F453552

General Info

Members Datasets Scaffolds Average Seq Length
488 229 976 151

Family's Representative Sequence

Representative Sequence 3300005339|Ga0070660_100087475|Ga0070660_1000874753
Length 180
Sequence MRASEPHPAPLCQPQPSRNFRRAALTSYTQAMSIVRNAAAIAKGMSITLKEVFQPTEVENYPDGKGPMRGAKFQERFRGKHQLQRDENGLEKCVACFLCAAACPSNCIYIEAADNTAEKRISSAERYAKVYNIDYTHGHGFELASLNATSLVMRKEDLLVPAHHLPDAVESEQDEAEVLS

Samples

Sample ID Description Type Environment
1 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
39 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
40 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
44 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
45 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
46 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
47 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
48 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
49 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
50 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
51 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
52 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
53 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
54 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
55 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
56 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
57 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
58 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
59 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
60 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
61 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
62 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
63 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
64 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
65 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
66 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
67 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
68 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
107 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
108 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
109 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
110 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
111 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
112 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
113 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
114 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
115 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
116 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
117 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
118 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
119 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
120 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
121 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
122 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
123 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
124 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
125 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
126 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
127 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
128 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
129 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
130 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
131 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
132 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
133 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
134 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
135 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
136 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
137 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
138 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
139 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
