F453544

General Info

Members Datasets Scaffolds Average Seq Length
488 248 976 161

Family's Representative Sequence

Representative Sequence 3300005327|Ga0070658_10510494|Ga0070658_105104941
Length 165
Sequence MSKVAIYAGTFDPITRGHQDLIERSLTFCDRLVVAVASNSSKAPLFSADERVALVREVVGNDPRVEVRMLKGQLLVDFARDVGATLLIRGLRAVSDFEYEFQMALMNRHLAPIETVFMVPSLDTTYISSSIVREVARYGGRVDDLLHPSVAAALRRKMDERPKPD

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
50 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
51 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
54 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
62 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300012495 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 Metagenome Rhizosphere
68 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
69 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
75 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
76 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
77 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
78 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
116 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
120 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
121 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
122 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
123 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
124 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
125 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
126 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
127 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
128 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
129 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
130 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
131 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
132 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
133 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
134 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
135 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
136 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
137 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
138 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
139 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
140 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
141 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
142 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
143 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
144 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
145 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
146 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
147 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
148 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
149 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
150 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
151 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
152 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
153 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
154 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
155 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
156 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
157 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
158 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
159 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
160 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
161 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
162 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
163 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
164 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
165 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
166 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
167 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
168 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
169 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
170 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
171 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
172 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
173 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
174 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
175 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
176 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
177 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
178 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
179 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
180 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
181 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
182 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
183 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
184 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
185 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
186 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
187 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
188 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
189 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
190 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
191 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
192 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
193 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
194 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
195 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
196 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
197 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
198 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
199 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
200 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
213 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
214 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
215 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
216 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
217 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
218 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
219 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
220 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
221 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
222 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
223 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
224 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
225 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
226 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
227 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
228 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
229 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
230 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
231 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
232 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
233 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
234 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
235 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
237 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
238 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
239 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
240 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
241 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
242 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
243 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
244 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
245 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
246 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
247 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
248 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.53
Rhizosphere 93.85
Stem 0
Stem Tuber 0
Unclassified 2.87

