3300026095 Bacteria 22753
230 Ga0207676_10014472 3300026095 Bacteria 5678
231 Ga0207674_10026441 3300026116 Bacteria 6162
232 Ga0207674_10141479 3300026116 Bacteria 2365
233 Ga0207675_100000082 3300026118 Bacteria 74689
234 Ga0207675_100002616 3300026118 Bacteria 17805
235 Ga0207675_100077210 3300026118 Bacteria 3120
236 Ga0207698_10009374 3300026142 Bacteria 6240
237 Ga0209813_10000039 3300027866 Bacteria 55148
238 Ga0209974_10003990 3300027876 Bacteria 5279
239 Ga0268266_10000033 3300028379 Bacteria 388374
240 Ga0268266_10070227 3300028379 Bacteria 3035
241 Ga0268265_10000116 3300028380 Bacteria 100689
242 Ga0268265_10000200 3300028380 Bacteria 69474
243 Ga0268264_10000116 3300028381 Bacteria 198591
244 Ga0268264_10000161 3300028381 Bacteria 150917
245 Ga0268264_10000190 3300028381 Bacteria 127747
246 Ga0268264_10122385 3300028381 Bacteria 2295
247 Ga0307517_10000255 3300028786 Bacteria 91028
248 Ga0307509_10020337 3300031507 Bacteria 7532
249 Ga0307509_10111241 3300031507 Bacteria 2742
250 Ga0307408_100045987 3300031548 Bacteria 3120
251 Ga0307405_10004587 3300031731 Bacteria 6555
252 Ga0307405_10050449 3300031731 Bacteria 2577
253 Ga0307405_10074929 3300031731 Bacteria 2190
254 Ga0307413_10072175 3300031824 Bacteria 2178
255 Ga0307406_10137301 3300031901 Bacteria 1725
256 Ga0307412_10006119 3300031911 Bacteria 6782
257 Ga0307412_10006659 3300031911 Bacteria 6548
258 Ga0307412_10006938 3300031911 Bacteria 6427
259 Ga0307412_10010366 3300031911 Bacteria 5365
260 Ga0307412_10013048 3300031911 Bacteria 4858
261 Ga0307416_100011317 3300032002 Bacteria 5939
262 Ga0307416_100219869 3300032002 Bacteria 1820
263 Ga0307414_10000462 3300032004 Bacteria 21302
264 Ga0307414_10034675 3300032004 Bacteria 3349
265 Ga0307414_10115698 3300032004 Bacteria 2051
266 Ga0307414_10134316 3300032004 Bacteria 1926
267 Ga0307411_10066245 3300032005 Bacteria 2426
268 Ga0316593_10004096 3300032168 Bacteria 3701
269 Ga0307510_10003311 3300033180 Bacteria 18761
270 Ga0395905_0109150 3300037471 Bacteria 2598
271 Ga0395905_0142709 3300037471 Bacteria 2253
272 Ga0395901_0049482 3300038443 Bacteria 4367
273 Ga0439436_0013847 3300041404 Bacteria 2437
274 Ga0439461_0000421 3300041410 Bacteria 6105
275 Ga0439465_0003794 3300041413 Bacteria 4929
276 Ga0439431_0001596 3300041997 Bacteria 5025
277 Ga0439431_0001723 3300041997 Bacteria 4820
278 Ga0439432_004902 3300042006 Bacteria 4854
279 Ga0439449_0061648 3300042007 Bacteria 1384
280 Ga0439462_0000037 3300042015 Bacteria 19168
281 Ga0439462_0006691 3300042015 Bacteria 2874
282 Ga0439434_0000921 3300042435 Bacteria 8463
283 Ga0439434_0012732 3300042435 Bacteria 2491
284 Ga0466960_0008308 3300044901 Bacteria 4248
285 Ga0451576_0000007 3300045051 Bacteria 782228
286 Ga0451576_0098775 3300045051 Bacteria 3037
287 Ga0495627_000078 3300046453 Bacteria 119920
288 Ga0495627_000159 3300046453 Bacteria 76595
289 Ga0495627_002214 3300046453 Bacteria 9665
290 Ga0495590_0006925 3300046457 Bacteria 4399
291 Ga0495638_0000011 3300046460 Bacteria 442453
292 Ga0495650_0001292 3300046471 Bacteria 25491
293 Ga0495650_0001375 3300046471 Bacteria 24009
