F453513

General Info

Members Datasets Scaffolds Average Seq Length
487 241 482 420

Family's Representative Sequence

Representative Sequence 3300053080|Ga0500635_0000110|Ga0500635_0000110_6587_8029
Length 480
Sequence MQDPRQIAKEGYRRTAVARKCALRENAAIIYQMPFVAAPAVSPDSLAPAADSAPLNAGAGSLADLAQRERFLEALAQGLADGSATRVLFSKPTAKDDDLERVTARPLVLRGERCLSFVFKHRTKDITKNEPVAAALETIEGLVGTRFAHAHLFTHDAELQLMMSRKGRYTMHRAKANVDDATRTAVVAASDEDGAQHDRQKHRFLSLDAPFLAELGVTTPRHELVPAMARKWKQINKFVEVMSHALESAGVGATAPLNIVDFGAGKGYLTFALHDYLRRQAAGAPRALDIVGVELRPDLVTLCNDAIAKCRLQGLRFEAGDVSSFVPERLDVMIALHACDTATDHALHTGIRAGASIIMCSPCCHKQIRPQMQMPSLLKPMLQHGIHLGQQAEMVTDGLRALLLEAHGYDAQVFEFVALEHTSKNKMILAVRRKGRQDTPQAQRRRADVLAQIAELKAFYGIREHCLETLLAAPAQALPA

Samples

Sample ID Description Type Environment
1 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
2 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
3 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
4 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
5 2738541337 Pelomonas sp. BT06 Isolate Unclassified
6 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
7 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
8 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
9 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
12 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
13 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
14 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
15 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
16 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
17 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
18 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
19 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
20 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
21 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
22 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
23 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
24 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
25 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
26 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
27 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
28 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
29 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
30 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
31 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
32 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
33 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
34 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
35 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
36 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
37 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
38 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
65 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
66 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
67 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
83 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
91 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
92 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
93 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
94 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
95 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
96 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
99 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
101 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
102 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
104 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
153 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
154 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
155 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
156 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
157 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
158 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
159 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
160 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
161 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
162 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
163 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
164 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
165 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
166 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
167 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
168 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
169 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
170 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
171 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
172 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
173 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
174 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
175 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
176 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
177 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
178 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
179 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
180 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
181 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
182 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
183 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
184 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
185 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
186 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
187 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
188 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
189 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
190 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
191 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
192 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
193 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
194 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
195 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
196 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
197 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
198 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
199 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
200 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
201 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
202 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
203 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
204 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
205 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
206 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
207 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
208 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
209 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
210 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
211 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
212 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
213 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
214 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
215 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
216 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
217 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
218 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
219 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
220 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
221 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
222 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
223 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
224 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
225 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
226 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
227 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
228 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
229 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
230 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
231 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
232 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
233 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
234 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
235 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
236 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
237 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
238 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
239 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
240 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
241 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.97
Metatranscriptomes 0
Isolates 1.03

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.11
Nodule 0
Rhizoplane 2.26
Rhizosphere 78.64
Stem 0
Stem Tuber 0
Unclassified 6.98