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10510494 3300005327 Bacteria 1039
2 Ga0065715_10072244 3300005293 Bacteria 596
3 Ga0065707_10585356 3300005295 Bacteria 699
4 Ga0070683_100058762 3300005329 Bacteria 3572
5 Ga0070683_100339704 3300005329 Bacteria 1430
6 Ga0070670_100963913 3300005331 Bacteria 775
7 Ga0070680_100020187 3300005336 Bacteria 5287
8 Ga0070680_100030601 3300005336 Bacteria 4325
9 Ga0070680_100050348 3300005336 Bacteria 3397
10 Ga0070660_100151501 3300005339 Bacteria 1865
11 Ga0070660_100500706 3300005339 Bacteria 1011
12 Ga0070660_100949199 3300005339 Bacteria 726
13 Ga0070691_10188568 3300005341 Bacteria 1077
14 Ga0070661_100003411 3300005344 Bacteria 10978
15 Ga0070661_100862154 3300005344 Bacteria 746
16 Ga0070692_10013691 3300005345 Bacteria 3788
17 Ga0070668_100148391 3300005347 Bacteria 1894
18 Ga0070668_100594652 3300005347 Bacteria 967
19 Ga0070668_100687019 3300005347 Unclassified 902
20 Ga0070669_100003079 3300005353 Bacteria 12001
21 Ga0070669_100160201 3300005353 Bacteria 1748
22 Ga0070669_100895017 3300005353 Bacteria 758
23 Ga0070671_100993761 3300005355 Bacteria 735
24 Ga0070659_100017963 3300005366 Bacteria 5330
25 Ga0070711_100001286 3300005439 Bacteria 13623
26 Ga0070705_101171262 3300005440 Bacteria 632
27 Ga0070694_100028827 3300005444 Bacteria 3616
28 Ga0070694_101167799 3300005444 Bacteria 644
29 Ga0070708_100079242 3300005445 Bacteria 2971
30 Ga0070663_100026569 3300005455 Bacteria 3923
31 Ga0070663_100230667 3300005455 Bacteria 1458
32 Ga0070663_100442520 3300005455 Bacteria 1070
33 Ga0070678_100220569 3300005456 Bacteria 1576
34 Ga0070662_100475570 3300005457 Bacteria 1040
35 Ga0070662_100636564 3300005457 Bacteria 899
36 Ga0070662_101061568 3300005457 Bacteria 694
37 Ga0070681_10008932 3300005458 Bacteria 9851
38 Ga0070681_10010307 3300005458 Bacteria 9226
39 Ga0070681_10077498 3300005458 Bacteria 3281
40 Ga0070681_10306667 3300005458 Bacteria 1497
41 Ga0068867_101010449 3300005459 Bacteria 755
42 Ga0070685_10634249 3300005466 Unclassified 772
43 Ga0070706_100650402 3300005467 Bacteria 979
44 Ga0070706_100911943 3300005467 Bacteria 812
45 Ga0070707_100171775 3300005468 Bacteria 2112
46 Ga0070707_101121778 3300005468 Bacteria 752
47 Ga0070699_100000824 3300005518 Bacteria 28768
48 Ga0070699_100065250 3300005518 Bacteria 3159
49 Ga0070699_100291279 3300005518 Bacteria 1464
50 Ga0070679_100014954 3300005530 Bacteria 7456
51 Ga0070679_100036230 3300005530 Bacteria 4896
52 Ga0070679_100043081 3300005530 Bacteria 4496
53 Ga0070679_100113171 3300005530 Bacteria 2699
54 Ga0070684_100026677 3300005535 Bacteria 4868
55 Ga0070684_100608741 3300005535 Bacteria 1016
56 Ga0070697_100009789 3300005536 Bacteria 7476
57 Ga0068853_100013646 3300005539 Bacteria 6638
58 Ga0070672_100129750 3300005543 Bacteria 2071
59 Ga0070672_100155226 3300005543 Bacteria 1895
60 Ga0070672_100203555 3300005543 Bacteria 1656
61 Ga0070672_100231388 3300005543 Bacteria 1553
62 Ga0070686_101305091 3300005544 Bacteria 606
63 Ga0070695_100030682 3300005545 Bacteria 3348
64 Ga0070695_100180696 3300005545 Bacteria 1495
65 Ga0070696_100170062 3300005546 Bacteria 1610
66 Ga0070665_100042538 3300005548 Bacteria 4567
67 Ga0070704_100541263 3300005549 Bacteria 1016
68 Ga0068855_100008571 3300005563 Bacteria 12363
69 Ga0068855_100251326 3300005563 Bacteria 1972
70 Ga0070664_100076525 3300005564 Bacteria 2876
71 Ga0070664_100111051 3300005564 Bacteria 2393
72 Ga0070664_100159760 3300005564 Bacteria 1993
73 Ga0070664_100206975 3300005564 Bacteria 1752
74 Ga0068857_100214040 3300005577 Bacteria 1759
75 Ga0070702_100768022 3300005615 Bacteria 742
76 Ga0068852_100069165 3300005616 Bacteria 3093
77 Ga0068864_100180637 3300005618 Bacteria 1929
78 Ga0068861_100119842 3300005719 Bacteria 2121
79 Ga0068861_100492059 3300005719 Bacteria 1107
80 Ga0068861_100844213 3300005719 Bacteria 863
81 Ga0068870_10002079 3300005840 Bacteria 8295
82 Ga0068863_100696157 3300005841 Bacteria 1010
83 Ga0068860_100139566 3300005843 Bacteria 2329
84 Ga0068860_100910972 3300005843 Bacteria 895
85 Ga0068860_101262832 3300005843 Unclassified 759
86 Ga0068860_101542420 3300005843 Bacteria 686
87 Ga0068862_100000376 3300005844 Bacteria 48418
88 Ga0068862_100093687 3300005844 Bacteria 2619
89 Ga0068862_100599645 3300005844 Bacteria 1057
90 Ga0081455_10050687 3300005937 Bacteria 3566
91 Ga0070717_11392994 3300006028 Bacteria 637
92 Ga0070712_100105013 3300006175 Bacteria 2097
93 Ga0075428_101147254 3300006844 Bacteria 820
94 Ga0075428_101149041 3300006844 Bacteria 819
95 Ga0075430_100109751 3300006846 Bacteria 2301
96 Ga0075431_100064200 3300006847 Bacteria 3791
97 Ga0075431_100747874 3300006847 Bacteria 953
98 Ga0075434_100091187 3300006871 Bacteria 3049
99 Ga0075429_100021264 3300006880 Bacteria 5624
100 Ga0075429_100665963 3300006880 Bacteria 912
101 Ga0068865_100020297 3300006881 Bacteria 4308
102 Ga0075435_100241786 3300007076 Bacteria 1536
103 Ga0105240_10074073 3300009093 Bacteria 4204
104 Ga0114129_10274423 3300009147 Bacteria 2255
105 Ga0114129_11177214 3300009147 Bacteria 956
106 Ga0105243_10333503 3300009148 Bacteria 1386
107 Ga0105243_10744155 3300009148 Bacteria 960
108 Ga0105243_10880089 3300009148 Bacteria 889
109 Ga0105241_10116790 3300009174 Bacteria 2143
110 Ga0105241_10397937 3300009174 Bacteria 1207
111 Ga0105248_10087798 3300009177 Bacteria 3500
112 Ga0105248_10099173 3300009177 Bacteria 3282
113 Ga0105248_10454509 3300009177 Bacteria 1443
114 Ga0105238_10073038 3300009551 Bacteria 3425
115 Ga0105249_10000115 3300009553 Bacteria 108581
116 Ga0105249_10000454 3300009553 Bacteria 38498
117 Ga0105249_10020246 3300009553 Bacteria 5947
118 Ga0105249_10262497 3300009553 Bacteria 1717
119 Ga0105239_11716520 3300010375 Bacteria 727
120 Ga0157323_1010152 3300012495 Bacteria 735