140 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
141 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
142 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
143 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
144 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
145 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
146 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
147 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
148 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
149 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
150 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
151 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
152 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
153 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
154 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
155 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
156 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
157 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
158 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
159 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
160 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
161 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
162 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
163 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
164 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
165 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
166 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
167 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
168 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
169 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
170 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
171 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
172 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
173 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
174 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
175 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
176 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
177 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
178 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
179 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
180 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
181 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
182 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
183 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
184 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
185 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
186 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
187 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
188 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
189 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
190 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
191 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
192 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
193 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
194 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
195 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
196 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
197 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
198 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
199 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
200 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
201 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
202 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
203 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
204 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
205 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
206 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
207 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
208 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
218 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
219 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
220 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
221 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
223 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
224 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
225 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
226 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
227 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
228 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
229 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.8
Metatranscriptomes 0.2
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.64
Nodule 0
Rhizoplane 5.53
Rhizosphere 90.57
Stem 0
Stem Tuber 0
Unclassified 3.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070660_100087475 3300005339 Bacteria 2453
2 Ga0065715_10378056 3300005293 Bacteria 911
3 Ga0070658_10005757 3300005327 Bacteria 10051
4 Ga0070658_10006882 3300005327 Bacteria 9189
5 Ga0070658_10145614 3300005327 Bacteria 1981
6 Ga0070658_10428095 3300005327 Bacteria 1139
7 Ga0070658_10913350 3300005327 Bacteria 763
8 Ga0070658_11524891 3300005327 Bacteria 579
9 Ga0070683_100037424 3300005329 Bacteria 4442
10 Ga0070683_100188085 3300005329 Bacteria 1960
11 Ga0070683_100731490 3300005329 Bacteria 948
12 Ga0070670_101542938 3300005331 Bacteria 610
13 Ga0070666_10021612 3300005335 Bacteria 4170
14 Ga0070666_10426446 3300005335 Bacteria 956
15 Ga0070680_100219461 3300005336 Bacteria 1605
16 Ga0070680_100229158 3300005336 Bacteria 1569
17 Ga0070682_101449200 3300005337 Bacteria 589
18 Ga0068868_100061728 3300005338 Unclassified 2969
19 Ga0068868_100683228 3300005338 Bacteria 917
20 Ga0070660_100287570 3300005339 Bacteria 1346
21 Ga0070691_10361448 3300005341 Bacteria 809
22 Ga0070687_100447915 3300005343 Bacteria 858
23 Ga0070661_100030465 3300005344 Bacteria 3898
24 Ga0070661_100208670 3300005344 Unclassified 1494
25 Ga0070661_100214365 3300005344 Bacteria 1475
26 Ga0070671_100012322 3300005355 Bacteria 6884
27 Ga0070671_100444033 3300005355 Bacteria 1112
28 Ga0070659_100000258 3300005366 Bacteria 41648
29 Ga0070659_100037809 3300005366 Bacteria 3763
30 Ga0070659_100100001 3300005366 Bacteria 2333
31 Ga0070659_100373465 3300005366 Bacteria 1200
32 Ga0070667_100237429 3300005367 Unclassified 1627
33 Ga0070714_100061820 3300005435 Bacteria 3217
34 Ga0070713_100024588 3300005436 Bacteria 4694
35 Ga0070710_10217407 3300005437 Bacteria 1214
36 Ga0070711_100616548 3300005439 Bacteria 906
37 Ga0070663_100008093 3300005455 Bacteria 6448
38 Ga0070663_100091428 3300005455 Bacteria 2255
39 Ga0070663_100202794 3300005455 Bacteria 1549
40 Ga0070663_100313665 3300005455 Bacteria 1259
41 Ga0070663_100644942 3300005455 Bacteria 895
42 Ga0070678_100568278 3300005456 Bacteria 1009
43 Ga0070662_100064077 3300005457 Bacteria 2690
44 Ga0070681_10035080 3300005458 Bacteria 5039
45 Ga0070681_10110984 3300005458 Bacteria 2681
46 Ga0070681_10150692 3300005458 Bacteria 2252
47 Ga0070681_10238142 3300005458 Bacteria 1734
48 Ga0070681_11372928 3300005458 Bacteria 630
49 Ga0068867_100250469 3300005459 Bacteria 1440
50 Ga0070679_100003252 3300005530 Bacteria 14854
51 Ga0070679_100004416 3300005530 Bacteria 13006
52 Ga0070679_100036457 3300005530 Bacteria 4880
53 Ga0070679_100067377 3300005530 Bacteria 3570
54 Ga0070679_100472890 3300005530 Bacteria 1198
55 Ga0068853_100000014 3300005539 Bacteria 227023
56 Ga0068853_100017042 3300005539 Bacteria 5991
57 Ga0068853_100022025 3300005539 Bacteria 5316
58 Ga0068853_100692456 3300005539 Bacteria 972
59 Ga0068853_100850281 3300005539 Bacteria 875
60 Ga0070672_100529140 3300005543 Bacteria 1022
61 Ga0070693_100307580 3300005547 Bacteria 1071
62 Ga0070665_100025901 3300005548 Bacteria 5906
63 Ga0070665_100320058 3300005548 Bacteria 1555
64 Ga0070665_100681105 3300005548 Bacteria 1041
65 Ga0068855_100017920 3300005563 Bacteria 8508
66 Ga0068855_100027496 3300005563 Bacteria 6802