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25156J39149_1002039 3300002705 Bacteria 7702
2 JGI25154J39366_1003088 3300002738 Bacteria 3740
3 JGI25157J39369_1000289 3300002741 Bacteria 36586
4 rootH2_10038858 3300003320 Bacteria 8695
5 rootH1_10021727 3300003323 Bacteria 5669
6 Ga0055539_1000278 3300003752 Bacteria 29564
7 Ga0055533_1000026 3300003756 Bacteria 323407
8 Ga0055525_1000004 3300003759 Bacteria 888039
9 Ga0055535_1000163 3300003761 Bacteria 71841
10 Ga0055529_1000278 3300003763 Bacteria 61095
11 Ga0055540_1011351 3300003792 Bacteria 2881
12 Ga0065165_1017765 3300005262 Bacteria 2606
13 Ga0070658_10045785 3300005327 Bacteria 3538
14 Ga0070676_10001334 3300005328 Bacteria 12393
15 Ga0070676_10004760 3300005328 Bacteria 7174
16 Ga0070676_10009760 3300005328 Bacteria 5193
17 Ga0070676_10037810 3300005328 Bacteria 2785
18 Ga0070683_100067455 3300005329 Bacteria 3332
19 Ga0070690_100007891 3300005330 Bacteria 6105
20 Ga0070690_100145437 3300005330 Bacteria 1612
21 Ga0070670_100007679 3300005331 Bacteria 9166
22 Ga0070670_100007959 3300005331 Bacteria 9016
23 Ga0070670_100011885 3300005331 Bacteria 7445
24 Ga0070670_100013527 3300005331 Bacteria 6993
25 Ga0070670_100033279 3300005331 Bacteria 4440
26 Ga0070670_100069393 3300005331 Bacteria 3025
27 Ga0070670_100089787 3300005331 Bacteria 2641
28 Ga0070670_100151383 3300005331 Bacteria 2008
29 Ga0070677_10006811 3300005333 Bacteria 3798
30 Ga0070677_10018563 3300005333 Bacteria 2506
31 Ga0068869_100001761 3300005334 Bacteria 12948
32 Ga0068869_100003785 3300005334 Bacteria 9322
33 Ga0068869_100027862 3300005334 Bacteria 3942
34 Ga0068869_100075208 3300005334 Bacteria 2509
35 Ga0070666_10002852 3300005335 Bacteria 10445
36 Ga0070680_100007136 3300005336 Bacteria 8514
37 Ga0070682_100037805 3300005337 Bacteria 2957
38 Ga0068868_100001350 3300005338 Bacteria 16911
39 Ga0068868_100029620 3300005338 Bacteria 4193
40 Ga0070660_100078687 3300005339 Bacteria 2585
41 Ga0070660_100200222 3300005339 Bacteria 1620
42 Ga0070661_100078728 3300005344 Bacteria 2432
43 Ga0070668_100007743 3300005347 Bacteria 7974
44 Ga0070669_100002211 3300005353 Bacteria 14098
45 Ga0070669_100085672 3300005353 Bacteria 2353
46 Ga0070669_100131506 3300005353 Bacteria 1920
47 Ga0070669_100255721 3300005353 Bacteria 1396
48 Ga0070675_100002027 3300005354 Bacteria 15027
49 Ga0070675_100003621 3300005354 Bacteria 11755
50 Ga0070675_100007426 3300005354 Bacteria 8468
51 Ga0070675_100035230 3300005354 Bacteria 4066
52 Ga0070675_100055415 3300005354 Bacteria 3263
53 Ga0070675_100067838 3300005354 Bacteria 2952
54 Ga0070675_100094179 3300005354 Bacteria 2513
55 Ga0070675_100160545 3300005354 Bacteria 1933
56 Ga0070671_100000437 3300005355 Bacteria 28930
57 Ga0070671_100049662 3300005355 Bacteria 3490
58 Ga0070671_100085232 3300005355 Bacteria 2643
59 Ga0070671_100198789 3300005355 Bacteria 1700
60 Ga0070674_100000965 3300005356 Bacteria 14986
61 Ga0070674_100015072 3300005356 Bacteria 4819
62 Ga0070674_100026659 3300005356 Bacteria 3778
63 Ga0070674_100089350 3300005356 Bacteria 2219
64 Ga0070673_100000957 3300005364 Bacteria 16367
65 Ga0070673_100104517 3300005364 Bacteria 2339
66 Ga0070673_100191325 3300005364 Bacteria 1758
67 Ga0070659_100067958 3300005366 Bacteria 2826
68 Ga0070659_100158552 3300005366 Bacteria 1849
69 Ga0070667_100002738 3300005367 Bacteria 15240
70 Ga0070667_100054700 3300005367 Bacteria 3370
71 Ga0070667_100082813 3300005367 Bacteria 2747
72 Ga0070667_100143509 3300005367 Bacteria 2093
73 Ga0070678_100015003 3300005456 Bacteria 4907
74 Ga0070678_100050364 3300005456 Bacteria 3012
75 Ga0070678_100053928 3300005456 Bacteria 2927
76 Ga0070678_100079120 3300005456 Bacteria 2485
77 Ga0070678_100204384 3300005456 Bacteria 1632
78 Ga0070678_100228666 3300005456 Bacteria 1549
79 Ga0070662_100004128 3300005457 Bacteria 9135
80 Ga0070662_100023060 3300005457 Bacteria 4272
81 Ga0070662_100042390 3300005457 Bacteria 3251
82 Ga0070662_100186708 3300005457 Bacteria 1637
83 Ga0070662_100215722 3300005457 Bacteria 1529
84 Ga0070681_10045717 3300005458 Bacteria 4379
85 Ga0068867_100001658 3300005459 Bacteria 15497
86 Ga0068867_100003930 3300005459 Bacteria 10463
87 Ga0068867_100012995 3300005459 Bacteria 5892
88 Ga0068867_100051536 3300005459 Bacteria 3036
89 Ga0070685_10142394 3300005466 Bacteria 1511
90 Ga0070706_100000873 3300005467 Bacteria 33089
91 Ga0070679_100005395 3300005530 Bacteria 11845
92 Ga0070684_100033638 3300005535 Bacteria 4378
93 Ga0068853_100202944 3300005539 Bacteria 1805
94 Ga0070672_100001237 3300005543 Bacteria 15684
95 Ga0070672_100003309 3300005543 Bacteria 10434
96 Ga0070672_100022617 3300005543 Bacteria 4622
97 Ga0070672_100043274 3300005543 Bacteria 3471
98 Ga0070672_100082357 3300005543 Bacteria 2581
99 Ga0068855_100002188 3300005563 Bacteria 24162
100 Ga0068855_100029336 3300005563 Bacteria 6578
101 Ga0068855_100072709 3300005563 Bacteria 3996
102 Ga0070664_100002594 3300005564 Bacteria 14577
103 Ga0070664_100092663 3300005564 Bacteria 2616
104 Ga0068857_100025125 3300005577 Bacteria 5246
105 Ga0068857_100031528 3300005577 Bacteria 4684
106 Ga0068854_100032157 3300005578 Bacteria 3648
107 Ga0068856_100011448 3300005614 Bacteria 8608
108 Ga0068856_100034931 3300005614 Bacteria 4926
109 Ga0070702_100122269 3300005615 Bacteria 1631
110 Ga0068852_100007596 3300005616 Bacteria 7927
111 Ga0068852_100020723 3300005616 Bacteria 5231
112 Ga0068852_100032621 3300005616 Bacteria 4314
113 Ga0068859_100066707 3300005617 Bacteria 3634
114 Ga0068864_100002345 3300005618 Bacteria 15657
115 Ga0068864_100002677 3300005618 Bacteria 14698
116 Ga0068864_100003775 3300005618 Bacteria 12497
117 Ga0068864_100004227 3300005618 Bacteria 11819
118 Ga0068864_100013261 3300005618 Bacteria 6827
119 Ga0068864_100087455 3300005618 Bacteria 2743
120 Ga0068861_100002811 3300005719 Bacteria 11447
121 Ga0068861_100006197 3300005719 Bacteria 8139
122 Ga0068861_100023098 3300005719 Bacteria 4483
123 Ga0068851_10008810 3300005834 Bacteria 4675
124 Ga0068851_10011296 3300005834 Bacteria 4186
125 Ga0068863_100004699 3300005841 Bacteria 13460
126 Ga0068863_100009890 3300005841 Bacteria 9287
127 Ga0068863_100018040 3300005841 Bacteria 6757
128 Ga0068858_100003848 3300005842 Bacteria 14837
129 Ga0068858_100004714 3300005842 Bacteria 13353
130 Ga0068858_100010462 3300005842 Bacteria 8788
131 Ga0068858_100020636 3300005842 Bacteria 6156
132 Ga0068860_100005300 3300005843 Bacteria 13093
133 Ga0068860_100005363 3300005843 Bacteria 13014
134 Ga0068860_100162965 3300005843 Bacteria 2150
135 Ga0068862_100025829 3300005844 Bacteria 4932
136 Ga0075363_100053330 3300006048 Bacteria 2161
137 Ga0075363_100057579 3300006048 Bacteria 2086
138 Ga0075362_10061007 3300006177 Bacteria 1705
139 Ga0075367_10018886 3300006178 Bacteria 3811
140 Ga0075367_10024391 3300006178 Bacteria 3410
141 Ga0075366_10003855 3300006195 Bacteria 7988
142 Ga0075366_10009852 3300006195 Bacteria 5345
143 Ga0075366_10010161 3300006195 Bacteria 5280
144 Ga0075366_10014618 3300006195 Bacteria 4485
145 Ga0075366_10016305 3300006195 Bacteria 4269
146 Ga0075366_10032590 3300006195 Bacteria 3067
147 Ga0097621_100003869 3300006237 Bacteria 10373
148 Ga0097621_100005342 3300006237 Bacteria 9046
149 Ga0097621_100012725 3300006237 Bacteria 6251
150 Ga0097621_100021800 3300006237 Bacteria 4964
151 Ga0075370_10000414 3300006353 Bacteria 15762
152 Ga0075370_10002136 3300006353 Bacteria 9035
153 Ga0075370_10003303 3300006353 Bacteria 7653
154 Ga0075370_10051294 3300006353 Bacteria 2340
155 Ga0068871_100012846 3300006358 Bacteria 6199
156 Ga0068871_100111176 3300006358 Bacteria 2304
157 Ga0068865_100002020 3300006881 Bacteria 11969
158 Ga0068865_100037287 3300006881 Bacteria 3282
159 Ga0097620_100066707 3300006931 Bacteria 3634
160 Ga0105240_10023285 3300009093 Bacteria 8196