121 Ga0157370_10165029 3300013104 Bacteria 2060
122 Ga0157369_10115485 3300013105 Bacteria 2851
123 Ga0157369_10154139 3300013105 Bacteria 2428
124 Ga0163162_10059365 3300013306 Bacteria 3856
125 Ga0157372_10683897 3300013307 Bacteria 1194
126 Ga0157372_10847696 3300013307 Bacteria 1061
127 Ga0157375_10873090 3300013308 Bacteria 1045
128 Ga0157375_12008437 3300013308 Unclassified 687
129 Ga0163163_10066631 3300014325 Bacteria 3577
130 Ga0163163_10171929 3300014325 Bacteria 2213
131 Ga0163163_10806932 3300014325 Bacteria 1002
132 Ga0157380_10172196 3300014326 Bacteria 1893
133 Ga0157380_10654155 3300014326 Bacteria 1049
134 Ga0157380_11665764 3300014326 Bacteria 695
135 Ga0157379_10265372 3300014968 Bacteria 1561
136 Ga0157379_10829323 3300014968 Bacteria 874
137 Ga0157379_11046607 3300014968 Bacteria 780
138 Ga0157376_10211400 3300014969 Bacteria 1791
139 Ga0157376_10267374 3300014969 Bacteria 1605
140 Ga0157376_11135119 3300014969 Bacteria 808
141 Ga0182007_10206684 3300015262 Bacteria 688
142 Ga0207645_10067632 3300025907 Bacteria 2284
143 Ga0207643_10001951 3300025908 Bacteria 11403
144 Ga0207705_10089643 3300025909 Bacteria 2251
145 Ga0207705_10379726 3300025909 Bacteria 1091
146 Ga0207654_10079503 3300025911 Bacteria 1970
147 Ga0207707_10007791 3300025912 Bacteria 9323
148 Ga0207707_10023881 3300025912 Bacteria 5346
149 Ga0207707_10041733 3300025912 Bacteria 4006
150 Ga0207707_10412454 3300025912 Bacteria 1159
151 Ga0207695_10081615 3300025913 Bacteria 3272
152 Ga0207693_10330978 3300025915 Bacteria 1192
153 Ga0207663_10001490 3300025916 Bacteria 10915
154 Ga0207660_10095373 3300025917 Bacteria 2213
155 Ga0207660_10238060 3300025917 Bacteria 1433
156 Ga0207660_10441739 3300025917 Bacteria 1051
157 Ga0207662_10134859 3300025918 Bacteria 1560
158 Ga0207657_10005262 3300025919 Bacteria 13552
159 Ga0207657_10738236 3300025919 Bacteria 763
160 Ga0207649_10096437 3300025920 Bacteria 1948
161 Ga0207652_10008367 3300025921 Bacteria 8321
162 Ga0207652_10024204 3300025921 Bacteria 5036
163 Ga0207652_10031148 3300025921 Bacteria 4476
164 Ga0207652_10644804 3300025921 Bacteria 947
165 Ga0207646_10122557 3300025922 Bacteria 2336
166 Ga0207681_10003561 3300025923 Bacteria 9699
167 Ga0207681_10023462 3300025923 Bacteria 3947
168 Ga0207644_10513276 3300025931 Bacteria 990
169 Ga0207690_10097772 3300025932 Bacteria 2089
170 Ga0207690_10516577 3300025932 Bacteria 968
171 Ga0207706_10076182 3300025933 Bacteria 2950
172 Ga0207706_10361664 3300025933 Bacteria 1261
173 Ga0207709_10193874 3300025935 Bacteria 1445
174 Ga0207691_10052046 3300025940 Bacteria 3741
175 Ga0207691_10164589 3300025940 Bacteria 1944
176 Ga0207711_10055461 3300025941 Bacteria 3402
177 Ga0207711_10152177 3300025941 Bacteria 2088
178 Ga0207661_10222512 3300025944 Bacteria 1669
179 Ga0207661_10244948 3300025944 Bacteria 1592
180 Ga0207679_10026253 3300025945 Bacteria 4015
181 Ga0207679_10070401 3300025945 Bacteria 2636
182 Ga0207679_10141370 3300025945 Bacteria 1946
183 Ga0207679_10210109 3300025945 Bacteria 1631
184 Ga0207667_10081585 3300025949 Bacteria 3350
185 Ga0207667_10310692 3300025949 Bacteria 1610
186 Ga0207651_10042005 3300025960 Unclassified 3040
187 Ga0207712_10000499 3300025961 Bacteria 32439
188 Ga0207712_10001176 3300025961 Bacteria 18145
189 Ga0207712_10081403 3300025961 Bacteria 2358
190 Ga0207712_10797805 3300025961 Bacteria 830
191 Ga0207668_10309425 3300025972 Bacteria 1307
192 Ga0207668_10614131 3300025972 Bacteria 948
193 Ga0207640_10139919 3300025981 Bacteria 1763
194 Ga0207677_10754569 3300026023 Bacteria 868
195 Ga0207678_10068814 3300026067 Bacteria 3036
196 Ga0207678_10289810 3300026067 Bacteria 1406
197 Ga0207678_10620997 3300026067 Unclassified 948
198 Ga0207702_10057844 3300026078 Bacteria 3297
199 Ga0207702_11059431 3300026078 Bacteria 805
200 Ga0207648_10023923 3300026089 Bacteria 5460
201 Ga0207676_10226214 3300026095 Bacteria 1669
202 Ga0207676_10680541 3300026095 Bacteria 995
203 Ga0207674_10179106 3300026116 Bacteria 2071
204 Ga0207675_100059762 3300026118 Bacteria 3558
205 Ga0207675_100090617 3300026118 Bacteria 2875
206 Ga0207675_100821073 3300026118 Bacteria 944
207 Ga0207698_10013973 3300026142 Bacteria 5318
208 Ga0207698_10494551 3300026142 Bacteria 1189
209 Ga0209995_1078555 3300027471 Bacteria 566
210 Ga0207428_10129186 3300027907 Bacteria 1934
211 Ga0268266_10935521 3300028379 Bacteria 838
212 Ga0268265_10002121 3300028380 Bacteria 15384
213 Ga0268265_10072005 3300028380 Bacteria 2694
214 Ga0268265_10554481 3300028380 Bacteria 1091
215 Ga0268264_10020367 3300028381 Bacteria 5421
216 Ga0268264_11333172 3300028381 Bacteria 728
217 Ga0268264_12075754 3300028381 Bacteria 577
218 Ga0307408_100008337 3300031548 Bacteria 6844
219 Ga0307408_100143062 3300031548 Bacteria 1879
220 Ga0307408_100215144 3300031548 Bacteria 1564
221 Ga0307408_100371672 3300031548 Bacteria 1219
222 Ga0307408_100540701 3300031548 Bacteria 1026
223 Ga0307405_10004488 3300031731 Bacteria 6603
224 Ga0307405_10036009 3300031731 Bacteria 2962
225 Ga0307405_10240206 3300031731 Bacteria 1341
226 Ga0307405_10501621 3300031731 Bacteria 973
227 Ga0307413_10010972 3300031824 Bacteria 4427
228 Ga0307413_10019705 3300031824 Bacteria 3571
229 Ga0307413_10036278 3300031824 Bacteria 2837
230 Ga0307413_10165887 3300031824 Bacteria 1557
231 Ga0307413_10262852 3300031824 Bacteria 1287
232 Ga0307413_10390592 3300031824 Bacteria 1087
233 Ga0307413_10446736 3300031824 Bacteria 1025
234 Ga0307410_10002527 3300031852 Bacteria 8847
235 Ga0307410_10010146 3300031852 Bacteria 5323
236 Ga0307410_10274470 3300031852 Bacteria 1320
237 Ga0307410_10535507 3300031852 Bacteria 968
238 Ga0307410_10570322 3300031852 Bacteria 940
239 Ga0307406_10001688 3300031901 Bacteria 12133