294 Ga0495584_0015497 3300046491 Bacteria 3884
295 Ga0495596_0000113 3300046500 Bacteria 55405
296 Ga0495596_0000868 3300046500 Bacteria 18199
297 Ga0495607_0074252 3300046501 Bacteria 1888
298 Ga0495583_0000077 3300046506 Bacteria 171772
299 Ga0495606_0016763 3300046507 Bacteria 5570
300 Ga0495610_0000044 3300046512 Bacteria 156847
301 Ga0495610_0000068 3300046512 Bacteria 122949
302 Ga0495610_0004014 3300046512 Bacteria 11107
303 Ga0495616_0000180 3300046513 Bacteria 54040
304 Ga0495632_0000079 3300046519 Bacteria 100131
305 Ga0495632_0000272 3300046519 Bacteria 51232
306 Ga0495632_0000834 3300046519 Bacteria 27160
307 Ga0495637_0001274 3300046520 Bacteria 15200
308 Ga0495637_0017956 3300046520 Bacteria 3287
309 Ga0495643_0000030 3300046522 Bacteria 260229
310 Ga0495643_0027346 3300046522 Bacteria 3207
311 Ga0495644_0008416 3300046523 Bacteria 3974
312 Ga0495648_0000023 3300046524 Bacteria 240174
313 Ga0495648_0026596 3300046524 Bacteria 3892
314 Ga0495663_0000006 3300046525 Bacteria 306938
315 Ga0495652_0113344 3300046529 Bacteria 2177
316 Ga0495654_0041533 3300046530 Bacteria 2287
317 Ga0495665_0083369 3300046531 Bacteria 1681
318 Ga0495609_0009931 3300046538 Bacteria 4586
319 Ga0495633_0000515 3300046558 Bacteria 38895
320 Ga0495633_0002283 3300046558 Bacteria 13710
321 Ga0495633_0040112 3300046558 Bacteria 2232
322 Ga0495633_0054427 3300046558 Bacteria 1882
323 Ga0495668_0000001 3300046616 Bacteria 1013420
324 Ga0495625_0000240 3300046660 Bacteria 85840
325 Ga0495625_0001742 3300046660 Bacteria 25169
326 Ga0495625_0065250 3300046660 Bacteria 2567
327 Ga0495670_0000056 3300046691 Bacteria 55007
328 Ga0495671_0000012 3300046692 Bacteria 358632
329 Ga0495671_0000072 3300046692 Bacteria 97315
330 Ga0495671_0016660 3300046692 Bacteria 3921
331 Ga0495671_0041252 3300046692 Bacteria 2325
332 Ga0495687_033643 3300047443 Bacteria 2323
333 Ga0495675_0113970 3300047444 Bacteria 1686
334 Ga0495673_0000029 3300047469 Bacteria 471019
335 Ga0495681_0000014 3300047470 Bacteria 184395
336 Ga0495681_0000055 3300047470 Bacteria 104502
337 Ga0495681_0031291 3300047470 Bacteria 2696
338 Ga0495686_0013645 3300047472 Bacteria 5631
339 Ga0495686_0033018 3300047472 Bacteria 3344
340 Ga0495686_0063379 3300047472 Bacteria 2291
341 Ga0495615_0000168 3300048090 Bacteria 16242
342 Ga0496102_0000010 3300048905 Bacteria 324617
343 Ga0496103_0000029 3300048906 Bacteria 213326
344 Ga0496108_0001477 3300048911 Bacteria 18569
345 Ga0496110_0026741 3300048913 Bacteria 4941
346 Ga0496110_0322693 3300048913 Bacteria 1407
347 Ga0496111_0106171 3300048914 Bacteria 2067
348 Ga0496112_0005190 3300048915 Bacteria 11200
349 Ga0496115_0000218 3300048918 Bacteria 52824
350 Ga0496116_0000039 3300048919 Bacteria 349134
351 Ga0496116_0000942 3300048919 Bacteria 35835
352 Ga0496117_0000037 3300048920 Bacteria 324960
353 Ga0496117_0012176 3300048920 Bacteria 7616
354 Ga0496118_0000034 3300048921 Bacteria 322764
355 Ga0496118_0001130 3300048921 Bacteria 41162
356 Ga0496118_0036224 3300048921 Bacteria 3993
357 Ga0496121_0000610 3300048924 Bacteria 66844
358 Ga0496121_0002847 3300048924 Bacteria 25528