161 Ga0105240_10112120 3300009093 Bacteria 3298
162 Ga0105245_10026508 3300009098 Bacteria 5102
163 Ga0105243_10037336 3300009148 Bacteria 3775
164 Ga0105243_10071989 3300009148 Bacteria 2797
165 Ga0105248_10006661 3300009177 Bacteria 12674
166 Ga0105248_10015607 3300009177 Bacteria 8373
167 Ga0105248_10030887 3300009177 Bacteria 5984
168 Ga0105248_10065141 3300009177 Bacteria 4091
169 Ga0105248_10173538 3300009177 Bacteria 2430
170 Ga0105237_10000529 3300009545 Bacteria 53671
171 Ga0105237_10152202 3300009545 Bacteria 2310
172 Ga0105238_10006779 3300009551 Bacteria 11443
173 Ga0105249_10028713 3300009553 Bacteria 5021
174 Ga0105239_10425085 3300010375 Bacteria 1505
175 Ga0105246_10041347 3300011119 Bacteria 3115
176 Ga0157370_10102175 3300013104 Bacteria 2685
177 Ga0157369_10006148 3300013105 Bacteria 13931
178 Ga0157369_10226307 3300013105 Bacteria 1956
179 Ga0157374_10035585 3300013296 Bacteria 4556
180 Ga0157374_10078384 3300013296 Bacteria 3129
181 Ga0157374_10086317 3300013296 Bacteria 2985
182 Ga0157378_10091000 3300013297 Bacteria 2773
183 Ga0157378_10216498 3300013297 Bacteria 1819
184 Ga0163162_10004467 3300013306 Bacteria 13476
185 Ga0163162_10019378 3300013306 Bacteria 6673
186 Ga0157372_10019500 3300013307 Bacteria 7313
187 Ga0157375_10001941 3300013308 Bacteria 17817
188 Ga0157375_10003094 3300013308 Bacteria 14445
189 Ga0157375_10003497 3300013308 Bacteria 13616
190 Ga0157375_10088288 3300013308 Bacteria 3155
191 Ga0163163_10019043 3300014325 Bacteria 6441
192 Ga0163163_10212865 3300014325 Bacteria 1982
193 Ga0157380_10001564 3300014326 Bacteria 15067
194 Ga0157380_10025557 3300014326 Bacteria 4478
195 Ga0157377_10000433 3300014745 Bacteria 18071
196 Ga0157379_10007064 3300014968 Bacteria 9706
197 Ga0157379_10010571 3300014968 Bacteria 8048
198 Ga0157379_10047949 3300014968 Bacteria 3813
199 Ga0157376_10009056 3300014969 Bacteria 7212
200 Ga0157376_10053319 3300014969 Bacteria 3367
201 Ga0157376_10077374 3300014969 Bacteria 2845
202 Ga0157376_10251692 3300014969 Bacteria 1650
203 Ga0157376_10255808 3300014969 Bacteria 1638
204 Ga0163161_10007201 3300017792 Bacteria 7688
205 Ga0163161_10037492 3300017792 Bacteria 3475
206 Ga0163161_10110310 3300017792 Bacteria 2056
207 Ga0213872_10000003 3300021361 Bacteria 366948
208 Ga0213872_10000007 3300021361 Bacteria 228206
209 Ga0213872_10000163 3300021361 Bacteria 61122
210 Ga0213872_10000376 3300021361 Bacteria 37531
211 Ga0209674_100024 3300025226 Bacteria 535481
212 Ga0209563_100013 3300025230 Bacteria 941463
213 Ga0209563_100069 3300025230 Bacteria 253154
214 Ga0207427_100422 3300025231 Bacteria 24068
215 Ga0209258_100080 3300025242 Bacteria 255287
216 Ga0209258_102580 3300025242 Bacteria 4544
217 Ga0209646_1000012 3300025246 Bacteria 573300
218 Ga0209026_1000004 3300025250 Bacteria 949012
219 Ga0209677_100048 3300025253 Bacteria 183563
220 Ga0209677_100184 3300025253 Bacteria 51898
221 Ga0209677_103310 3300025253 Bacteria 5320
222 Ga0209759_1000003 3300025256 Bacteria 792130
223 Ga0209759_1000067 3300025256 Bacteria 183764
224 Ga0209759_1000655 3300025256 Bacteria 32102
225 Ga0209759_1001607 3300025256 Bacteria 12125
226 Ga0209455_1000030 3300025272 Bacteria 533479
227 Ga0209051_1011987 3300025303 Bacteria 4230
228 Ga0209051_1025496 3300025303 Bacteria 2404
229 Ga0209051_1048632 3300025303 Bacteria 1436
230 Ga0207682_10005576 3300025893 Bacteria 5117
231 Ga0207682_10007552 3300025893 Bacteria 4327
232 Ga0207682_10011243 3300025893 Bacteria 3498
233 Ga0207682_10024588 3300025893 Bacteria 2386
234 Ga0207642_10001813 3300025899 Bacteria 6604
235 Ga0207642_10071083 3300025899 Bacteria 1656
236 Ga0207680_10010356 3300025903 Bacteria 4662
237 Ga0207685_10049433 3300025905 Bacteria 1615
238 Ga0207645_10000870 3300025907 Bacteria 25116
239 Ga0207645_10002088 3300025907 Bacteria 15984
240 Ga0207645_10004592 3300025907 Bacteria 10183
241 Ga0207645_10019662 3300025907 Bacteria 4427
242 Ga0207645_10029105 3300025907 Bacteria 3562
243 Ga0207643_10029590 3300025908 Bacteria 3046
244 Ga0207707_10031988 3300025912 Bacteria 4606
245 Ga0207695_10004136 3300025913 Bacteria 19925
246 Ga0207662_10095229 3300025918 Bacteria 1837
247 Ga0207657_10025656 3300025919 Bacteria 5430
248 Ga0207657_10059522 3300025919 Bacteria 3281
249 Ga0207649_10001580 3300025920 Bacteria 13267
250 Ga0207649_10046929 3300025920 Bacteria 2656
251 Ga0207652_10013046 3300025921 Bacteria 6725
252 Ga0207681_10000967 3300025923 Bacteria 18742
253 Ga0207681_10088644 3300025923 Bacteria 2204
254 Ga0207650_10006010 3300025925 Bacteria 8283
255 Ga0207650_10009880 3300025925 Bacteria 6527
256 Ga0207650_10014689 3300025925 Bacteria 5441
257 Ga0207650_10101601 3300025925 Bacteria 2214
258 Ga0207659_10000963 3300025926 Bacteria 17179
259 Ga0207659_10015889 3300025926 Bacteria 4890
260 Ga0207659_10102134 3300025926 Bacteria 2164
261 Ga0207659_10105807 3300025926 Bacteria 2129
262 Ga0207659_10124447 3300025926 Bacteria 1981
263 Ga0207644_10000278 3300025931 Bacteria 33992
264 Ga0207644_10022498 3300025931 Bacteria 4307
265 Ga0207644_10112367 3300025931 Bacteria 2062
266 Ga0207690_10029707 3300025932 Bacteria 3478
267 Ga0207690_10043057 3300025932 Bacteria 2969
268 Ga0207690_10057352 3300025932 Bacteria 2631
269 Ga0207706_10011095 3300025933 Bacteria 8213
270 Ga0207706_10011458 3300025933 Bacteria 8075
271 Ga0207706_10013502 3300025933 Bacteria 7423
272 Ga0207706_10038294 3300025933 Bacteria 4254
273 Ga0207709_10019522 3300025935 Bacteria 3813
274 Ga0207669_10020052 3300025937 Bacteria 3496
275 Ga0207704_10144967 3300025938 Bacteria 1667
276 Ga0207665_10129942 3300025939 Bacteria 1787
277 Ga0207691_10000229 3300025940 Bacteria 54461
278 Ga0207691_10006361 3300025940 Bacteria 11410
279 Ga0207691_10010278 3300025940 Bacteria 8977
280 Ga0207691_10041139 3300025940 Bacteria 4269
281 Ga0207691_10067151 3300025940 Bacteria 3243
282 Ga0207691_10106912 3300025940 Bacteria 2491
283 Ga0207691_10121211 3300025940 Bacteria 2318
284 Ga0207711_10009959 3300025941 Bacteria 7898
285 Ga0207711_10019406 3300025941 Bacteria 5661
286 Ga0207711_10038028 3300025941 Bacteria 4091
287 Ga0207711_10055496 3300025941 Bacteria 3401
288 Ga0207711_10202662 3300025941 Bacteria 1811
289 Ga0207689_10000259 3300025942 Bacteria 47474
290 Ga0207689_10008584 3300025942 Bacteria 8902
291 Ga0207689_10029100 3300025942 Bacteria 4617
292 Ga0207689_10090984 3300025942 Bacteria 2507
293 Ga0207679_10181963 3300025945 Bacteria 1739
294 Ga0207679_10209841 3300025945 Bacteria 1632
295 Ga0207667_10001981 3300025949 Bacteria 25666
296 Ga0207667_10088066 3300025949 Bacteria 3211
297 Ga0207651_10000390 3300025960 Bacteria 18670
298 Ga0207651_10072480 3300025960 Bacteria 2445
299 Ga0207651_10149425 3300025960 Bacteria 1816
300 Ga0207651_10180057 3300025960 Bacteria 1676
301 Ga0207668_10047628 3300025972 Bacteria 2936
302 Ga0207658_10002231 3300025986 Bacteria 14379
303 Ga0207658_10024606 3300025986 Bacteria 4213
304 Ga0207677_10000880 3300026023 Bacteria 16941
305 Ga0207677_10011633 3300026023 Bacteria 5024
306 Ga0207677_10021826 3300026023 Bacteria 3922
307 Ga0207677_10111697 3300026023 Bacteria 2037
308 Ga0207703_10000382 3300026035 Bacteria 47374
309 Ga0207639_10044960 3300026041 Bacteria 3323
310 Ga0207639_10046752 3300026041 Bacteria 3267
311 Ga0207639_10213827 3300026041 Bacteria 1661
312 Ga0207678_10084856 3300026067 Bacteria 2708
313 Ga0207702_10005642 3300026078 Bacteria 10914
314 Ga0207702_10006602 3300026078 Bacteria 9975
315 Ga0207702_10018263 3300026078 Bacteria 5801
316 Ga0207702_10074311 3300026078 Bacteria 2934
317 Ga0207641_10006486 3300026088 Bacteria 9852
318 Ga0207641_10011245 3300026088 Bacteria 7341
319 Ga0207641_10069069 3300026088 Bacteria 3031
320 Ga0207648_10003517 3300026089 Bacteria 16406
321 Ga0207648_10008771 3300026089 Bacteria 9745