240 Ga0307406_10014718 3300031901 Bacteria 4506
241 Ga0307406_10198542 3300031901 Bacteria 1474
242 Ga0307406_10557723 3300031901 Bacteria 938
243 Ga0307407_10018599 3300031903 Bacteria 3518
244 Ga0307407_10027368 3300031903 Bacteria 3033
245 Ga0307407_10054888 3300031903 Bacteria 2300
246 Ga0307407_10086253 3300031903 Bacteria 1912
247 Ga0307407_10453310 3300031903 Bacteria 931
248 Ga0307407_10617161 3300031903 Bacteria 809
249 Ga0307412_10080294 3300031911 Bacteria 2253
250 Ga0307412_10346886 3300031911 Bacteria 1190
251 Ga0307412_11419397 3300031911 Bacteria 629
252 Ga0307409_100000144 3300031995 Bacteria 26764
253 Ga0307409_100005669 3300031995 Bacteria 7231
254 Ga0307409_100009411 3300031995 Bacteria 6000
255 Ga0307409_100026152 3300031995 Bacteria 4111
256 Ga0307409_100120314 3300031995 Bacteria 2222
257 Ga0307409_100179122 3300031995 Bacteria 1874
258 Ga0307409_100182609 3300031995 Bacteria 1859
259 Ga0307409_100404155 3300031995 Bacteria 1305
260 Ga0307409_101049244 3300031995 Unclassified 835
261 Ga0307416_100000828 3300032002 Bacteria 16247
262 Ga0307416_100085434 3300032002 Bacteria 2686
263 Ga0307416_100121404 3300032002 Bacteria 2330
264 Ga0307416_100137033 3300032002 Bacteria 2216
265 Ga0307416_100307518 3300032002 Bacteria 1579
266 Ga0307416_100400666 3300032002 Bacteria 1409
267 Ga0307416_100528993 3300032002 Unclassified 1249
268 Ga0307416_100563387 3300032002 Bacteria 1214
269 Ga0307416_101104424 3300032002 Bacteria 898
270 Ga0307416_101873449 3300032002 Bacteria 703
271 Ga0307414_10002383 3300032004 Bacteria 9831
272 Ga0307414_10032844 3300032004 Bacteria 3422
273 Ga0307414_10137897 3300032004 Bacteria 1905
274 Ga0307414_10335255 3300032004 Bacteria 1293
275 Ga0307414_10484407 3300032004 Bacteria 1091
276 Ga0307411_10007270 3300032005 Bacteria 5620
277 Ga0307411_10016984 3300032005 Bacteria 4132
278 Ga0307411_10038481 3300032005 Bacteria 3017
279 Ga0307411_10157364 3300032005 Bacteria 1697
280 Ga0307411_10192544 3300032005 Bacteria 1558
281 Ga0307411_10293419 3300032005 Bacteria 1300
282 Ga0307411_10856079 3300032005 Bacteria 805
283 Ga0307415_100000419 3300032126 Bacteria 18192
284 Ga0307415_100036475 3300032126 Bacteria 3222
285 Ga0307415_100044728 3300032126 Bacteria 2962
286 Ga0307415_100104570 3300032126 Bacteria 2086
287 Ga0307415_100131985 3300032126 Bacteria 1893
288 Ga0307415_100293152 3300032126 Bacteria 1344
289 Ga0307415_100563413 3300032126 Bacteria 1007
290 Ga0307415_100877952 3300032126 Bacteria 825
291 Ga0307415_101204795 3300032126 Bacteria 713
292 Ga0373926_0004167 3300035083 Bacteria 4716
293 Ga0373932_0044489 3300035112 Bacteria 1295
294 Ga0373945_0027811 3300035116 Bacteria 1977
295 Ga0373960_0232818 3300035121 Bacteria 663
296 Ga0373943_0016857 3300035170 Bacteria 3338
297 Ga0373962_0134193 3300035242 Bacteria 799
298 Ga0373935_0018031 3300035692 Bacteria 4290
299 Ga0373935_0340967 3300035692 Bacteria 1067
300 Ga0373927_0026060 3300035695 Bacteria 3821
301 Ga0373947_0002126 3300035725 Bacteria 12064
302 Ga0373937_0476569 3300036401 Bacteria 1185
303 Ga0373925_0013098 3300037068 Bacteria 6002
304 Ga0395905_0434509 3300037471 Bacteria 1210
305 Ga0242420_028295 3300038996 Unclassified 1031
306 Ga0436365_0504187 3300039437 Bacteria 1133
307 Ga0439453_0033522 3300041408 Bacteria 982
308 Ga0451807_2555286 3300041486 Bacteria 1904
309 Ga0451841_0074140 3300041498 Bacteria 730
310 Ga0451849_0414375 3300041505 Bacteria 987
311 Ga0439454_017522 3300042011 Bacteria 1024
312 Ga0450921_001219 3300042123 Bacteria 1502
313 Ga0450898_068549 3300042134 Bacteria 707
314 Ga0439434_0115927 3300042435 Bacteria 870
315 Ga0439444_0079283 3300042437 Bacteria 716
316 Ga0451577_0003975 3300042876 Bacteria 15941
317 Ga0451577_0061655 3300042876 Bacteria 3345
318 Ga0466961_0592676 3300044693 Bacteria 667
319 Ga0453684_0210433 3300044712 Bacteria 2261
320 Ga0466959_0528410 3300045049 Bacteria 796
321 Ga0466958_0573571 3300045836 Bacteria 733
322 Ga0466967_1649394 3300045976 Bacteria 639
323 Ga0495629_0025075 3300046459 Bacteria 4241
324 Ga0495580_0095865 3300046472 Bacteria 2063
325 Ga0495580_0147155 3300046472 Bacteria 1632
326 Ga0495605_0259700 3300046474 Bacteria 742
327 Ga0495639_0000549 3300046475 Bacteria 17446
328 Ga0495639_0018403 3300046475 Bacteria 3041
329 Ga0495662_0025907 3300046476 Bacteria 2833
330 Ga0495664_0031638 3300046477 Bacteria 3103
331 Ga0495594_0007257 3300046499 Bacteria 5700
332 Ga0495618_0053276 3300046514 Bacteria 2558
333 Ga0495630_0002236 3300046517 Bacteria 13469
334 Ga0495630_0026160 3300046517 Bacteria 4319
335 Ga0495666_0013463 3300046526 Bacteria 4079
336 Ga0495665_0000358 3300046531 Bacteria 23104
337 Ga0495586_0012895 3300046535 Bacteria 4432
338 Ga0495635_0277029 3300046663 Bacteria 1127
339 Ga0495635_0972483 3300046663 Unclassified 541
340 Ga0495588_0012498 3300046674 Bacteria 4015
341 Ga0495647_0418663 3300046681 Bacteria 617
342 Ga0495658_0001403 3300046683 Bacteria 12652
343 Ga0495658_0008579 3300046683 Bacteria 5070
344 Ga0495613_0069329 3300046689 Bacteria 2571
345 Ga0495613_0165850 3300046689 Bacteria 1569
346 Ga0495624_0459405 3300046690 Bacteria 763
347 Ga0495581_0000659 3300047315 Bacteria 18109
348 Ga0495674_0131259 3300047319 Bacteria 2111
349 Ga0495680_0066918 3300047322 Bacteria 2748
350 Ga0495684_0070462 3300047471 Bacteria 2658
351 Ga0495593_0000356 3300047673 Bacteria 25268
352 Ga0495614_0000638 3300048089 Bacteria 14664
353 Ga0496100_0065280 3300048903 Bacteria 2411
354 Ga0496100_0905600 3300048903 Bacteria 693
355 Ga0496101_0515952 3300048904 Bacteria 944
356 Ga0496102_0269133 3300048905 Bacteria 1606
357 Ga0496102_0873782 3300048905 Bacteria 821
358 Ga0496103_0071001 3300048906 Bacteria 2179
359 Ga0496104_0207729 3300048907 Bacteria 1870
360 Ga0496104_0698224 3300048907 Bacteria 922