359 Ga0496121_0036511 3300048924 Bacteria 4378
360 Ga0496122_0000507 3300048925 Bacteria 80433
361 Ga0496122_0000841 3300048925 Bacteria 58100
362 Ga0496122_0006059 3300048925 Bacteria 14089
363 Ga0496122_0043257 3300048925 Bacteria 3531
364 Ga0496123_0000518 3300048926 Bacteria 67308
365 Ga0496123_0001492 3300048926 Bacteria 32495
366 Ga0496123_0002030 3300048926 Bacteria 26140
367 Ga0496123_0031439 3300048926 Bacteria 3862
368 Ga0496124_0000033 3300048927 Bacteria 330586
369 Ga0496124_0000576 3300048927 Bacteria 61985
370 Ga0496124_0008527 3300048927 Bacteria 10699
371 Ga0496124_0041791 3300048927 Bacteria 3953
372 Ga0496124_0059375 3300048927 Bacteria 3213
373 Ga0496124_0073682 3300048927 Bacteria 2825
374 Ga0496125_0028608 3300048928 Bacteria 5029
375 Ga0496125_0069897 3300048928 Bacteria 2751
376 Ga0496126_0000041 3300048929 Bacteria 340389
377 Ga0496126_0078272 3300048929 Bacteria 2930
378 Ga0501031_0023878 3300049568 Bacteria 3987
379 Ga0501032_0014552 3300049569 Bacteria 5571
380 Ga0501032_0042021 3300049569 Bacteria 3102
381 Ga0501033_0010992 3300049570 Bacteria 6935
382 Ga0501034_0016722 3300049571 Bacteria 7522
383 Ga0501036_0033809 3300049572 Bacteria 4324
384 Ga0501038_0131086 3300049574 Bacteria 2058
385 Ga0501038_0230616 3300049574 Bacteria 1474
386 Ga0501039_0010606 3300049575 Bacteria 7021
387 Ga0501043_0005963 3300049579 Bacteria 9794
388 Ga0501046_0030301 3300049580 Bacteria 4392
389 Ga0501047_0001177 3300049581 Bacteria 25922
390 Ga0501047_0093357 3300049581 Bacteria 2888
391 Ga0501072_0203951 3300049588 Bacteria 1577
392 Ga0501223_000002 3300049663 Bacteria 154573
393 Ga0501223_000538 3300049663 Bacteria 9132
394 Ga0501224_000005 3300049664 Bacteria 149922
395 Ga0501233_000398 3300049668 Bacteria 6862
396 Ga0501235_001456 3300049669 Bacteria 5057
397 Ga0501235_009311 3300049669 Bacteria 2147
398 Ga0501249_001085 3300049679 Bacteria 5771
399 Ga0501255_001681 3300049684 Bacteria 1831
400 Ga0501257_000103 3300049686 Bacteria 19988
401 Ga0501225_0000257 3300049705 Bacteria 16700
402 Ga0501225_0000385 3300049705 Bacteria 13930
403 Ga0501225_0007226 3300049705 Bacteria 3223
404 Ga0501080_0129703 3300049742 Bacteria 2334
405 Ga0501083_0011181 3300049744 Bacteria 6297
406 Ga0501282_000049 3300049778 Bacteria 15222
407 Ga0501035_0016069 3300049822 Bacteria 6906
408 Ga0501044_0037278 3300049823 Bacteria 5082
409 Ga0501044_0054206 3300049823 Bacteria 4123
410 Ga0501204_001505 3300049850 Bacteria 2285
411 Ga0501226_000299 3300049853 Bacteria 7456
412 nmdc:mga00v17_5693_c1 3300050491 Bacteria 6580
413 nmdc:mga0k408_8127_c1 3300050493 Bacteria 5622
414 nmdc:mga06z11_94_c1 3300050494 Bacteria 37972
415 nmdc:mga04h51_50_c1 3300050495 Bacteria 38012
416 nmdc:mga07m45_109513_c1 3300050496 Bacteria 1590
417 nmdc:mga07m45_84336_c1 3300050496 Bacteria 1816
418 nmdc:mga08y16_69099_c1 3300050511 Bacteria 3683
419 nmdc:mga0sz30_16435_c1 3300050516 Bacteria 2938
420 nmdc:mga0sz30_5071_c2 3300050516 Bacteria 4255
421 Ga0500635_0002934 3300053080 Bacteria 4244
422 Ga0500643_000066 3300053087 Bacteria 119317
423 Ga0500643_000084 3300053087 Bacteria 99333