67 Ga0068855_100042598 3300005563 Bacteria 5379
68 Ga0068855_100047550 3300005563 Bacteria 5068
69 Ga0068855_100108643 3300005563 Bacteria 3186
70 Ga0068855_100123742 3300005563 Bacteria 2958
71 Ga0068855_100134804 3300005563 Bacteria 2818
72 Ga0068855_100218518 3300005563 Bacteria 2138
73 Ga0068855_100227323 3300005563 Bacteria 2091
74 Ga0068855_100739350 3300005563 Bacteria 1050
75 Ga0070664_100776903 3300005564 Bacteria 895
76 Ga0070664_100906943 3300005564 Bacteria 826
77 Ga0070664_101187115 3300005564 Bacteria 720
78 Ga0068857_100107417 3300005577 Bacteria 2507
79 Ga0068857_100246902 3300005577 Bacteria 1635
80 Ga0068857_101397256 3300005577 Bacteria 681
81 Ga0068854_100000014 3300005578 Bacteria 163231
82 Ga0068854_100002084 3300005578 Bacteria 12260
83 Ga0068854_100090856 3300005578 Bacteria 2271
84 Ga0068856_100605189 3300005614 Bacteria 1117
85 Ga0068856_100690640 3300005614 Bacteria 1041
86 Ga0068856_100744015 3300005614 Bacteria 1000
87 Ga0068852_100070101 3300005616 Bacteria 3074
88 Ga0068852_100238760 3300005616 Bacteria 1736
89 Ga0068852_102270892 3300005616 Bacteria 564
90 Ga0068851_10015174 3300005834 Bacteria 3667
91 Ga0068863_100003591 3300005841 Bacteria 15307
92 Ga0070717_10078215 3300006028 Bacteria 2771
93 Ga0070717_10297230 3300006028 Bacteria 1435
94 Ga0070717_11177476 3300006028 Bacteria 698
95 Ga0070716_100026900 3300006173 Bacteria 3084
96 Ga0070716_100948332 3300006173 Bacteria 677
97 Ga0097621_100124356 3300006237 Bacteria 2190
98 Ga0068871_100085875 3300006358 Bacteria 2614
99 Ga0105240_10000002 3300009093 Bacteria 1924170
100 Ga0105240_10000437 3300009093 Bacteria 76980
101 Ga0105240_10021109 3300009093 Bacteria 8669
102 Ga0105240_10029782 3300009093 Bacteria 7104
103 Ga0105240_10155979 3300009093 Bacteria 2715
104 Ga0105240_10323599 3300009093 Unclassified 1757
105 Ga0105240_10348954 3300009093 Bacteria 1679
106 Ga0105240_10754481 3300009093 Bacteria 1058
107 Ga0105241_10650142 3300009174 Bacteria 957
108 Ga0105241_10706703 3300009174 Bacteria 921
109 Ga0105248_10062929 3300009177 Bacteria 4164
110 Ga0105248_10078666 3300009177 Bacteria 3707
111 Ga0105248_10970224 3300009177 Bacteria 960
112 Ga0105237_10010761 3300009545 Bacteria 9709
113 Ga0105238_10018133 3300009551 Bacteria 7158
114 Ga0105238_10065077 3300009551 Bacteria 3646
115 Ga0105238_10093289 3300009551 Bacteria 2998
116 Ga0105238_10131139 3300009551 Bacteria 2484
117 Ga0105238_10184249 3300009551 Bacteria 2064
118 Ga0105238_10200483 3300009551 Bacteria 1971
119 Ga0105238_10218133 3300009551 Bacteria 1883
120 Ga0105238_10484347 3300009551 Bacteria 1237
121 Ga0105239_10109490 3300010375 Bacteria 3061
122 Ga0105239_11145714 3300010375 Bacteria 896
123 Ga0105239_12571219 3300010375 Bacteria 594
124 Ga0157373_10038905 3300013100 Bacteria 3407
125 Ga0157373_10153120 3300013100 Bacteria 1622
126 Ga0157373_10236748 3300013100 Bacteria 1290
127 Ga0157371_10217862 3300013102 Bacteria 1371
128 Ga0157370_10014698 3300013104 Bacteria 7996
129 Ga0157370_10025029 3300013104 Bacteria 5908
130 Ga0157370_10036576 3300013104 Bacteria 4763
131 Ga0157370_10042769 3300013104 Bacteria 4364
132 Ga0157370_10088565 3300013104 Bacteria 2907
133 Ga0157370_10118813 3300013104 Bacteria 2469
134 Ga0157370_10194396 3300013104 Bacteria 1883
135 Ga0157370_10227529 3300013104 Bacteria 1726
136 Ga0157370_10229133 3300013104 Bacteria 1720
137 Ga0157370_10314584 3300013104 Bacteria 1445
138 Ga0157370_10371983 3300013104 Bacteria 1317
139 Ga0157370_10444929 3300013104 Bacteria 1191
140 Ga0157369_10005245 3300013105 Bacteria 15115
141 Ga0157369_10012215 3300013105 Bacteria 9751
142 Ga0157369_10016931 3300013105 Bacteria 8193
143 Ga0157369_10038881 3300013105 Bacteria 5201
144 Ga0157369_10076808 3300013105 Bacteria 3580
145 Ga0157369_10087685 3300013105 Bacteria 3323
146 Ga0157369_10149001 3300013105 Bacteria 2473
147 Ga0157369_11198964 3300013105 Bacteria 775
148 Ga0157374_10006610 3300013296 Bacteria 9852
149 Ga0157374_10133110 3300013296 Bacteria 2407