361 Ga0496105_0250591 3300048908 Bacteria 1435
362 Ga0496106_0053593 3300048909 Bacteria 3047
363 Ga0496106_0366757 3300048909 Bacteria 1157
364 Ga0496106_0671675 3300048909 Bacteria 827
365 Ga0496106_1134556 3300048909 Bacteria 611
366 Ga0496107_0110621 3300048910 Bacteria 2019
367 Ga0496107_0251521 3300048910 Bacteria 1315
368 Ga0496108_0075320 3300048911 Bacteria 2851
369 Ga0496108_0888305 3300048911 Bacteria 765
370 Ga0496109_0043903 3300048912 Unclassified 4053
371 Ga0496109_0419606 3300048912 Bacteria 1264
372 Ga0496110_0028810 3300048913 Bacteria 4773
373 Ga0496110_0100205 3300048913 Bacteria 2597
374 Ga0496112_0022223 3300048915 Bacteria 6044
375 Ga0496112_0661130 3300048915 Bacteria 974
376 Ga0496113_0774854 3300048916 Bacteria 763
377 Ga0496113_1242379 3300048916 Bacteria 581
378 Ga0496115_0476264 3300048918 Unclassified 1006
379 Ga0501290_017104 3300049513 Bacteria 970
380 Ga0501303_045128 3300049526 Bacteria 563
381 Ga0501031_0037498 3300049568 Bacteria 3163
382 Ga0501031_0239043 3300049568 Bacteria 1181
383 Ga0501032_0230541 3300049569 Bacteria 1204
384 Ga0501033_0144217 3300049570 Bacteria 1721
385 Ga0501034_0004342 3300049571 Bacteria 15797
386 Ga0501036_0041282 3300049572 Bacteria 3904
387 Ga0501036_0055831 3300049572 Bacteria 3346
388 Ga0501039_0383419 3300049575 Bacteria 1104
389 Ga0501040_0050648 3300049576 Bacteria 2841
390 Ga0501040_0153098 3300049576 Bacteria 1627
391 Ga0501041_0071773 3300049577 Bacteria 2126
392 Ga0501041_0114239 3300049577 Bacteria 1676
393 Ga0501042_0056601 3300049578 Bacteria 2798
394 Ga0501046_0249628 3300049580 Bacteria 1306
395 Ga0501046_0286677 3300049580 Bacteria 1205
396 Ga0501047_0053540 3300049581 Bacteria 3903
397 Ga0501047_0187163 3300049581 Bacteria 1935
398 Ga0501048_0328180 3300049582 Bacteria 1090
399 Ga0501048_0695086 3300049582 Bacteria 730
400 Ga0501067_0000353 3300049583 Bacteria 25052
401 Ga0501067_0004616 3300049583 Bacteria 7626
402 Ga0501067_0022949 3300049583 Bacteria 3455
403 Ga0501067_0434366 3300049583 Bacteria 733
404 Ga0501068_0000022 3300049584 Bacteria 58879
405 Ga0501068_0001339 3300049584 Bacteria 13056
406 Ga0501068_0389399 3300049584 Bacteria 898
407 Ga0501068_0460820 3300049584 Bacteria 823
408 Ga0501068_0561529 3300049584 Bacteria 742
409 Ga0501069_0000105 3300049585 Bacteria 38637
410 Ga0501069_0001800 3300049585 Bacteria 10728
411 Ga0501069_0032461 3300049585 Unclassified 2874
412 Ga0501069_0186503 3300049585 Bacteria 1200
413 Ga0501069_0197156 3300049585 Bacteria 1166
414 Ga0501070_0000192 3300049586 Bacteria 57359
415 Ga0501070_0027750 3300049586 Bacteria 4749
416 Ga0501070_0062415 3300049586 Bacteria 3087
417 Ga0501071_0000678 3300049587 Bacteria 17791
418 Ga0501071_0002547 3300049587 Bacteria 11102
419 Ga0501071_1035916 3300049587 Bacteria 634
420 Ga0501072_0005786 3300049588 Bacteria 9417
421 Ga0501072_0009721 3300049588 Bacteria 7315
422 Ga0501072_0305978 3300049588 Bacteria 1264
423 Ga0501073_0000949 3300049589 Bacteria 20906
424 Ga0501073_0006186 3300049589 Bacteria 8933
425 Ga0501073_0148021 3300049589 Bacteria 1627
426 Ga0501073_0533643 3300049589 Bacteria 811
427 Ga0501073_0597224 3300049589 Bacteria 762
428 Ga0501074_0000171 3300049590 Bacteria 34937
429 Ga0501074_0000742 3300049590 Bacteria 20488
430 Ga0501074_0171416 3300049590 Bacteria 1549
431 Ga0501074_0207462 3300049590 Bacteria 1396
432 Ga0501074_0238008 3300049590 Bacteria 1295
433 Ga0501074_0267314 3300049590 Bacteria 1215
434 Ga0501074_0478565 3300049590 Bacteria 883
435 Ga0501075_0018150 3300049591 Bacteria 5088
436 Ga0501075_1116760 3300049591 Bacteria 599
437 Ga0501076_0021090 3300049592 Bacteria 4993
438 Ga0501076_0272461 3300049592 Bacteria 1386
439 Ga0501077_0004768 3300049593 Bacteria 8242
440 Ga0501077_0064921 3300049593 Bacteria 2315
441 Ga0501077_0422306 3300049593 Bacteria 853
442 Ga0501202_013730 3300049652 Bacteria 1544
443 Ga0501243_028915 3300049675 Bacteria 940
444 Ga0501249_147527 3300049679 Bacteria 590
445 Ga0501253_076377 3300049683 Bacteria 749
446 Ga0501261_020553 3300049690 Bacteria 944
447 Ga0501079_0065742 3300049741 Bacteria 2798
448 Ga0501079_0076548 3300049741 Bacteria 2588
449 Ga0501079_0076836 3300049741 Bacteria 2582
450 Ga0501079_0127383 3300049741 Bacteria 1980
451 Ga0501079_1239801 3300049741 Bacteria 587
452 Ga0501080_0000060 3300049742 Bacteria 71292
453 Ga0501080_0005735 3300049742 Bacteria 11107
454 Ga0501080_0006023 3300049742 Bacteria 10866
455 Ga0501080_0111578 3300049742 Bacteria 2535
456 Ga0501080_0297281 3300049742 Bacteria 1465
457 Ga0501080_0484844 3300049742 Bacteria 1106
458 Ga0501081_0050168 3300049743 Bacteria 2875
459 Ga0501081_0718839 3300049743 Bacteria 750
460 Ga0501083_0008037 3300049744 Bacteria 7464
461 Ga0501083_0393052 3300049744 Bacteria 902
462 Ga0501268_039996 3300049765 Bacteria 879
463 Ga0501270_059470 3300049767 Bacteria 713
464 Ga0501283_049060 3300049779 Bacteria 745
465 Ga0501035_0315717 3300049822 Bacteria 1314
466 Ga0501045_0009723 3300049824 Bacteria 6728
467 Ga0501045_0014038 3300049824 Bacteria 5670
468 nmdc:mga05p37_186756_c1 3300050507 Bacteria 2519
469 nmdc:mga09592_91131_c1 3300050508 Bacteria 2605
470 nmdc:mga0qj67_3022_c1 3300050509 Bacteria 12093
471 nmdc:mga06r32_77166_c1 3300050510 Bacteria 3236
472 nmdc:mga06r32_882482_c1 3300050510 Unclassified 851
473 nmdc:mga08y16_9037_c1 3300050511 Bacteria 10459
474 nmdc:mga0n895_108355_c1 3300050512 Bacteria 2792
475 nmdc:mga0rr50_559504_c1 3300050513 Bacteria 974
476 nmdc:mga0a205_7709_c1 3300050515 Bacteria 9767
477 Ga0501084_0001187 3300054114 Bacteria 20381
478 Ga0501084_0002953 3300054114 Bacteria 13773
479 Ga0501084_0170156 3300054114 Bacteria 1839
480 Ga0501084_0202134 3300054114 Bacteria 1676
481 Ga0501084_0246566 3300054114 Bacteria 1508