424 Ga0500643_000760 3300053087 Bacteria 21001
425 Ga0500643_003130 3300053087 Bacteria 8102
426 Ga0500643_007751 3300053087 Bacteria 4288
427 Ga0500566_0007510 3300053094 Bacteria 6461
428 Ga0500641_0008295 3300053096 Bacteria 3705
429 Ga0500556_0000049 3300053104 Bacteria 122572
430 Ga0500592_000112 3300053116 Bacteria 17479
431 Ga0500592_001930 3300053116 Bacteria 3334
432 Ga0500607_001050 3300053121 Bacteria 26031
433 Ga0500608_000402 3300053122 Bacteria 16609
434 Ga0500608_013371 3300053122 Bacteria 3637
435 Ga0500642_0000002 3300053130 Bacteria 795093
436 Ga0500658_0004942 3300053134 Bacteria 4971
437 Ga0500658_0011990 3300053134 Bacteria 3196
438 Ga0500559_0000905 3300053136 Bacteria 18904
439 Ga0500559_0002867 3300053136 Bacteria 8712
440 Ga0500559_0006809 3300053136 Bacteria 5125
441 Ga0500568_0003373 3300053139 Bacteria 8928
442 Ga0500573_0000089 3300053140 Bacteria 41855
443 Ga0500604_0000520 3300053151 Bacteria 10639
444 Ga0500624_000042 3300053157 Bacteria 90289
445 Ga0500624_000590 3300053157 Bacteria 9976
446 Ga0500627_0000057 3300053158 Bacteria 52807
447 Ga0500627_0000436 3300053158 Bacteria 11313
448 Ga0500627_0000476 3300053158 Bacteria 10849
449 Ga0500636_0052586 3300053177 Bacteria 2391
450 Ga0500637_0033522 3300053178 Bacteria 2868
451 Ga0500567_000239 3300053723 Bacteria 16697
452 Ga0500625_000006 3300053729 Bacteria 206258
453 Ga0500645_008055 3300053730 Bacteria 3626
454 Ga0500596_003337 3300053735 Bacteria 3068
455 Ga0501084_0017698 3300054114 Bacteria 5929
456 Ga0500661_000114 3300055283 Bacteria 13212
457 2511128772 2510917021 Bacteria 5705459
458 2512643788 2512564014 Bacteria 4639632
459 2600227447 2599185359 Bacteria 4772316
460 2643729268 2643221541 Bacteria 5498788
461 2643823025 2643221560 Bacteria 4801179
462 2643835486 2643221563 Bacteria 4726935
463 2644040687 2643221605 Bacteria 4772303
464 2644045744 2643221606 Bacteria 5588032
465 2644056412 2643221608 Bacteria 4724829
466 2644127930 2643221622 Bacteria 4212502
467 2644393321 2643221671 Bacteria 5496681
468 2739649965 2739367664 Bacteria 4114334
469 2739793163 2739367756 Bacteria 4553612
470 2740028438 2739367865 Bacteria 4114482
471 2778124705 2775507255 Bacteria 3945731
472 2809064264 2808606401 Bacteria 4586670
473 2809080232 2808606404 Bacteria 4652788
474 2809084596 2808606405 Bacteria 4586632
475 2819550604 2818991438 Bacteria 5793701
476 2819715975 2818991466 Bacteria 4748179
477 2852655084 2852653556 Bacteria 4050083
478 2852681445 2852680915 Bacteria 4100189
479 2866553997 2866552031 Bacteria 5824618
480 2879165120 2879163058 Bacteria 4223965
481 2880522168 2880518877 Bacteria 5012590
482 2882807938 2882806704 Bacteria 3007728
483 2919712181 2919709256 Bacteria 4318106
484 2928031034 2928027323 Bacteria 4382488
485 2928531178 2928526807 Bacteria 4760224
486 2928970561 2928968154 Bacteria 4633371
487 8054305717 8054302542 Bacteria 5698134
488 Ga0495686_0012946
489 SwRhRL2b_contig_261670
490 SwRhRL2b_contig_351495
491 JGI24736J21556_1003293
492 JGI24741J21665_1001320
493 JGI24752J21851_1000349
494 JGI24740J21852_10004199
495 JGI24739J22299_10003506
496 JGI25162J39368_1000546