150 Ga0157374_10139100 3300013296 Bacteria 2356
151 Ga0157374_10164969 3300013296 Bacteria 2159
152 Ga0157374_10197849 3300013296 Bacteria 1967
153 Ga0157374_10292299 3300013296 Unclassified 1611
154 Ga0157378_10390705 3300013297 Bacteria 1368
155 Ga0157378_10586627 3300013297 Bacteria 1124
156 Ga0163162_10000825 3300013306 Bacteria 28845
157 Ga0163162_10097641 3300013306 Bacteria 3026
158 Ga0163162_10421359 3300013306 Bacteria 1467
159 Ga0163162_10617984 3300013306 Bacteria 1209
160 Ga0157372_10014463 3300013307 Bacteria 8444
161 Ga0157372_10015145 3300013307 Bacteria 8253
162 Ga0157372_10079020 3300013307 Bacteria 3719
163 Ga0157372_10216723 3300013307 Bacteria 2219
164 Ga0157372_10278571 3300013307 Bacteria 1944
165 Ga0157372_10724295 3300013307 Bacteria 1157
166 Ga0157372_11122199 3300013307 Bacteria 909
167 Ga0157375_10602921 3300013308 Bacteria 1257
168 Ga0163163_10080832 3300014325 Bacteria 3251
169 Ga0182008_10029360 3300014497 Bacteria 2779
170 Ga0157379_11045914 3300014968 Bacteria 780
171 Ga0157376_10101603 3300014969 Bacteria 2513
172 Ga0157376_10122860 3300014969 Bacteria 2304
173 Ga0157376_10246518 3300014969 Bacteria 1667
174 Ga0157376_10814503 3300014969 Bacteria 947
175 Ga0157376_11086388 3300014969 Unclassified 825
176 Ga0157376_12310537 3300014969 Bacteria 577
177 Ga0182007_10030780 3300015262 Unclassified 1832
178 Ga0182005_1027529 3300015265 Bacteria 1550
179 Ga0197907_10671735 3300020069 Bacteria 601
180 Ga0213872_10007492 3300021361 Bacteria 5365
181 Ga0213876_10257220 3300021384 Bacteria 928
182 Ga0213871_10000497 3300021441 Bacteria 5391
183 Ga0209233_1001766 3300025261 Bacteria 8342
184 Ga0209233_1070702 3300025261 Bacteria 646
185 Ga0207656_10059654 3300025321 Bacteria 1670
186 Ga0207692_10261060 3300025898 Bacteria 1041
187 Ga0207680_10152192 3300025903 Bacteria 1543
188 Ga0207647_10042909 3300025904 Bacteria 2833
189 Ga0207647_10102738 3300025904 Bacteria 1695
190 Ga0207705_10000517 3300025909 Bacteria 32944
191 Ga0207705_10056745 3300025909 Bacteria 2824
192 Ga0207705_10070533 3300025909 Bacteria 2532
193 Ga0207705_10113157 3300025909 Bacteria 2007
194 Ga0207705_10168005 3300025909 Bacteria 1651
195 Ga0207707_10014903 3300025912 Bacteria 6770
196 Ga0207695_10000002 3300025913 Bacteria 2188391
197 Ga0207695_10000432 3300025913 Bacteria 91934
198 Ga0207695_10005047 3300025913 Bacteria 17724
199 Ga0207695_10109398 3300025913 Bacteria 2746
200 Ga0207695_10367056 3300025913 Bacteria 1326
201 Ga0207671_10025877 3300025914 Bacteria 4403
202 Ga0207693_10226127 3300025915 Bacteria 1470
203 Ga0207662_10445370 3300025918 Bacteria 885
204 Ga0207657_10000647 3300025919 Bacteria 37065
205 Ga0207657_10004649 3300025919 Bacteria 14501
206 Ga0207657_10042770 3300025919 Bacteria 3995
207 Ga0207657_10151107 3300025919 Bacteria 1892
208 Ga0207649_10144557 3300025920 Unclassified 1631
209 Ga0207649_10171280 3300025920 Bacteria 1513
210 Ga0207652_10000732 3300025921 Bacteria 31770
211 Ga0207652_10017625 3300025921 Bacteria 5846
212 Ga0207652_10263885 3300025921 Bacteria 1553
213 Ga0207694_10008629 3300025924 Bacteria 7694
214 Ga0207694_10015841 3300025924 Bacteria 5686
215 Ga0207694_10131118 3300025924 Bacteria 2009
216 Ga0207694_10257008 3300025924 Bacteria 1430
217 Ga0207694_10298303 3300025924 Bacteria 1326
218 Ga0207694_10451159 3300025924 Bacteria 1073
219 Ga0207694_10779698 3300025924 Bacteria 807
220 Ga0207687_10006171 3300025927 Bacteria 7931
221 Ga0207687_10119029 3300025927 Unclassified 1972
222 Ga0207700_10007835 3300025928 Bacteria 6567
223 Ga0207664_10092357 3300025929 Bacteria 2484
224 Ga0207644_10029784 3300025931 Bacteria 3789
225 Ga0207690_10001142 3300025932 Bacteria 16884
226 Ga0207690_10169792 3300025932 Bacteria 1633
227 Ga0207690_10354058 3300025932 Bacteria 1162
228 Ga0207706_10030768 3300025933 Bacteria 4787
229 Ga0207711_10141421 3300025941 Bacteria 2166
230 Ga0207711_10178251 3300025941 Bacteria 1931
231 Ga0207711_10557443 3300025941 Bacteria 1069