322 Ga0207648_10035109 3300026089 Bacteria 4420
323 Ga0207648_10060435 3300026089 Bacteria 3305
324 Ga0207648_10190238 3300026089 Bacteria 1818
325 Ga0207676_10000221 3300026095 Bacteria 49106
326 Ga0207676_10013022 3300026095 Bacteria 5972
327 Ga0207674_10009884 3300026116 Bacteria 10854
328 Ga0207674_10012008 3300026116 Bacteria 9705
329 Ga0207674_10038976 3300026116 Bacteria 4928
330 Ga0207674_10109709 3300026116 Bacteria 2735
331 Ga0207675_100000307 3300026118 Bacteria 46857
332 Ga0207675_100001416 3300026118 Bacteria 24021
333 Ga0207675_100030939 3300026118 Bacteria 4985
334 Ga0207675_100033255 3300026118 Bacteria 4805
335 Ga0207683_10003264 3300026121 Bacteria 14146
336 Ga0207683_10009129 3300026121 Bacteria 8451
337 Ga0207683_10009222 3300026121 Bacteria 8409
338 Ga0207683_10011351 3300026121 Bacteria 7601
339 Ga0207683_10044891 3300026121 Bacteria 3864
340 Ga0207683_10105127 3300026121 Bacteria 2524
341 Ga0207683_10136896 3300026121 Bacteria 2205
342 Ga0207698_10001108 3300026142 Bacteria 15701
343 Ga0207698_10017839 3300026142 Bacteria 4824
344 Ga0207698_10022030 3300026142 Bacteria 4419
345 Ga0207698_10127571 3300026142 Bacteria 2167
346 Ga0209968_1000634 3300027526 Bacteria 5412
347 Ga0209966_1000288 3300027695 Bacteria 17237
348 Ga0268265_10021062 3300028380 Bacteria 4561
349 Ga0268264_10004913 3300028381 Bacteria 11330
350 Ga0268264_10019419 3300028381 Bacteria 5554
351 Ga0265336_10000083 3300028666 Bacteria 75113
352 Ga0307517_10008069 3300028786 Bacteria 15177
353 Ga0307517_10148427 3300028786 Bacteria 1618
354 Ga0307515_10025831 3300028794 Bacteria 10139
355 Ga0265324_10003255 3300029957 Bacteria 7817
356 Ga0307511_10090894 3300030521 Bacteria 2070
357 Ga0307512_10066557 3300030522 Bacteria 2721
358 Ga0265331_10010224 3300031250 Bacteria 5203
359 Ga0265327_10000012 3300031251 Bacteria 530403
360 Ga0307513_10032823 3300031456 Bacteria 5847
361 Ga0307509_10002906 3300031507 Bacteria 27071
362 Ga0307408_100000109 3300031548 Bacteria 91284
363 Ga0307408_100224666 3300031548 Bacteria 1534
364 Ga0307508_10000222 3300031616 Bacteria 69029
365 Ga0307508_10016751 3300031616 Bacteria 6668
366 Ga0307508_10058972 3300031616 Bacteria 3395
367 Ga0307514_10001848 3300031649 Bacteria 23434
368 Ga0307516_10000662 3300031730 Bacteria 46543
369 Ga0307516_10011476 3300031730 Bacteria 9620
370 Ga0307516_10056108 3300031730 Bacteria 3842
371 Ga0307516_10111433 3300031730 Bacteria 2538
372 Ga0307405_10015575 3300031731 Bacteria 4123
373 Ga0307405_10018973 3300031731 Bacteria 3809
374 Ga0307410_10025659 3300031852 Bacteria 3700
375 Ga0307409_100072378 3300031995 Bacteria 2745
376 Ga0307416_100018756 3300032002 Bacteria 4884
377 Ga0307415_100001031 3300032126 Bacteria 12888
378 Ga0307510_10040707 3300033180 Bacteria 5096
379 Ga0373944_0037576 3300035089 Bacteria 1484
380 Ga0373939_0000055 3300035114 Bacteria 39731
381 Ga0373960_0000419 3300035121 Bacteria 8329
382 Ga0373946_0025759 3300035171 Bacteria 2315
383 Ga0373924_0026612 3300035410 Bacteria 2295
384 Ga0373931_0000216 3300035691 Bacteria 24466
385 Ga0373931_0051114 3300035691 Bacteria 2200
386 Ga0373947_0020189 3300035725 Bacteria 3845
387 Ga0373937_0081817 3300036401 Bacteria 2987
388 Ga0373937_0209434 3300036401 Bacteria 1834
389 Ga0373937_0268986 3300036401 Bacteria 1608
390 Ga0373925_0033167 3300037068 Bacteria 3806
391 Ga0373925_0112278 3300037068 Bacteria 2107
392 Ga0395898_0012449 3300037466 Bacteria 8795
393 Ga0395905_0001260 3300037471 Bacteria 31303
394 Ga0395901_0035246 3300038443 Bacteria 5170
395 Ga0436361_0163583 3300039447 Bacteria 173204
396 Ga0436361_0408289 3300039447 Bacteria 30886
397 Ga0436361_0528289 3300039447 Bacteria 1783
398 Ga0436361_0832058 3300039447 Bacteria 3478
399 Ga0436361_0914279 3300039447 Bacteria 37603
400 Ga0436361_1061851 3300039447 Bacteria 60009
401 Ga0436361_1143259 3300039447 Bacteria 4001
402 Ga0436361_1151650 3300039447 Bacteria 3135
403 Ga0436361_1175466 3300039447 Bacteria 1984
404 Ga0450890_000464 3300042127 Bacteria 5947
405 Ga0450892_000559 3300042130 Bacteria 4279
406 Ga0450893_0004552 3300042532 Bacteria 2208
407 Ga0451577_0001417 3300042876 Bacteria 31981
408 Ga0451577_0003947 3300042876 Bacteria 16007
409 Ga0451577_0043425 3300042876 Bacteria 4027
410 Ga0466966_0001886 3300044684 Bacteria 13605
411 Ga0466961_0023932 3300044693 Bacteria 3929
412 Ga0466964_0024325 3300044706 Bacteria 2360
413 Ga0453684_0308114 3300044712 Bacteria 1798
414 Ga0466970_0054944 3300044765 Bacteria 2126
415 Ga0466959_0004015 3300045049 Bacteria 9777
416 Ga0451576_0119633 3300045051 Bacteria 2742
417 Ga0466967_0020814 3300045976 Bacteria 5313
418 Ga0466967_0049988 3300045976 Bacteria 3659
419 Ga0495592_0000322 3300046454 Bacteria 40072
420 Ga0495629_0054567 3300046459 Bacteria 2795
421 Ga0495629_0100478 3300046459 Bacteria 2019
422 Ga0495650_0002544 3300046471 Bacteria 14530
423 Ga0495585_0022433 3300046492 Bacteria 3624
424 Ga0495583_0000022 3300046506 Bacteria 282544
425 Ga0495606_0002246 3300046507 Bacteria 22999
426 Ga0495630_0015221 3300046517 Bacteria 5612
427 Ga0495632_0017543 3300046519 Bacteria 3947
428 Ga0495645_0088941 3300046543 Bacteria 2208
429 Ga0495668_0018220 3300046616 Bacteria 4059
430 Ga0495668_0028624 3300046616 Bacteria 3151
431 Ga0495625_0006378 3300046660 Bacteria 10523
432 Ga0495625_0036918 3300046660 Bacteria 3587
433 Ga0495658_0063173 3300046683 Bacteria 2130
434 Ga0495658_0090717 3300046683 Bacteria 1809
435 Ga0495669_0005520 3300046684 Bacteria 5278
436 Ga0495624_0006839 3300046690 Bacteria 8049
437 Ga0495649_0008009 3300046694 Bacteria 6386
438 Ga0495589_0012391 3300046794 Bacteria 4416
439 Ga0495660_0058210 3300046810 Bacteria 2082
440 Ga0495687_000330 3300047443 Bacteria 60838
441 Ga0495686_0000980 3300047472 Bacteria 34946
442 Ga0495686_0038640 3300047472 Bacteria 3051
443 Ga0496102_0002816 3300048905 Bacteria 14813
444 Ga0496104_0007556 3300048907 Bacteria 9614
445 Ga0496106_0177755 3300048909 Bacteria 1689
446 Ga0496107_0063828 3300048910 Bacteria 2669
447 Ga0496108_0002823 3300048911 Bacteria 13938
448 Ga0496108_0048212 3300048911 Bacteria 3561
449 Ga0496108_0113475 3300048911 Bacteria 2319
450 Ga0496110_0301244 3300048913 Bacteria 1460
451 Ga0496113_0078407 3300048916 Bacteria 2527
452 Ga0496114_0125946 3300048917 Bacteria 2208
453 Ga0496115_0005403 3300048918 Bacteria 9291
454 Ga0496121_0080298 3300048924 Bacteria 2586
455 Ga0496124_0003153 3300048927 Bacteria 20392
456 Ga0496125_0003117 3300048928 Bacteria 20619
457 nmdc:mga03683_22743_c1 3300050489 Bacteria 2433
458 nmdc:mga03683_2487_c1 3300050489 Bacteria 5732
459 nmdc:mga0k408_10926_c1 3300050493 Bacteria 2369
460 nmdc:mga0k408_1110_c1 3300050493 Bacteria 14744
461 nmdc:mga0k408_1324_c1 3300050493 Bacteria 13382
462 nmdc:mga0k408_2616_c1 3300050493 Bacteria 9566
463 nmdc:mga0k408_42338_c1 3300050493 Bacteria 2623
464 nmdc:mga0k408_6633_c1 3300050493 Bacteria 6171
465 nmdc:mga06z11_3260_c1 3300050494 Bacteria 6273
466 nmdc:mga06z11_73271_c1 3300050494 Bacteria 1818
467 nmdc:mga04h51_2183_c1 3300050495 Bacteria 4591
468 nmdc:mga07m45_14548_c1 3300050496 Bacteria 4195
469 nmdc:mga07m45_47070_c1 3300050496 Bacteria 2424
470 nmdc:mga07m45_630_c1 3300050496 Bacteria 14978
471 nmdc:mga07m45_718_c1 3300050496 Bacteria 14097
472 nmdc:mga07m45_7700_c1 3300050496 Bacteria 5513
473 nmdc:mga07m45_93913_c1 3300050496 Bacteria 1720
474 nmdc:mga0n895_186496_c1 3300050512 Bacteria 2105
475 Ga0500635_0000110 3300053080 Bacteria 49377
476 Ga0500593_001263 3300053117 Bacteria 9151
477 Ga0500658_0015723 3300053134 Bacteria 2813
478 Ga0500559_0000020 3300053136 Bacteria 134858
479 Ga0500590_001526 3300053148 Bacteria 9599
480 Ga0500622_0002911 3300053156 Bacteria 11927
481 Ga0500636_0023154 3300053177 Bacteria 3671
482 Ga0466962_0005785 3300061719 Bacteria 5939