482 Ga0590071_015280 3300059421 Bacteria 1801
483 Ga0501082_0006728 3300060353 Bacteria 9941
484 Ga0501082_0139082 3300060353 Bacteria 2107
485 Ga0501082_0399315 3300060353 Bacteria 1200
486 Ga0501082_0767316 3300060353 Bacteria 844
487 Ga0501082_1125055 3300060353 Bacteria 686
488 Ga0530510_0092799 3300061734 Bacteria 2204
489 Ga0070658_10510494
490 Ga0065715_10072244
491 Ga0065707_10585356
492 Ga0070683_100058762
493 Ga0070683_100339704
494 Ga0070670_100963913
495 Ga0070680_100020187
496 Ga0070680_100030601
497 Ga0070680_100050348
498 Ga0070660_100151501
499 Ga0070660_100500706
500 Ga0070660_100949199
501 Ga0070691_10188568
502 Ga0070661_100003411
503 Ga0070661_100862154
504 Ga0070692_10013691
505 Ga0070668_100148391
506 Ga0070668_100594652
507 Ga0070668_100687019
508 Ga0070669_100003079
509 Ga0070669_100160201
510 Ga0070669_100895017
511 Ga0070671_100993761
512 Ga0070659_100017963
513 Ga0070711_100001286
514 Ga0070705_101171262
515 Ga0070694_100028827
516 Ga0070694_101167799
517 Ga0070708_100079242
518 Ga0070663_100026569
519 Ga0070663_100230667
520 Ga0070663_100442520
521 Ga0070678_100220569
522 Ga0070662_100475570
523 Ga0070662_100636564
524 Ga0070662_101061568
525 Ga0070681_10008932
526 Ga0070681_10010307
527 Ga0070681_10077498
528 Ga0070681_10306667
529 Ga0068867_101010449
530 Ga0070685_10634249
531 Ga0070706_100650402
532 Ga0070706_100911943
533 Ga0070707_100171775
534 Ga0070707_101121778
535 Ga0070699_100000824
536 Ga0070699_100065250
537 Ga0070699_100291279
538 Ga0070679_100014954
539 Ga0070679_100036230
540 Ga0070679_100043081
541 Ga0070679_100113171
542 Ga0070684_100026677
543 Ga0070684_100608741
544 Ga0070697_100009789
545 Ga0068853_100013646
546 Ga0070672_100129750
547 Ga0070672_100155226
548 Ga0070672_100203555
549 Ga0070672_100231388
550 Ga0070686_101305091
551 Ga0070695_100030682
552 Ga0070695_100180696
553 Ga0070696_100170062
554 Ga0070665_100042538
555 Ga0070704_100541263
556 Ga0068855_100008571
557 Ga0068855_100251326
558 Ga0070664_100076525
559 Ga0070664_100111051
560 Ga0070664_100159760
561 Ga0070664_100206975
562 Ga0068857_100214040
563 Ga0070702_100768022
564 Ga0068852_100069165
565 Ga0068864_100180637
566 Ga0068861_100119842
567 Ga0068861_100492059
568 Ga0068861_100844213
569 Ga0068870_10002079
570 Ga0068863_100696157
571 Ga0068860_100139566
572 Ga0068860_100910972
573 Ga0068860_101262832
574 Ga0068860_101542420
575 Ga0068862_100000376
576 Ga0068862_100093687
577 Ga0068862_100599645
578 Ga0081455_10050687
579 Ga0070717_11392994
580 Ga0070712_100105013
581 Ga0075428_101147254
582 Ga0075428_101149041
583 Ga0075430_100109751
584 Ga0075431_100064200
585 Ga0075431_100747874
586 Ga0075434_100091187
587 Ga0075429_100021264
588 Ga0075429_100665963
589 Ga0068865_100020297
590 Ga0075435_100241786
591 Ga0105240_10074073
592 Ga0114129_10274423
593 Ga0114129_11177214
594 Ga0105243_10333503
595 Ga0105243_10744155
596 Ga0105243_10880089
597 Ga0105241_10116790
598 Ga0105241_10397937
599 Ga0105248_10087798
600 Ga0105248_10099173
601 Ga0105248_10454509
602 Ga0105238_10073038
603 Ga0105249_10000115
604 Ga0105249_10000454
605 Ga0105249_10020246
606 Ga0105249_10262497
607 Ga0105239_11716520
608 Ga0157323_1010152
609 Ga0157370_10165029
610 Ga0157369_10115485
611 Ga0157369_10154139
612 Ga0163162_10059365
613 Ga0157372_10683897
614 Ga0157372_10847696
615 Ga0157375_10873090
616 Ga0157375_12008437
617 Ga0163163_10066631
618 Ga0163163_10171929
619 Ga0163163_10806932
620 Ga0157380_10172196
621 Ga0157380_10654155
622 Ga0157380_11665764
623 Ga0157379_10265372
624 Ga0157379_10829323
625 Ga0157379_11046607
626 Ga0157376_10211400
627 Ga0157376_10267374
628 Ga0157376_11135119
629 Ga0182007_10206684
630 Ga0207645_10067632
631 Ga0207643_10001951
632 Ga0207705_10089643
633 Ga0207705_10379726
634 Ga0207654_10079503
635 Ga0207707_10007791
636 Ga0207707_10023881
637 Ga0207707_10041733
638 Ga0207707_10412454
639 Ga0207695_10081615
640 Ga0207693_10330978
641 Ga0207663_10001490
642 Ga0207660_10095373
643 Ga0207660_10238060
644 Ga0207660_10441739
645 Ga0207662_10134859
646 Ga0207657_10005262
647 Ga0207657_10738236
648 Ga0207649_10096437
649 Ga0207652_10008367
650 Ga0207652_10024204
651 Ga0207652_10031148
652 Ga0207652_10644804
653 Ga0207646_10122557
654 Ga0207681_10003561
655 Ga0207681_10023462
656 Ga0207644_10513276
657 Ga0207690_10097772
658 Ga0207690_10516577
659 Ga0207706_10076182
660 Ga0207706_10361664
661 Ga0207709_10193874
662 Ga0207691_10052046
663 Ga0207691_10164589
664 Ga0207711_10055461
665 Ga0207711_10152177
666 Ga0207661_10222512
667 Ga0207661_10244948
668 Ga0207679_10026253
669 Ga0207679_10070401
670 Ga0207679_10141370
671 Ga0207679_10210109
672 Ga0207667_10081585
673 Ga0207667_10310692
674 Ga0207651_10042005
675 Ga0207712_10000499
676 Ga0207712_10001176
677 Ga0207712_10081403
678 Ga0207712_10797805
679 Ga0207668_10309425
680 Ga0207668_10614131
681 Ga0207640_10139919
682 Ga0207677_10754569
683 Ga0207678_10068814
684 Ga0207678_10289810
685 Ga0207678_10620997
686 Ga0207702_10057844
687 Ga0207702_11059431
688 Ga0207648_10023923
689 Ga0207676_10226214
690 Ga0207676_10680541
691 Ga0207674_10179106
692 Ga0207675_100059762
693 Ga0207675_100090617
694 Ga0207675_100821073
695 Ga0207698_10013973
696 Ga0207698_10494551
697 Ga0209995_1078555
698 Ga0207428_10129186
699 Ga0268266_10935521
700 Ga0268265_10002121
701 Ga0268265_10072005
702 Ga0268265_10554481
703 Ga0268264_10020367
704 Ga0268264_11333172
705 Ga0268264_12075754
706 Ga0307408_100008337
707 Ga0307408_100143062
708 Ga0307408_100215144
709 Ga0307408_100371672
710 Ga0307408_100540701
711 Ga0307405_10004488
712 Ga0307405_10036009
713 Ga0307405_10240206
714 Ga0307405_10501621
715 Ga0307413_10010972
716 Ga0307413_10019705
717 Ga0307413_10036278
718 Ga0307413_10165887
719 Ga0307413_10262852
720 Ga0307413_10390592