497 JGI25164J39214_1001169
498 JGI25150J39212_1001016
499 JGI25165J46597_1001143
500 JGI25153J46596_10000108
501 rootH2_10050636
502 rootH2_10074499
503 rootH1_10002072
504 rootH1_10005483
505 rootH1_10151529
506 Ga0055526_1012944
507 Ga0055537_1000859
508 Ga0055537_1004731
509 Ga0055524_1000103
510 Ga0055536_1000935
511 Ga0055536_1001355
512 Ga0055536_1002340
513 Ga0055536_1008140
514 Ga0055536_1015742
515 Ga0055534_1006719
516 Ga0055530_10000024
517 Ga0055540_1001811
518 Ga0055531_10000083
519 Ga0055531_10000164
520 Ga0055531_10002827
521 Ga0055531_10007299
522 Ga0065165_1002485
523 Ga0065165_1025133
524 Ga0065704_10001637
525 Ga0065704_10070447
526 Ga0065707_10082388
527 Ga0070683_100003962
528 Ga0070670_100002999
529 Ga0070670_100008358
530 Ga0070666_10000182
531 Ga0070666_10110671
532 Ga0068868_100030594
533 Ga0070660_100028955
534 Ga0070660_100213921
535 Ga0070668_100000035
536 Ga0070668_100004541
537 Ga0070669_100000001
538 Ga0070669_100030985
539 Ga0070671_100000002
540 Ga0070671_100002027
541 Ga0070671_100005166
542 Ga0070673_100195671
543 Ga0070659_100001348
544 Ga0070659_100048539
545 Ga0070667_100000053
546 Ga0070667_100000104
547 Ga0070667_100000130
548 Ga0070667_100001918
549 Ga0070667_100002900
550 Ga0070667_100059282
551 Ga0070705_100009564
552 Ga0070708_100056175
553 Ga0070707_100209249
554 Ga0070665_100000007
555 Ga0070665_100149366
556 Ga0070704_100151230
557 Ga0070664_100018989
558 Ga0070664_100068683
559 Ga0068857_100011641
560 Ga0068856_100041462
561 Ga0070702_100037902
562 Ga0068852_100086135
563 Ga0068859_100001571
564 Ga0068859_100005840
565 Ga0068859_100016548
566 Ga0068859_100028791
567 Ga0068864_100000800
568 Ga0068864_100002866
569 Ga0068861_100000147
570 Ga0068861_100001285
571 Ga0068863_100000029
572 Ga0068863_100007211
573 Ga0068863_100008270
574 Ga0068863_100012450
575 Ga0068863_100026289
576 Ga0068863_100124342
577 Ga0068858_100001601
578 Ga0068858_100007582
579 Ga0068860_100000197
580 Ga0068860_100000344
581 Ga0068860_100017565
582 Ga0068860_100113332
583 Ga0068862_100000301
584 Ga0068862_100001039
585 Ga0075368_10000406
586 Ga0075364_10002279
587 Ga0075367_10001156
588 Ga0075369_10041365
589 Ga0075366_10003956
590 Ga0097620_100001571
591 Ga0097620_100005840
592 Ga0097620_100016547
593 Ga0097620_100028791
594 Ga0105240_10000193
595 Ga0105240_10065447
596 Ga0111539_10010815
597 Ga0105245_10329679
598 Ga0105247_10028363
599 Ga0105241_10006942
600 Ga0105241_10015311
601 Ga0105248_10000637
602 Ga0105248_10043207
603 Ga0105248_10087142
604 Ga0105237_10000417
605 Ga0105237_10010588
606 Ga0105237_10013111
607 Ga0105237_10024387
608 Ga0105238_10083291
609 Ga0105238_10196564
610 Ga0105249_10000134
611 Ga0105249_10015277
612 Ga0105249_10058795
613 Ga0105148_100188
614 Ga0105239_10000095
615 Ga0105239_10000482
616 Ga0105246_10087755
617 Ga0157373_10000089
618 Ga0157378_10015228
619 Ga0157378_10215497
620 Ga0163162_10014276
621 Ga0163162_10154038
622 Ga0157372_10449703
623 Ga0157375_10005101
624 Ga0163163_10005212
625 Ga0163163_10023643
626 Ga0157379_10008410
627 Ga0163161_10005717
628 Ga0163161_10060893
629 Ga0209147_100655