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026116 Ga0207674_10038976 Ga0207674_100389763 368
2 3300005535 Ga0070684_100033638 Ga0070684_1000336384 370
3 3300003323 rootH1_10021727 rootH1_100217275 372
4 3300005329 Ga0070683_100067455 Ga0070683_1000674552 372
5 3300005577 Ga0068857_100025125 Ga0068857_1000251253 372
6 3300009551 Ga0105238_10006779 Ga0105238_1000677912 374
7 3300009093 Ga0105240_10112120 Ga0105240_101121202 377
8 3300005614 Ga0068856_100011448 Ga0068856_1000114486 379
9 3300014326 Ga0157380_10025557 Ga0157380_100255572 379
10 3300026078 Ga0207702_10005642 Ga0207702_1000564210 379
11 3300005328 Ga0070676_10001334 Ga0070676_100013347 380
12 3300005330 Ga0070690_100145437 Ga0070690_1001454371 380
13 3300005347 Ga0070668_100007743 Ga0070668_1000077432 380
14 3300005354 Ga0070675_100094179 Ga0070675_1000941791 380
15 3300005356 Ga0070674_100000965 Ga0070674_1000009659 380
16 3300005367 Ga0070667_100002738 Ga0070667_1000027389 380
17 3300005719 Ga0068861_100002811 Ga0068861_1000028114 380
18 3300005844 Ga0068862_100025829 Ga0068862_1000258296 380
19 3300006881 Ga0068865_100002020 Ga0068865_1000020209 380
20 3300009177 Ga0105248_10030887 Ga0105248_100308876 380
21 3300009553 Ga0105249_10028713 Ga0105249_100287132 380
22 3300013296 Ga0157374_10035585 Ga0157374_100355852 380
23 3300013297 Ga0157378_10091000 Ga0157378_100910003 380
24 3300013306 Ga0163162_10004467 Ga0163162_100044679 380
25 3300014326 Ga0157380_10001564 Ga0157380_1000156416 380
26 3300014968 Ga0157379_10010571 Ga0157379_100105719 380
27 3300014969 Ga0157376_10255808 Ga0157376_102558082 380
28 3300025899 Ga0207642_10001813 Ga0207642_100018134 380
29 3300025907 Ga0207645_10002088 Ga0207645_1000208810 380
30 3300025933 Ga0207706_10011095 Ga0207706_100110953 380
31 3300025941 Ga0207711_10202662 Ga0207711_102026622 380
32 3300025986 Ga0207658_10002231 Ga0207658_100022319 380
33 3300026118 Ga0207675_100001416 Ga0207675_10000141618 380
34 3300028380 Ga0268265_10021062 Ga0268265_100210622 380
35 3300048910 Ga0496107_0063828 Ga0496107_0063828_125_1390 380
36 3300048916 Ga0496113_0078407 Ga0496113_0078407_178_1443 380
37 3300005354 Ga0070675_100003621 Ga0070675_1000036216 381
38 3300005353 Ga0070669_100255721 Ga0070669_1002557211 383
39 3300005356 Ga0070674_100026659 Ga0070674_1000266593 383
40 3300005564 Ga0070664_100092663 Ga0070664_1000926632 383
41 3300005615 Ga0070702_100122269 Ga0070702_1001222692 383
42 3300025937 Ga0207669_10020052 Ga0207669_100200524 383
43 3300005334 Ga0068869_100001761 Ga0068869_1000017613 384
44 3300005366 Ga0070659_100158552 Ga0070659_1001585522 384
45 3300005539 Ga0068853_100202944 Ga0068853_1002029442 384
46 3300005842 Ga0068858_100020636 Ga0068858_1000206362 384
47 3300005843 Ga0068860_100162965 Ga0068860_1001629652 384
48 3300006237 Ga0097621_100003869 Ga0097621_1000038697 384
49 3300025919 Ga0207657_10059522 Ga0207657_100595223 384
50 3300025932 Ga0207690_10029707 Ga0207690_100297073 384
51 3300025942 Ga0207689_10000259 Ga0207689_100002599 384
52 3300026041 Ga0207639_10044960 Ga0207639_100449604 384
53 3300026041 Ga0207639_10213827 Ga0207639_102138272 384
54 3300026142 Ga0207698_10017839 Ga0207698_100178393 384
55 3300028381 Ga0268264_10019419 Ga0268264_100194195 384
56 3300037068 Ga0373925_0112278 Ga0373925_0112278_20_1234 384
57 3300005331 Ga0070670_100007959 Ga0070670_1000079592 385
58 3300005336 Ga0070680_100007136 Ga0070680_1000071368 385
59 3300005354 Ga0070675_100067838 Ga0070675_1000678384 385
60 3300005356 Ga0070674_100015072 Ga0070674_1000150725 385
61 3300005456 Ga0070678_100053928 Ga0070678_1000539283 385
62 3300005458 Ga0070681_10045717 Ga0070681_100457172 385
63 3300005459 Ga0068867_100001658 Ga0068867_1000016585 385
64 3300005530 Ga0070679_100005395 Ga0070679_1000053957 385
65 3300005543 Ga0070672_100001237 Ga0070672_1000012373 385
66 3300005618 Ga0068864_100013261 Ga0068864_1000132614 385
67 3300014969 Ga0157376_10053319 Ga0157376_100533192 385
68 3300017792 Ga0163161_10037492 Ga0163161_100374924 385
69 3300025893 Ga0207682_10005576 Ga0207682_100055761 385
70 3300025912 Ga0207707_10031988 Ga0207707_100319882 385
71 3300025921 Ga0207652_10013046 Ga0207652_100130463 385
72 3300025926 Ga0207659_10105807 Ga0207659_101058071 385
73 3300025940 Ga0207691_10000229 Ga0207691_1000022910 385
74 3300026089 Ga0207648_10008771 Ga0207648_100087715 385
75 3300026121 Ga0207683_10009222 Ga0207683_100092228 385
76 3300026142 Ga0207698_10127571 Ga0207698_101275713 385
77 3300009545 Ga0105237_10152202 Ga0105237_101522022 386
78 3300013307 Ga0157372_10019500 Ga0157372_100195009 386
79 3300030522 Ga0307512_10066557 Ga0307512_100665573 386
80 3300031616 Ga0307508_10016751 Ga0307508_100167516 386
81 3300031616 Ga0307508_10058972 Ga0307508_100589724 386
82 3300035691 Ga0373931_0051114 Ga0373931_0051114_338_1519 386
83 3300005354 Ga0070675_100160545 Ga0070675_1001605452 387
84 3300005356 Ga0070674_100089350 Ga0070674_1000893502 387
85 3300014969 Ga0157376_10251692 Ga0157376_102516922 387
86 3300025926 Ga0207659_10124447 Ga0207659_101244472 387
87 3300028786 Ga0307517_10008069 Ga0307517_100080694 387
88 3300005367 Ga0070667_100082813 Ga0070667_1000828133 388
89 3300005459 Ga0068867_100012995 Ga0068867_1000129954 388
90 3300005616 Ga0068852_100032621 Ga0068852_1000326216 388
91 3300005719 Ga0068861_100023098 Ga0068861_1000230981 388
92 3300005842 Ga0068858_100004714 Ga0068858_1000047148 388
93 3300005843 Ga0068860_100005363 Ga0068860_10000536311 388
94 3300006195 Ga0075366_10009852 Ga0075366_100098524 388
95 3300006353 Ga0075370_10003303 Ga0075370_100033038 388
96 3300006881 Ga0068865_100037287 Ga0068865_1000372872 388
97 3300009177 Ga0105248_10173538 Ga0105248_101735383 388
98 3300013308 Ga0157375_10001941 Ga0157375_1000194119 388
99 3300017792 Ga0163161_10007201 Ga0163161_100072012 388
100 3300025940 Ga0207691_10121211 Ga0207691_101212112 388
101 3300025941 Ga0207711_10055496 Ga0207711_100554961 388
102 3300026118 Ga0207675_100033255 Ga0207675_1000332552 388
103 3300031456 Ga0307513_10032823 Ga0307513_100328233 388
104 3300031616 Ga0307508_10000222 Ga0307508_100002226 388
105 3300042876 Ga0451577_0003947 Ga0451577_0003947_1359_2660 388
106 3300046471 Ga0495650_0002544 Ga0495650_0002544_6024_7205 388
107 3300005328 Ga0070676_10009760 Ga0070676_100097603 389
108 3300005338 Ga0068868_100029620 Ga0068868_1000296203 389
109 3300005339 Ga0070660_100200222 Ga0070660_1002002222 389
110 3300005355 Ga0070671_100000437 Ga0070671_10000043718 389
111 3300005563 Ga0068855_100029336 Ga0068855_1000293369 389
112 3300005564 Ga0070664_100002594 Ga0070664_10000259411 389
113 3300005616 Ga0068852_100020723 Ga0068852_1000207234 389
114 3300005617 Ga0068859_100066707 Ga0068859_1000667074 389
115 3300005618 Ga0068864_100003775 Ga0068864_1000037754 389
116 3300005618 Ga0068864_100004227 Ga0068864_1000042277 389
117 3300005834 Ga0068851_10008810 Ga0068851_100088105 389
118 3300005834 Ga0068851_10011296 Ga0068851_100112962 389
119 3300006237 Ga0097621_100012725 Ga0097621_1000127252 389
120 3300006358 Ga0068871_100111176 Ga0068871_1001111762 389
121 3300006931 Ga0097620_100066707 Ga0097620_1000667074 389
122 3300009098 Ga0105245_10026508 Ga0105245_100265082 389
123 3300009177 Ga0105248_10006661 Ga0105248_1000666117 389
124 3300014745 Ga0157377_10000433 Ga0157377_1000043314 389
125 3300014969 Ga0157376_10009056 Ga0157376_100090569 389
126 3300025907 Ga0207645_10029105 Ga0207645_100291054 389
127 3300025931 Ga0207644_10000278 Ga0207644_1000027833 389
128 3300025932 Ga0207690_10043057 Ga0207690_100430573 389
129 3300025933 Ga0207706_10011458 Ga0207706_100114589 389
130 3300025941 Ga0207711_10019406 Ga0207711_100194065 389
131 3300026023 Ga0207677_10011633 Ga0207677_100116334 389
132 3300026023 Ga0207677_10021826 Ga0207677_100218263 389
133 3300026088 Ga0207641_10011245 Ga0207641_100112453 389
134 3300026095 Ga0207676_10013022 Ga0207676_100130224 389
135 3300026116 Ga0207674_10012008 Ga0207674_1001200811 389
136 3300026121 Ga0207683_10009129 Ga0207683_100091293 389
137 3300026142 Ga0207698_10001108 Ga0207698_1000110811 389
138 3300026142 Ga0207698_10022030 Ga0207698_100220303 389
139 3300046517 Ga0495630_0015221 Ga0495630_0015221_4012_5208 389
140 3300046616 Ga0495668_0028624 Ga0495668_0028624_1918_3120 389
141 3300046690 Ga0495624_0006839 Ga0495624_0006839_4863_6059 389
142 3300048911 Ga0496108_0048212 Ga0496108_0048212_657_1970 389
143 3300048918 Ga0496115_0005403 Ga0496115_0005403_3036_4349 389
144 3300006048 Ga0075363_100053330 Ga0075363_1000533303 390
145 3300014325 Ga0163163_10212865 Ga0163163_102128652 390
146 3300014968 Ga0157379_10047949 Ga0157379_100479494 390
147 3300025960 Ga0207651_10149425 Ga0207651_101494252 390
148 3300031730 Ga0307516_10000662 Ga0307516_1000066220 390
149 3300039447 Ga0436361_0528289 Ga0436361_0528289_308_1612 390
150 3300005353 Ga0070669_100131506 Ga0070669_1001315062 391
151 3300006178 Ga0075367_10018886 Ga0075367_100188865 391
152 3300006195 Ga0075366_10010161 Ga0075366_100101616 391
153 3300006353 Ga0075370_10051294 Ga0075370_100512941 391
154 3300021361 Ga0213872_10000163 Ga0213872_1000016325 391
155 3300026118 Ga0207675_100000307 Ga0207675_10000030738 391
156 3300031548 Ga0307408_100224666 Ga0307408_1002246662 391
157 3300031731 Ga0307405_10018973 Ga0307405_100189734 391
158 3300032002 Ga0307416_100018756 Ga0307416_1000187563 391
159 3300032126 Ga0307415_100001031 Ga0307415_1000010319 391
160 3300036401 Ga0373937_0209434 Ga0373937_0209434_90_1310 391
161 3300039447 Ga0436361_0408289 Ga0436361_0408289_16613_17854 391
162 3300050496 nmdc:mga07m45_47070_c1 nmdc:mga07m45_47070_c1_843_2198 391
163 3300053148 Ga0500590_001526 Ga0500590_001526_1534_2727 391
164 iso_pu_bacteria 2585428058 2587733553 391
165 3300005262 Ga0065165_1017765 Ga0065165_10177652 392