721 Ga0307413_10446736
722 Ga0307410_10002527
723 Ga0307410_10010146
724 Ga0307410_10274470
725 Ga0307410_10535507
726 Ga0307410_10570322
727 Ga0307406_10001688
728 Ga0307406_10014718
729 Ga0307406_10198542
730 Ga0307406_10557723
731 Ga0307407_10018599
732 Ga0307407_10027368
733 Ga0307407_10054888
734 Ga0307407_10086253
735 Ga0307407_10453310
736 Ga0307407_10617161
737 Ga0307412_10080294
738 Ga0307412_10346886
739 Ga0307412_11419397
740 Ga0307409_100000144
741 Ga0307409_100005669
742 Ga0307409_100009411
743 Ga0307409_100026152
744 Ga0307409_100120314
745 Ga0307409_100179122
746 Ga0307409_100182609
747 Ga0307409_100404155
748 Ga0307409_101049244
749 Ga0307416_100000828
750 Ga0307416_100085434
751 Ga0307416_100121404
752 Ga0307416_100137033
753 Ga0307416_100307518
754 Ga0307416_100400666
755 Ga0307416_100528993
756 Ga0307416_100563387
757 Ga0307416_101104424
758 Ga0307416_101873449
759 Ga0307414_10002383
760 Ga0307414_10032844
761 Ga0307414_10137897
762 Ga0307414_10335255
763 Ga0307414_10484407
764 Ga0307411_10007270
765 Ga0307411_10016984
766 Ga0307411_10038481
767 Ga0307411_10157364
768 Ga0307411_10192544
769 Ga0307411_10293419
770 Ga0307411_10856079
771 Ga0307415_100000419
772 Ga0307415_100036475
773 Ga0307415_100044728
774 Ga0307415_100104570
775 Ga0307415_100131985
776 Ga0307415_100293152
777 Ga0307415_100563413
778 Ga0307415_100877952
779 Ga0307415_101204795
780 Ga0373926_0004167
781 Ga0373932_0044489
782 Ga0373945_0027811
783 Ga0373960_0232818
784 Ga0373943_0016857
785 Ga0373962_0134193
786 Ga0373935_0018031
787 Ga0373935_0340967
788 Ga0373927_0026060
789 Ga0373947_0002126
790 Ga0373937_0476569
791 Ga0373925_0013098
792 Ga0395905_0434509
793 Ga0242420_028295
794 Ga0436365_0504187
795 Ga0439453_0033522
796 Ga0451807_2555286
797 Ga0451841_0074140
798 Ga0451849_0414375
799 Ga0439454_017522
800 Ga0450921_001219
801 Ga0450898_068549
802 Ga0439434_0115927
803 Ga0439444_0079283
804 Ga0451577_0003975
805 Ga0451577_0061655
806 Ga0466961_0592676
807 Ga0453684_0210433
808 Ga0466959_0528410
809 Ga0466958_0573571
810 Ga0466967_1649394
811 Ga0495629_0025075
812 Ga0495580_0095865
813 Ga0495580_0147155
814 Ga0495605_0259700
815 Ga0495639_0000549
816 Ga0495639_0018403
817 Ga0495662_0025907
818 Ga0495664_0031638
819 Ga0495594_0007257
820 Ga0495618_0053276
821 Ga0495630_0002236
822 Ga0495630_0026160
823 Ga0495666_0013463
824 Ga0495665_0000358
825 Ga0495586_0012895
826 Ga0495635_0277029
827 Ga0495635_0972483
828 Ga0495588_0012498
829 Ga0495647_0418663
830 Ga0495658_0001403
831 Ga0495658_0008579
832 Ga0495613_0069329
833 Ga0495613_0165850
834 Ga0495624_0459405
835 Ga0495581_0000659
836 Ga0495674_0131259
837 Ga0495680_0066918
838 Ga0495684_0070462
839 Ga0495593_0000356
840 Ga0495614_0000638
841 Ga0496100_0065280
842 Ga0496100_0905600
843 Ga0496101_0515952
844 Ga0496102_0269133
845 Ga0496102_0873782
846 Ga0496103_0071001
847 Ga0496104_0207729
848 Ga0496104_0698224
849 Ga0496105_0250591
850 Ga0496106_0053593
851 Ga0496106_0366757
852 Ga0496106_0671675
853 Ga0496106_1134556
854 Ga0496107_0110621
855 Ga0496107_0251521
856 Ga0496108_0075320
857 Ga0496108_0888305
858 Ga0496109_0043903
859 Ga0496109_0419606
860 Ga0496110_0028810
861 Ga0496110_0100205
862 Ga0496112_0022223
863 Ga0496112_0661130
864 Ga0496113_0774854
865 Ga0496113_1242379
866 Ga0496115_0476264
867 Ga0501290_017104
868 Ga0501303_045128
869 Ga0501031_0037498
870 Ga0501031_0239043
871 Ga0501032_0230541
872 Ga0501033_0144217
873 Ga0501034_0004342
874 Ga0501036_0041282
875 Ga0501036_0055831
876 Ga0501039_0383419
877 Ga0501040_0050648
878 Ga0501040_0153098
879 Ga0501041_0071773
880 Ga0501041_0114239
881 Ga0501042_0056601
882 Ga0501046_0249628
883 Ga0501046_0286677
884 Ga0501047_0053540
885 Ga0501047_0187163
886 Ga0501048_0328180
887 Ga0501048_0695086
888 Ga0501067_0000353
889 Ga0501067_0004616
890 Ga0501067_0022949
891 Ga0501067_0434366
892 Ga0501068_0000022
893 Ga0501068_0001339
894 Ga0501068_0389399
895 Ga0501068_0460820
896 Ga0501068_0561529
897 Ga0501069_0000105
898 Ga0501069_0001800
899 Ga0501069_0032461
900 Ga0501069_0186503
901 Ga0501069_0197156
902 Ga0501070_0000192
903 Ga0501070_0027750
904 Ga0501070_0062415
905 Ga0501071_0000678
906 Ga0501071_0002547
907 Ga0501071_1035916
908 Ga0501072_0005786
909 Ga0501072_0009721
910 Ga0501072_0305978
911 Ga0501073_0000949
912 Ga0501073_0006186
913 Ga0501073_0148021
914 Ga0501073_0533643
915 Ga0501073_0597224
916 Ga0501074_0000171
917 Ga0501074_0000742
918 Ga0501074_0171416
919 Ga0501074_0207462
920 Ga0501074_0238008
921 Ga0501074_0267314
922 Ga0501074_0478565
923 Ga0501075_0018150
924 Ga0501075_1116760
925 Ga0501076_0021090
926 Ga0501076_0272461
927 Ga0501077_0004768
928 Ga0501077_0064921
929 Ga0501077_0422306
930 Ga0501202_013730
931 Ga0501243_028915
932 Ga0501249_147527
933 Ga0501253_076377
934 Ga0501261_020553
935 Ga0501079_0065742
936 Ga0501079_0076548
937 Ga0501079_0076836
938 Ga0501079_0127383
939 Ga0501079_1239801
940 Ga0501080_0000060
941 Ga0501080_0005735
942 Ga0501080_0006023
943 Ga0501080_0111578
944 Ga0501080_0297281
945 Ga0501080_0484844
946 Ga0501081_0050168
947 Ga0501081_0718839
948 Ga0501083_0008037
949 Ga0501083_0393052
950 Ga0501268_039996
951 Ga0501270_059470
952 Ga0501283_049060
953 Ga0501035_0315717
954 Ga0501045_0009723
955 Ga0501045_0014038
956 nmdc:mga05p37_186756_c1
957 nmdc:mga09592_91131_c1
958 nmdc:mga0qj67_3022_c1
959 nmdc:mga06r32_77166_c1
960 nmdc:mga06r32_882482_c1
961 nmdc:mga08y16_9037_c1
962 nmdc:mga0n895_108355_c1
963 nmdc:mga0rr50_559504_c1
964 nmdc:mga0a205_7709_c1
965 Ga0501084_0001187
966 Ga0501084_0002953
967 Ga0501084_0170156
968 Ga0501084_0202134
969 Ga0501084_0246566
970 Ga0590071_015280
971 Ga0501082_0006728
972 Ga0501082_0139082
973 Ga0501082_0399315
974 Ga0501082_0767316
975 Ga0501082_1125055
976 Ga0530510_0092799