630 Ga0207427_100091
631 Ga0209437_100026
632 Ga0207425_1000098
633 Ga0209026_1000991
634 Ga0209129_1008686
635 Ga0209233_1000111
636 Ga0209565_1000011
637 Ga0209565_1000214
638 Ga0209673_1005960
639 Ga0209675_1000025
640 Ga0209675_1005671
641 Ga0209676_1000085
642 Ga0209676_1000148
643 Ga0209676_1000238
644 Ga0209676_1009943
645 Ga0209025_1000413
646 Ga0209025_1017658
647 Ga0209758_1000019
648 Ga0209758_1005664
649 Ga0209050_1000047
650 Ga0209050_1000051
651 Ga0209050_1000217
652 Ga0209050_1000746
653 Ga0209050_1001423
654 Ga0209050_1013624
655 Ga0209256_1000016
656 Ga0209051_1006692
657 Ga0209257_1000028
658 Ga0209257_1000076
659 Ga0209257_1000329
660 Ga0209257_1001016
661 Ga0209257_1001081
662 Ga0209257_1003208
663 Ga0209257_1005761
664 Ga0207710_10004451
665 Ga0207680_10000033
666 Ga0207680_10191453
667 Ga0207654_10010192
668 Ga0207695_10000013
669 Ga0207671_10001597
670 Ga0207671_10005967
671 Ga0207671_10009833
672 Ga0207657_10002548
673 Ga0207646_10193312
674 Ga0207681_10000002
675 Ga0207681_10022283
676 Ga0207694_10043980
677 Ga0207650_10008660
678 Ga0207650_10086894
679 Ga0207650_10159596
680 Ga0207650_10166476
681 Ga0207644_10000002
682 Ga0207644_10001067
683 Ga0207644_10090332
684 Ga0207644_10221926
685 Ga0207690_10001050
686 Ga0207706_10060751
687 Ga0207670_10024346
688 Ga0207711_10002161
689 Ga0207661_10009755
690 Ga0207661_10141665
691 Ga0207667_10000504
692 Ga0207651_10037826
693 Ga0207712_10002209
694 Ga0207712_10150219
695 Ga0207668_10000017
696 Ga0207668_10001089
697 Ga0207668_10002721
698 Ga0207668_10027302
699 Ga0207640_10062529
700 Ga0207658_10000100
701 Ga0207658_10000363
702 Ga0207658_10000662
703 Ga0207658_10021507
704 Ga0207658_10065647
705 Ga0207703_10019468
706 Ga0207703_10085373
707 Ga0207678_10004444
708 Ga0207702_10039175
709 Ga0207641_10000049
710 Ga0207641_10000725
711 Ga0207641_10001638
712 Ga0207641_10002603
713 Ga0207641_10003191
714 Ga0207641_10004422
715 Ga0207641_10008204
716 Ga0207676_10000922
717 Ga0207676_10014472
718 Ga0207674_10026441
719 Ga0207674_10141479
720 Ga0207675_100000082
721 Ga0207675_100002616
722 Ga0207675_100077210
723 Ga0207698_10009374
724 Ga0209813_10000039
725 Ga0209974_10003990
726 Ga0268266_10000033
727 Ga0268266_10070227
728 Ga0268265_10000116
729 Ga0268265_10000200
730 Ga0268264_10000116
731 Ga0268264_10000161
732 Ga0268264_10000190
733 Ga0268264_10122385
734 Ga0307517_10000255
735 Ga0307509_10020337
736 Ga0307509_10111241
737 Ga0307408_100045987
738 Ga0307405_10004587
739 Ga0307405_10050449
740 Ga0307405_10074929
741 Ga0307413_10072175
742 Ga0307406_10137301
743 Ga0307412_10006119
744 Ga0307412_10006659
745 Ga0307412_10006938
746 Ga0307412_10010366
747 Ga0307412_10013048
748 Ga0307416_100011317
749 Ga0307416_100219869
750 Ga0307414_10000462
751 Ga0307414_10034675
752 Ga0307414_10115698
753 Ga0307414_10134316
754 Ga0307411_10066245
755 Ga0316593_10004096
756 Ga0307510_10003311
757 Ga0395905_0109150
758 Ga0395905_0142709
759 Ga0395901_0049482
760 Ga0439436_0013847
761 Ga0439461_0000421
762 Ga0439465_0003794
763 Ga0439431_0001596
764 Ga0439431_0001723
765 Ga0439432_004902
766 Ga0439449_0061648