166 3300005457 Ga0070662_100023060 Ga0070662_1000230604 392
167 3300005467 Ga0070706_100000873 Ga0070706_10000087331 392
168 3300006178 Ga0075367_10024391 Ga0075367_100243912 392
169 3300025932 Ga0207690_10057352 Ga0207690_100573521 392
170 3300025933 Ga0207706_10038294 Ga0207706_100382945 392
171 3300031507 Ga0307509_10002906 Ga0307509_100029063 392
172 3300046454 Ga0495592_0000322 Ga0495592_0000322_34082_35278 392
173 3300005333 Ga0070677_10018563 Ga0070677_100185632 393
174 3300005334 Ga0068869_100003785 Ga0068869_1000037853 393
175 3300005353 Ga0070669_100002211 Ga0070669_1000022119 393
176 3300005456 Ga0070678_100228666 Ga0070678_1002286661 393
177 3300005457 Ga0070662_100004128 Ga0070662_1000041284 393
178 3300005459 Ga0068867_100003930 Ga0068867_1000039307 393
179 3300005543 Ga0070672_100003309 Ga0070672_1000033098 393
180 3300005618 Ga0068864_100087455 Ga0068864_1000874553 393
181 3300005841 Ga0068863_100004699 Ga0068863_1000046999 393
182 3300005842 Ga0068858_100010462 Ga0068858_1000104626 393
183 3300005843 Ga0068860_100005300 Ga0068860_1000053006 393
184 3300013105 Ga0157369_10006148 Ga0157369_1000614813 393
185 3300013308 Ga0157375_10003497 Ga0157375_100034979 393
186 3300017792 Ga0163161_10110310 Ga0163161_101103102 393
187 3300025893 Ga0207682_10024588 Ga0207682_100245883 393
188 3300025918 Ga0207662_10095229 Ga0207662_100952292 393
189 3300025920 Ga0207649_10001580 Ga0207649_100015805 393
190 3300025923 Ga0207681_10000967 Ga0207681_1000096710 393
191 3300025940 Ga0207691_10006361 Ga0207691_100063615 393
192 3300025942 Ga0207689_10008584 Ga0207689_100085849 393
193 3300025960 Ga0207651_10180057 Ga0207651_101800572 393
194 3300025972 Ga0207668_10047628 Ga0207668_100476282 393
195 3300026078 Ga0207702_10006602 Ga0207702_100066023 393
196 3300026088 Ga0207641_10006486 Ga0207641_100064869 393
197 3300026089 Ga0207648_10003517 Ga0207648_100035179 393
198 3300026121 Ga0207683_10044891 Ga0207683_100448912 393
199 3300028381 Ga0268264_10004913 Ga0268264_1000491310 393
200 3300033180 Ga0307510_10040707 Ga0307510_100407072 393
201 3300048905 Ga0496102_0002816 Ga0496102_0002816_208_1401 393
202 3300053136 Ga0500559_0000020 Ga0500559_0000020_5405_6610 393
203 3300053156 Ga0500622_0002911 Ga0500622_0002911_5265_6470 393
204 3300005328 Ga0070676_10037810 Ga0070676_100378102 394
205 3300005331 Ga0070670_100013527 Ga0070670_1000135272 394
206 3300005333 Ga0070677_10006811 Ga0070677_100068113 394
207 3300005335 Ga0070666_10002852 Ga0070666_100028523 394
208 3300005338 Ga0068868_100001350 Ga0068868_10000135011 394
209 3300005354 Ga0070675_100002027 Ga0070675_10000202716 394
210 3300005364 Ga0070673_100000957 Ga0070673_10000095710 394
211 3300005367 Ga0070667_100054700 Ga0070667_1000547002 394
212 3300005456 Ga0070678_100015003 Ga0070678_1000150033 394
213 3300005457 Ga0070662_100186708 Ga0070662_1001867082 394
214 3300005466 Ga0070685_10142394 Ga0070685_101423942 394
215 3300005618 Ga0068864_100002677 Ga0068864_1000026772 394
216 3300005842 Ga0068858_100003848 Ga0068858_10000384810 394
217 3300006237 Ga0097621_100021800 Ga0097621_1000218002 394
218 3300006358 Ga0068871_100012846 Ga0068871_1000128465 394
219 3300009177 Ga0105248_10015607 Ga0105248_100156075 394
220 3300013296 Ga0157374_10086317 Ga0157374_100863173 394
221 3300013297 Ga0157378_10216498 Ga0157378_102164982 394
222 3300013308 Ga0157375_10003094 Ga0157375_1000309416 394
223 3300014325 Ga0163163_10019043 Ga0163163_100190438 394
224 3300025893 Ga0207682_10011243 Ga0207682_100112432 394
225 3300025899 Ga0207642_10071083 Ga0207642_100710832 394
226 3300025903 Ga0207680_10010356 Ga0207680_100103566 394
227 3300025907 Ga0207645_10019662 Ga0207645_100196622 394
228 3300025926 Ga0207659_10000963 Ga0207659_1000096317 394
229 3300025941 Ga0207711_10009959 Ga0207711_100099592 394
230 3300025960 Ga0207651_10000390 Ga0207651_1000039010 394
231 3300025986 Ga0207658_10024606 Ga0207658_100246062 394
232 3300026023 Ga0207677_10000880 Ga0207677_100008808 394
233 3300026035 Ga0207703_10000382 Ga0207703_1000038216 394
234 3300026067 Ga0207678_10084856 Ga0207678_100848562 394
235 3300026089 Ga0207648_10060435 Ga0207648_100604352 394
236 3300026095 Ga0207676_10000221 Ga0207676_1000022141 394
237 3300026121 Ga0207683_10003264 Ga0207683_100032644 394
238 3300031250 Ga0265331_10010224 Ga0265331_100102244 394
239 3300031251 Ga0265327_10000012 Ga0265327_10000012272 394
240 3300046683 Ga0495658_0090717 Ga0495658_0090717_539_1774 394
241 3300048911 Ga0496108_0002823 Ga0496108_0002823_10188_11423 394
242 3300048913 Ga0496110_0301244 Ga0496110_0301244_119_1354 394
243 3300050493 nmdc:mga0k408_1324_c1 nmdc:mga0k408_1324_c1_2319_3551 394
244 3300050496 nmdc:mga07m45_93913_c1 nmdc:mga07m45_93913_c1_246_1478 394
245 3300005543 Ga0070672_100043274 Ga0070672_1000432742 395
246 3300026121 Ga0207683_10136896 Ga0207683_101368962 395
247 3300046519 Ga0495632_0017543 Ga0495632_0017543_1247_2500 395
248 3300046694 Ga0495649_0008009 Ga0495649_0008009_1126_2379 395
249 3300046810 Ga0495660_0058210 Ga0495660_0058210_667_1920 395
250 3300053117 Ga0500593_001263 Ga0500593_001263_5636_6835 395
251 3300005614 Ga0068856_100034931 Ga0068856_1000349314 396
252 3300013296 Ga0157374_10078384 Ga0157374_100783843 396
253 3300021361 Ga0213872_10000376 Ga0213872_100003763 396
254 3300026078 Ga0207702_10074311 Ga0207702_100743113 396
255 3300027526 Ga0209968_1000634 Ga0209968_10006345 396
256 3300027695 Ga0209966_1000288 Ga0209966_100028811 396
257 3300031548 Ga0307408_100000109 Ga0307408_10000010959 396
258 3300039447 Ga0436361_0914279 Ga0436361_0914279_3360_4598 396
259 3300048924 Ga0496121_0080298 Ga0496121_0080298_208_1407 396
260 3300050496 nmdc:mga07m45_718_c1 nmdc:mga07m45_718_c1_5852_7096 396
261 3300050512 nmdc:mga0n895_186496_c1 nmdc:mga0n895_186496_c1_81_1394 396
262 iso_pu_bacteria 2643221544 2643743774 396
263 iso_pu_bacteria 2738541337 2739058441 396
264 3300006195 Ga0075366_10003855 Ga0075366_100038553 397
265 3300009093 Ga0105240_10023285 Ga0105240_100232855 397
266 3300009148 Ga0105243_10071989 Ga0105243_100719893 397
267 3300009545 Ga0105237_10000529 Ga0105237_1000052942 397
268 3300010375 Ga0105239_10425085 Ga0105239_104250851 397
269 3300025913 Ga0207695_10004136 Ga0207695_1000413613 397
270 3300025945 Ga0207679_10181963 Ga0207679_101819632 397
271 3300026116 Ga0207674_10109709 Ga0207674_101097093 397
272 3300031730 Ga0307516_10111433 Ga0307516_101114332 397
273 3300035114 Ga0373939_0000055 Ga0373939_0000055_35310_36542 397
274 3300035121 Ga0373960_0000419 Ga0373960_0000419_6276_7508 397
275 3300035691 Ga0373931_0000216 Ga0373931_0000216_9737_10969 397
276 3300044712 Ga0453684_0308114 Ga0453684_0308114_331_1581 397
277 3300050493 nmdc:mga0k408_1110_c1 nmdc:mga0k408_1110_c1_3289_4548 397
278 iso_pu_bacteria 2643221639 2644222306 397
279 iso_pu_bacteria 2643221646 2644256322 397
280 3300005337 Ga0070682_100037805 Ga0070682_1000378053 398
281 3300005459 Ga0068867_100051536 Ga0068867_1000515364 398
282 3300006048 Ga0075363_100057579 Ga0075363_1000575792 398
283 3300006353 Ga0075370_10000414 Ga0075370_1000041414 398
284 3300021361 Ga0213872_10000007 Ga0213872_10000007106 398
285 3300039447 Ga0436361_0163583 Ga0436361_0163583_125471_126766 398
286 3300042127 Ga0450890_000464 Ga0450890_000464_644_1876 398
287 3300042130 Ga0450892_000559 Ga0450892_000559_2312_3544 398
288 3300042532 Ga0450893_0004552 Ga0450893_0004552_63_1295 398
289 3300048927 Ga0496124_0003153 Ga0496124_0003153_9170_10417 398
290 3300048928 Ga0496125_0003117 Ga0496125_0003117_8955_10202 398
291 3300003759 Ga0055525_1000004 Ga0055525_1000004254 399
292 3300005344 Ga0070661_100078728 Ga0070661_1000787282 399
293 3300005353 Ga0070669_100085672 Ga0070669_1000856722 399
294 3300005616 Ga0068852_100007596 Ga0068852_1000075964 399
295 3300025230 Ga0209563_100013 Ga0209563_100013254 399
296 3300025920 Ga0207649_10046929 Ga0207649_100469292 399
297 3300025923 Ga0207681_10088644 Ga0207681_100886442 399
298 3300025940 Ga0207691_10067151 Ga0207691_100671513 399
299 3300028794 Ga0307515_10025831 Ga0307515_1002583110 399
300 3300039447 Ga0436361_1151650 Ga0436361_1151650_1532_2776 399
301 3300046683 Ga0495658_0063173 Ga0495658_0063173_473_1795 399
302 3300047472 Ga0495686_0000980 Ga0495686_0000980_24708_25919 399
303 3300025939 Ga0207665_10129942 Ga0207665_101299422 400
304 3300037471 Ga0395905_0001260 Ga0395905_0001260_22453_23694 400
305 3300039447 Ga0436361_1143259 Ga0436361_1143259_502_1743 400
306 3300045051 Ga0451576_0119633 Ga0451576_0119633_748_1986 400
307 3300047443 Ga0495687_000330 Ga0495687_000330_7180_8475 400
308 3300005331 Ga0070670_100033279 Ga0070670_1000332795 401
309 3300006195 Ga0075366_10016305 Ga0075366_100163054 401
310 3300021361 Ga0213872_10000003 Ga0213872_10000003222 401
311 3300039447 Ga0436361_1061851 Ga0436361_1061851_14347_15612 401
312 3300050493 nmdc:mga0k408_10926_c1 nmdc:mga0k408_10926_c1_838_2094 401
313 3300050494 nmdc:mga06z11_73271_c1 nmdc:mga06z11_73271_c1_316_1554 401
314 3300005327 Ga0070658_10045785 Ga0070658_100457852 402
315 3300005328 Ga0070676_10004760 Ga0070676_100047605 402
316 3300005331 Ga0070670_100011885 Ga0070670_1000118855 402
317 3300005331 Ga0070670_100069393 Ga0070670_1000693934 402
318 3300005334 Ga0068869_100027862 Ga0068869_1000278625 402
319 3300005354 Ga0070675_100055415 Ga0070675_1000554152 402
320 3300005355 Ga0070671_100198789 Ga0070671_1001987892 402
321 3300005364 Ga0070673_100191325 Ga0070673_1001913252 402
322 3300005456 Ga0070678_100050364 Ga0070678_1000503642 402
323 3300005457 Ga0070662_100215722 Ga0070662_1002157222 402
324 3300005577 Ga0068857_100031528 Ga0068857_1000315286 402
325 3300006177 Ga0075362_10061007 Ga0075362_100610071 402
326 3300006195 Ga0075366_10032590 Ga0075366_100325904 402
327 3300006353 Ga0075370_10002136 Ga0075370_100021366 402