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01467

CTP_transf_like

Cytidylyltransferase-like

6

135

0.92

PF08218

Citrate_ly_lig

Citrate lyase ligase C-terminal domain

5

118

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
8i8i-assembly2.cif.gz_C-2 crystal structure of phosphopantetheine adenylyltransferase from klebsiella pneumoniae at 2.59 a resolution 0.9737 2 160
6b7d-assembly1.cif.gz_A crystal structure of e.coli phosphopantetheine adenylyltransferase (ppat/coad) in complex with 3-(4-chlorophenyl)-6-methoxy-4,5-dimethylpyridazine 0.9694 2 159
6b7b-assembly1.cif.gz_A crystal structure of e.coli phosphopantetheine adenylyltransferase (ppat/coad) in complex with 5-methoxy-2-methyl-1h-indole 0.9685 2 159
8i8i-assembly2.cif.gz_C-2 crystal structure of phosphopantetheine adenylyltransferase from klebsiella pneumoniae at 2.59 a resolution 0.9677 2 160
8i8j-assembly1.cif.gz_B error: 404 client error: for url: https://data.rcsb.org/rest/v1/core/entry/8i8j 0.9668 1 160
ID Description Score Start End Superfamily
6g7vA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9607 4 160 3.40.50.620
3nbkD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9553 1 160 3.40.50.620
6g7vA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9479 4 160 3.40.50.620
5ts2A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9475 1 160 3.40.50.620
3nbkD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9438 1 160 3.40.50.620
ID Description Score Start End GO Terms
AF-A0A1W9PQH9-F1-model_v4 Phosphopantetheine adenylyltransferase (EC 2.7.7.3) (Dephospho-CoA pyrophosphorylase) (Pantetheine-phosphate adenylyltransferase) (PPAT) 0.9845 4 122 GO:0004595
GO:0005524
GO:0005737
GO:0015937
AF-A5V280-F1-model_v4 Phosphopantetheine adenylyltransferase (EC 2.7.7.3) (Dephospho-CoA pyrophosphorylase) (Pantetheine-phosphate adenylyltransferase) (PPAT) 0.983 4 159 GO:0004595
GO:0005524
GO:0005737
GO:0015937
AF-X1CLR4-F1-model_v4 Phosphopantetheine adenylyltransferase (EC 2.7.7.3) 0.9804 4 115 GO:0004595
GO:0005737
GO:0015937
AF-A0A373F7U0-F1-model_v4 Phosphopantetheine adenylyltransferase (EC 2.7.7.3) (Dephospho-CoA pyrophosphorylase) (Pantetheine-phosphate adenylyltransferase) (PPAT) 0.9787 4 160 GO:0004595
GO:0005524
GO:0005737
GO:0015937
AF-A0A3C0YCS7-F1-model_v4 Phosphopantetheine adenylyltransferase (EC 2.7.7.3) (Dephospho-CoA pyrophosphorylase) (Pantetheine-phosphate adenylyltransferase) (PPAT) 0.977 1 159 GO:0004595
GO:0005524
GO:0005737
GO:0015937

Map