767 Ga0439462_0000037
768 Ga0439462_0006691
769 Ga0439434_0000921
770 Ga0439434_0012732
771 Ga0466960_0008308
772 Ga0451576_0000007
773 Ga0451576_0098775
774 Ga0495627_000078
775 Ga0495627_000159
776 Ga0495627_002214
777 Ga0495590_0006925
778 Ga0495638_0000011
779 Ga0495650_0001292
780 Ga0495650_0001375
781 Ga0495584_0015497
782 Ga0495596_0000113
783 Ga0495596_0000868
784 Ga0495607_0074252
785 Ga0495583_0000077
786 Ga0495606_0016763
787 Ga0495610_0000044
788 Ga0495610_0000068
789 Ga0495610_0004014
790 Ga0495616_0000180
791 Ga0495632_0000079
792 Ga0495632_0000272
793 Ga0495632_0000834
794 Ga0495637_0001274
795 Ga0495637_0017956
796 Ga0495643_0000030
797 Ga0495643_0027346
798 Ga0495644_0008416
799 Ga0495648_0000023
800 Ga0495648_0026596
801 Ga0495663_0000006
802 Ga0495652_0113344
803 Ga0495654_0041533
804 Ga0495665_0083369
805 Ga0495609_0009931
806 Ga0495633_0000515
807 Ga0495633_0002283
808 Ga0495633_0040112
809 Ga0495633_0054427
810 Ga0495668_0000001
811 Ga0495625_0000240
812 Ga0495625_0001742
813 Ga0495625_0065250
814 Ga0495670_0000056
815 Ga0495671_0000012
816 Ga0495671_0000072
817 Ga0495671_0016660
818 Ga0495671_0041252
819 Ga0495687_033643
820 Ga0495675_0113970
821 Ga0495673_0000029
822 Ga0495681_0000014
823 Ga0495681_0000055
824 Ga0495681_0031291
825 Ga0495686_0013645
826 Ga0495686_0033018
827 Ga0495686_0063379
828 Ga0495615_0000168
829 Ga0496102_0000010
830 Ga0496103_0000029
831 Ga0496108_0001477
832 Ga0496110_0026741
833 Ga0496110_0322693
834 Ga0496111_0106171
835 Ga0496112_0005190
836 Ga0496115_0000218
837 Ga0496116_0000039
838 Ga0496116_0000942
839 Ga0496117_0000037
840 Ga0496117_0012176
841 Ga0496118_0000034
842 Ga0496118_0001130
843 Ga0496118_0036224
844 Ga0496121_0000610
845 Ga0496121_0002847
846 Ga0496121_0036511
847 Ga0496122_0000507
848 Ga0496122_0000841
849 Ga0496122_0006059
850 Ga0496122_0043257
851 Ga0496123_0000518
852 Ga0496123_0001492
853 Ga0496123_0002030
854 Ga0496123_0031439
855 Ga0496124_0000033
856 Ga0496124_0000576
857 Ga0496124_0008527
858 Ga0496124_0041791
859 Ga0496124_0059375
860 Ga0496124_0073682
861 Ga0496125_0028608
862 Ga0496125_0069897
863 Ga0496126_0000041
864 Ga0496126_0078272
865 Ga0501031_0023878
866 Ga0501032_0014552
867 Ga0501032_0042021
868 Ga0501033_0010992
869 Ga0501034_0016722
870 Ga0501036_0033809
871 Ga0501038_0131086
872 Ga0501038_0230616
873 Ga0501039_0010606
874 Ga0501043_0005963
875 Ga0501046_0030301
876 Ga0501047_0001177
877 Ga0501047_0093357
878 Ga0501072_0203951
879 Ga0501223_000002
880 Ga0501223_000538
881 Ga0501224_000005
882 Ga0501233_000398
883 Ga0501235_001456
884 Ga0501235_009311
885 Ga0501249_001085
886 Ga0501255_001681
887 Ga0501257_000103
888 Ga0501225_0000257
889 Ga0501225_0000385
890 Ga0501225_0007226
891 Ga0501080_0129703
892 Ga0501083_0011181
893 Ga0501282_000049
894 Ga0501035_0016069
895 Ga0501044_0037278
896 Ga0501044_0054206
897 Ga0501204_001505
898 Ga0501226_000299
899 nmdc:mga00v17_5693_c1
900 nmdc:mga0k408_8127_c1
901 nmdc:mga06z11_94_c1
902 nmdc:mga04h51_50_c1
903 nmdc:mga07m45_109513_c1
904 nmdc:mga07m45_84336_c1
905 nmdc:mga08y16_69099_c1
906 nmdc:mga0sz30_16435_c1
907 nmdc:mga0sz30_5071_c2