328 3300013308 Ga0157375_10088288 Ga0157375_100882882 402
329 3300025907 Ga0207645_10000870 Ga0207645_1000087017 402
330 3300025925 Ga0207650_10009880 Ga0207650_100098806 402
331 3300025925 Ga0207650_10101601 Ga0207650_101016012 402
332 3300025926 Ga0207659_10102134 Ga0207659_101021342 402
333 3300025931 Ga0207644_10112367 Ga0207644_101123672 402
334 3300025933 Ga0207706_10013502 Ga0207706_100135025 402
335 3300025938 Ga0207704_10144967 Ga0207704_101449672 402
336 3300025940 Ga0207691_10041139 Ga0207691_100411395 402
337 3300025942 Ga0207689_10029100 Ga0207689_100291002 402
338 3300025945 Ga0207679_10209841 Ga0207679_102098411 402
339 3300026023 Ga0207677_10111697 Ga0207677_101116972 402
340 3300026116 Ga0207674_10009884 Ga0207674_100098845 402
341 3300026121 Ga0207683_10011351 Ga0207683_100113513 402
342 3300028786 Ga0307517_10148427 Ga0307517_101484272 402
343 3300031731 Ga0307405_10015575 Ga0307405_100155754 402
344 3300031852 Ga0307410_10025659 Ga0307410_100256593 402
345 3300046660 Ga0495625_0036918 Ga0495625_0036918_1313_2551 402
346 3300050493 nmdc:mga0k408_42338_c1 nmdc:mga0k408_42338_c1_1090_2343 402
347 3300050496 nmdc:mga07m45_14548_c1 nmdc:mga07m45_14548_c1_439_1692 402
348 3300006195 Ga0075366_10014618 Ga0075366_100146186 403
349 3300035171 Ga0373946_0025759 Ga0373946_0025759_766_2070 403
350 3300035725 Ga0373947_0020189 Ga0373947_0020189_1015_2319 403
351 3300036401 Ga0373937_0081817 Ga0373937_0081817_714_2018 403
352 3300037068 Ga0373925_0033167 Ga0373925_0033167_854_2158 403
353 3300042876 Ga0451577_0043425 Ga0451577_0043425_1545_2810 403
354 3300046459 Ga0495629_0100478 Ga0495629_0100478_577_1881 403
355 3300046543 Ga0495645_0088941 Ga0495645_0088941_717_2021 403
356 3300050493 nmdc:mga0k408_6633_c1 nmdc:mga0k408_6633_c1_1499_2740 403
357 3300053134 Ga0500658_0015723 Ga0500658_0015723_48_1289 403
358 3300005331 Ga0070670_100151383 Ga0070670_1001513832 404
359 3300005543 Ga0070672_100082357 Ga0070672_1000823573 404
360 3300013104 Ga0157370_10102175 Ga0157370_101021753 404
361 3300013105 Ga0157369_10226307 Ga0157369_102263072 404
362 3300035410 Ga0373924_0026612 Ga0373924_0026612_388_1686 404
363 3300036401 Ga0373937_0268986 Ga0373937_0268986_255_1529 404
364 3300046459 Ga0495629_0054567 Ga0495629_0054567_1197_2498 404
365 3300050489 nmdc:mga03683_2487_c1 nmdc:mga03683_2487_c1_4466_5707 404
366 3300050493 nmdc:mga0k408_2616_c1 nmdc:mga0k408_2616_c1_2474_3715 404
367 3300050494 nmdc:mga06z11_3260_c1 nmdc:mga06z11_3260_c1_184_1425 404
368 3300050495 nmdc:mga04h51_2183_c1 nmdc:mga04h51_2183_c1_3113_4354 404
369 3300050496 nmdc:mga07m45_630_c1 nmdc:mga07m45_630_c1_9171_10412 404
370 3300005331 Ga0070670_100007679 Ga0070670_1000076797 405
371 3300005354 Ga0070675_100007426 Ga0070675_1000074264 405
372 3300005355 Ga0070671_100085232 Ga0070671_1000852323 405
373 3300005364 Ga0070673_100104517 Ga0070673_1001045171 405
374 3300005367 Ga0070667_100143509 Ga0070667_1001435091 405
375 3300005543 Ga0070672_100022617 Ga0070672_1000226174 405
376 3300005618 Ga0068864_100002345 Ga0068864_1000023459 405
377 3300005841 Ga0068863_100018040 Ga0068863_1000180405 405
378 3300006237 Ga0097621_100005342 Ga0097621_1000053429 405
379 3300025905 Ga0207685_10049433 Ga0207685_100494332 405
380 3300025925 Ga0207650_10006010 Ga0207650_100060104 405
381 3300025926 Ga0207659_10015889 Ga0207659_100158894 405
382 3300025940 Ga0207691_10010278 Ga0207691_100102789 405
383 3300025940 Ga0207691_10106912 Ga0207691_101069123 405
384 3300025960 Ga0207651_10072480 Ga0207651_100724801 405
385 3300005331 Ga0070670_100089787 Ga0070670_1000897872 406
386 3300005354 Ga0070675_100035230 Ga0070675_1000352303 406
387 3300005456 Ga0070678_100204384 Ga0070678_1002043842 406
388 3300005841 Ga0068863_100009890 Ga0068863_1000098909 406
389 3300009177 Ga0105248_10065141 Ga0105248_100651414 406
390 3300013306 Ga0163162_10019378 Ga0163162_100193783 406
391 3300014968 Ga0157379_10007064 Ga0157379_100070642 406
392 3300025908 Ga0207643_10029590 Ga0207643_100295903 406
393 3300025925 Ga0207650_10014689 Ga0207650_100146893 406
394 3300025941 Ga0207711_10038028 Ga0207711_100380284 406
395 3300026088 Ga0207641_10069069 Ga0207641_100690692 406
396 3300026089 Ga0207648_10035109 Ga0207648_100351091 406
397 3300048907 Ga0496104_0007556 Ga0496104_0007556_289_1596 406
398 3300048917 Ga0496114_0125946 Ga0496114_0125946_495_1802 406
399 3300005355 Ga0070671_100049662 Ga0070671_1000496623 407
400 3300005456 Ga0070678_100079120 Ga0070678_1000791203 407
401 3300005457 Ga0070662_100042390 Ga0070662_1000423903 407
402 3300025907 Ga0207645_10004592 Ga0207645_100045925 407
403 3300025931 Ga0207644_10022498 Ga0207644_100224983 407
404 3300026121 Ga0207683_10105127 Ga0207683_101051272 407
405 3300031995 Ga0307409_100072378 Ga0307409_1000723782 407
406 3300025893 Ga0207682_10007552 Ga0207682_100075523 408
407 3300026089 Ga0207648_10190238 Ga0207648_101902382 408
408 3300035089 Ga0373944_0037576 Ga0373944_0037576_18_1307 408
409 3300042876 Ga0451577_0001417 Ga0451577_0001417_14148_15470 408
410 3300050489 nmdc:mga03683_22743_c1 nmdc:mga03683_22743_c1_1125_2396 408
411 3300050496 nmdc:mga07m45_7700_c1 nmdc:mga07m45_7700_c1_3682_4953 408
412 3300031649 Ga0307514_10001848 Ga0307514_1000184819 410
413 3300031730 Ga0307516_10056108 Ga0307516_100561081 411
414 3300037466 Ga0395898_0012449 Ga0395898_0012449_6294_7541 415
415 3300038443 Ga0395901_0035246 Ga0395901_0035246_2580_3827 415
416 3300039447 Ga0436361_0832058 Ga0436361_0832058_1003_2283 421
417 3300045976 Ga0466967_0049988 Ga0466967_0049988_929_2308 424
418 3300046492 Ga0495585_0022433 Ga0495585_0022433_1431_2762 425
419 3300045976 Ga0466967_0020814 Ga0466967_0020814_1054_2433 427
420 3300003761 Ga0055535_1000163 Ga0055535_100016331 429
421 3300003763 Ga0055529_1000278 Ga0055529_100027846 429
422 3300025242 Ga0209258_100080 Ga0209258_100080128 429
423 3300025256 Ga0209759_1000655 Ga0209759_10006556 429
424 3300025272 Ga0209455_1000030 Ga0209455_1000030371 429
425 3300003792 Ga0055540_1011351 Ga0055540_10113512 430
426 3300025253 Ga0209677_103310 Ga0209677_1033103 430
427 3300025303 Ga0209051_1025496 Ga0209051_10254962 430
428 3300025303 Ga0209051_1048632 Ga0209051_10486321 430
429 3300044706 Ga0466964_0024325 Ga0466964_0024325_255_1658 430
430 3300048911 Ga0496108_0113475 Ga0496108_0113475_168_1565 430
431 3300003320 rootH2_10038858 rootH2_100388585 431
432 3300005563 Ga0068855_100002188 Ga0068855_10000218810 431
433 3300009148 Ga0105243_10037336 Ga0105243_100373364 431
434 3300025303 Ga0209051_1011987 Ga0209051_10119873 431
435 3300025935 Ga0207709_10019522 Ga0207709_100195223 431
436 3300025949 Ga0207667_10001981 Ga0207667_1000198110 431
437 3300045049 Ga0466959_0004015 Ga0466959_0004015_3907_5307 431
438 3300046660 Ga0495625_0006378 Ga0495625_0006378_424_1725 433
439 3300002705 JGI25156J39149_1002039 JGI25156J39149_10020392 434
440 3300002738 JGI25154J39366_1003088 JGI25154J39366_10030882 434
441 3300002741 JGI25157J39369_1000289 JGI25157J39369_100028925 434
442 3300003752 Ga0055539_1000278 Ga0055539_10002787 434
443 3300003756 Ga0055533_1000026 Ga0055533_100002693 434
444 3300005330 Ga0070690_100007891 Ga0070690_1000078912 434
445 3300005334 Ga0068869_100075208 Ga0068869_1000752082 434
446 3300005339 Ga0070660_100078687 Ga0070660_1000786872 434
447 3300005366 Ga0070659_100067958 Ga0070659_1000679582 434
448 3300005563 Ga0068855_100072709 Ga0068855_1000727093 434
449 3300005578 Ga0068854_100032157 Ga0068854_1000321571 434
450 3300005719 Ga0068861_100006197 Ga0068861_1000061976 434
451 3300011119 Ga0105246_10041347 Ga0105246_100413472 434
452 3300014969 Ga0157376_10077374 Ga0157376_100773742 434
453 3300025226 Ga0209674_100024 Ga0209674_100024204 434
454 3300025230 Ga0209563_100069 Ga0209563_100069204 434
455 3300025231 Ga0207427_100422 Ga0207427_10042217 434
456 3300025242 Ga0209258_102580 Ga0209258_1025802 434
457 3300025246 Ga0209646_1000012 Ga0209646_1000012303 434
458 3300025250 Ga0209026_1000004 Ga0209026_1000004317 434
459 3300025253 Ga0209677_100048 Ga0209677_10004893 434
460 3300025253 Ga0209677_100184 Ga0209677_10018418 434
461 3300025256 Ga0209759_1000003 Ga0209759_1000003411 434
462 3300025256 Ga0209759_1000067 Ga0209759_10000675 434
463 3300025256 Ga0209759_1001607 Ga0209759_10016072 434
464 3300025919 Ga0207657_10025656 Ga0207657_100256564 434
465 3300025942 Ga0207689_10090984 Ga0207689_100909841 434
466 3300025949 Ga0207667_10088066 Ga0207667_100880661 434
467 3300026041 Ga0207639_10046752 Ga0207639_100467522 434
468 3300026078 Ga0207702_10018263 Ga0207702_100182632 434
469 3300026118 Ga0207675_100030939 Ga0207675_1000309392 434
470 3300028666 Ga0265336_10000083 Ga0265336_1000008333 434
471 3300029957 Ga0265324_10003255 Ga0265324_100032558 434
472 3300030521 Ga0307511_10090894 Ga0307511_100908942 434
473 3300031730 Ga0307516_10011476 Ga0307516_100114765 434
474 3300039447 Ga0436361_1175466 Ga0436361_1175466_411_1832 434
475 3300044684 Ga0466966_0001886 Ga0466966_0001886_6160_7557 434
476 3300044693 Ga0466961_0023932 Ga0466961_0023932_1576_2973 434
477 3300044765 Ga0466970_0054944 Ga0466970_0054944_526_1923 434
478 3300046506 Ga0495583_0000022 Ga0495583_0000022_93206_94510 434
479 3300046507 Ga0495606_0002246 Ga0495606_0002246_5083_6387 434
480 3300046616 Ga0495668_0018220 Ga0495668_0018220_2570_3874 434
481 3300046684 Ga0495669_0005520 Ga0495669_0005520_2253_3557 434
482 3300046794 Ga0495589_0012391 Ga0495589_0012391_2731_4035 434
483 3300047472 Ga0495686_0038640 Ga0495686_0038640_1274_2620 434
484 3300048909 Ga0496106_0177755 Ga0496106_0177755_159_1532 434
485 3300053080 Ga0500635_0000110 Ga0500635_0000110_6587_8029 434
486 3300053177 Ga0500636_0023154 Ga0500636_0023154_1620_2924 434
487 3300061719 Ga0466962_0005785 Ga0466962_0005785_3903_5300 434