908 Ga0500635_0002934
909 Ga0500643_000066
910 Ga0500643_000084
911 Ga0500643_000760
912 Ga0500643_003130
913 Ga0500643_007751
914 Ga0500566_0007510
915 Ga0500641_0008295
916 Ga0500556_0000049
917 Ga0500592_000112
918 Ga0500592_001930
919 Ga0500607_001050
920 Ga0500608_000402
921 Ga0500608_013371
922 Ga0500642_0000002
923 Ga0500658_0004942
924 Ga0500658_0011990
925 Ga0500559_0000905
926 Ga0500559_0002867
927 Ga0500559_0006809
928 Ga0500568_0003373
929 Ga0500573_0000089
930 Ga0500604_0000520
931 Ga0500624_000042
932 Ga0500624_000590
933 Ga0500627_0000057
934 Ga0500627_0000436
935 Ga0500627_0000476
936 Ga0500636_0052586
937 Ga0500637_0033522
938 Ga0500567_000239
939 Ga0500625_000006
940 Ga0500645_008055
941 Ga0500596_003337
942 Ga0501084_0017698
943 Ga0500661_000114
944 2511128772
945 2512643788
946 2600227447
947 2643729268
948 2643823025
949 2643835486
950 2644040687
951 2644045744
952 2644056412
953 2644127930
954 2644393321
955 2739649965
956 2739793163
957 2740028438
958 2778124705
959 2809064264
960 2809080232
961 2809084596
962 2819550604
963 2819715975
964 2852655084
965 2852681445
966 2866553997
967 2879165120
968 2880522168
969 2882807938
970 2919712181
971 2928031034
972 2928531178
973 2928970561
974 8054305717

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07687

M20_dimer

Peptidase dimerisation domain

268

373

0.93

PF01546

Peptidase_M20

Peptidase family M20/M25/M40

151

460

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ewt-assembly1.cif.gz_B the crystal structure of a putative aminohydrolase from methicillin resistant staphylococcus aureus 0.9354 52 460
4ewt-assembly1.cif.gz_B the crystal structure of a putative aminohydrolase from methicillin resistant staphylococcus aureus 0.921 52 460
1ysj-assembly1.cif.gz_B crystal structure of bacillus subtilis yxep protein (apc1829), a dinuclear metal binding peptidase from m20 family 0.9193 59 462
1ysj-assembly1.cif.gz_A crystal structure of bacillus subtilis yxep protein (apc1829), a dinuclear metal binding peptidase from m20 family 0.9164 59 462
4ewt-assembly1.cif.gz_D the crystal structure of a putative aminohydrolase from methicillin resistant staphylococcus aureus 0.9143 51 463
ID Description Score Start End Superfamily
af_Q7XUA8_201_320_3.40.630.10 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.9398 240 360 3.40.630.10
4ewtD02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9375 240 356 3.30.70.360
af_A0A0R0IPM0_41_149_3.30.70.360 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9343 241 354 3.30.70.360
2q43A01 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.9312 57 462 3.40.630.10
4ewtB01 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.9262 51 460 3.40.630.10
ID Description Score Start End GO Terms
AF-A0A2N3ATI6-F1-model_v4 Amidohydrolase 0.9855 61 465 GO:0016787
GO:0046872
AF-A0A0Q0CIH7-F1-model_v4 Amidohydrolase 0.9852 55 178 GO:0016787
AF-A0A3C1KFH2-F1-model_v4 Amidohydrolase 0.9825 62 235 GO:0016787
AF-A0A2V5KCZ0-F1-model_v4 Amidohydrolase 0.9782 201 464 GO:0016787
AF-A0A534NAK6-F1-model_v4 Amidohydrolase 0.9776 55 354 GO:0016787

Map