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13679

Methyltransf_32

Methyltransferase domain

230

371

0.95

PF13847

Methyltransf_31

Methyltransferase domain

254

387

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ua3-assembly1.cif.gz_A crystal structure of protein arginine methyltransferase prmt5 in complex with sah 0.7994 186 305
2yxe-assembly1.cif.gz_B crystal structure of l-isoaspartyl protein carboxyl methyltranferase 0.7874 198 319
3gyx-assembly6.cif.gz_L crystal structure of adenylylsulfate reductase from desulfovibrio gigas 0.7745 110 140
3ua3-assembly1.cif.gz_B crystal structure of protein arginine methyltransferase prmt5 in complex with sah 0.7708 186 305
1vpr-assembly1.cif.gz_A crystal structure of a luciferase domain from the dinoflagellate lingulodinium polyedrum 0.736 60 86
ID Description Score Start End Superfamily
af_A0A1D6EFY7_537_616_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8695 217 283 3.40.50.150
af_Q55C78_181_338_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8419 215 283 3.40.50.150
af_C0H5A2_481_622_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8216 194 280 3.40.50.150
af_A0A0P0Y1E1_35_188_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.7977 190 295 3.40.50.150
af_K7KE15_1_124_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.7946 201 295 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A1Q3M7Z9-F1-model_v4 Methyltransferase 0.9538 162 430 GO:0005737
GO:0008168
GO:0032259
AF-A0A7U3Y2I9-F1-model_v4 SAM-dependent methyltransferase 0.9463 154 430 GO:0005737
GO:0008168
GO:0032259
AF-A0A2R7TB99-F1-model_v4 deleted 0.9463 233 430
AF-A0A348NVP6-F1-model_v4 Methyltransferase domain-containing protein 0.9461 161 430 GO:0005737
AF-A0A365VLM5-F1-model_v4 deleted 0.9452 169 317

Feature Viewer

pLDDT pTM Quality
84.65 0.76 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map