232 Ga0207661_10457071 3300025944 Bacteria 1163
233 Ga0207661_10729314 3300025944 Bacteria 912
234 Ga0207661_11419515 3300025944 Bacteria 637
235 Ga0207679_10387003 3300025945 Bacteria 1227
236 Ga0207679_10742814 3300025945 Bacteria 892
237 Ga0207679_11120319 3300025945 Bacteria 722
238 Ga0207667_10002365 3300025949 Bacteria 23617
239 Ga0207667_10012083 3300025949 Bacteria 9982
240 Ga0207667_10019687 3300025949 Bacteria 7524
241 Ga0207667_10024740 3300025949 Bacteria 6585
242 Ga0207667_10093005 3300025949 Bacteria 3114
243 Ga0207667_10207561 3300025949 Bacteria 2008
244 Ga0207667_10226844 3300025949 Bacteria 1913
245 Ga0207667_10256305 3300025949 Bacteria 1789
246 Ga0207667_11111768 3300025949 Bacteria 773
247 Ga0207712_10005487 3300025961 Bacteria 8002
248 Ga0207668_10260091 3300025972 Bacteria 1414
249 Ga0207640_10000010 3300025981 Bacteria 275745
250 Ga0207640_10004770 3300025981 Bacteria 7362
251 Ga0207677_10655412 3300026023 Bacteria 927
252 Ga0207639_10000247 3300026041 Bacteria 40068
253 Ga0207639_10095100 3300026041 Bacteria 2393
254 Ga0207639_10315234 3300026041 Bacteria 1387
255 Ga0207678_10020091 3300026067 Bacteria 5867
256 Ga0207678_10057549 3300026067 Bacteria 3345
257 Ga0207678_10290795 3300026067 Bacteria 1403
258 Ga0207678_10699862 3300026067 Bacteria 892
259 Ga0207678_10777319 3300026067 Bacteria 845
260 Ga0207702_10110276 3300026078 Bacteria 2445
261 Ga0207702_10329348 3300026078 Bacteria 1456
262 Ga0207702_10629178 3300026078 Bacteria 1054
263 Ga0207702_10938417 3300026078 Bacteria 858
264 Ga0207641_10493338 3300026088 Bacteria 1188
265 Ga0207648_10466595 3300026089 Bacteria 1151
266 Ga0207676_10041300 3300026095 Bacteria 3540
267 Ga0207674_10001485 3300026116 Bacteria 30265
268 Ga0207683_10277441 3300026121 Bacteria 1532
269 Ga0207698_10101451 3300026142 Bacteria 2386
270 Ga0207698_10156364 3300026142 Bacteria 1987
271 Ga0207698_10502788 3300026142 Bacteria 1180
272 Ga0268266_10004481 3300028379 Bacteria 13353
273 Ga0268266_10194120 3300028379 Bacteria 1855
274 Ga0268266_10421107 3300028379 Bacteria 1265
275 Ga0268266_10545250 3300028379 Bacteria 1111
276 Ga0268266_10928444 3300028379 Bacteria 842
277 Ga0268266_11280144 3300028379 Bacteria 708
278 Ga0265338_10049813 3300028800 Bacteria 3792
279 Ga0265338_10254010 3300028800 Bacteria 1295
280 Ga0265330_10059152 3300031235 Bacteria 1669
281 Ga0265331_10099916 3300031250 Bacteria 1336
282 Ga0265316_10524456 3300031344 Bacteria 845
283 Ga0307510_10017839 3300033180 Bacteria 8362
284 Ga0307510_10063899 3300033180 Bacteria 3742
285 Ga0307510_10315968 3300033180 Bacteria 1020
286 Ga0373926_0004572 3300035083 Bacteria 4541
287 Ga0373923_0097916 3300035111 Bacteria 1290
288 Ga0373923_0124449 3300035111 Bacteria 1154
289 Ga0373945_0010050 3300035116 Bacteria 3111
290 Ga0373956_0249787 3300035119 Bacteria 843
291 Ga0373943_0020856 3300035170 Bacteria 3024
292 Ga0373946_0005180 3300035171 Bacteria 4699
293 Ga0373924_0000147 3300035410 Bacteria 20622
294 Ga0373924_0075651 3300035410 Bacteria 1425
295 Ga0373935_0006079 3300035692 Bacteria 7179
296 Ga0373935_0050300 3300035692 Unclassified 2644
297 Ga0373935_0183229 3300035692 Bacteria 1439
298 Ga0373935_0470694 3300035692 Bacteria 909
299 Ga0373927_0102286 3300035695 Bacteria 1864
300 Ga0373927_0107447 3300035695 Bacteria 1817
301 Ga0373933_0416731 3300035724 Bacteria 877
302 Ga0373947_0087795 3300035725 Bacteria 1934
303 Ga0373937_0026535 3300036401 Bacteria 5234
304 Ga0373937_0101474 3300036401 Bacteria 2671
305 Ga0373937_1251049 3300036401 Bacteria 690
306 Ga0373925_0005534 3300037068 Bacteria 9404
307 Ga0373925_0107340 3300037068 Bacteria 2153
308 Ga0373925_0110331 3300037068 Bacteria 2124
309 Ga0373925_1192136 3300037068 Bacteria 626
310 Ga0395900_0174521 3300037418 Bacteria 2187
311 Ga0395900_0355814 3300037418 Bacteria 1437
312 Ga0436365_1281494 3300039437 Bacteria 768
313 Ga0436360_0293936 3300039438 Unclassified 874
314 Ga0436360_1126178 3300039438 Bacteria 6937
315 Ga0436361_0209357 3300039447 Bacteria 1662
316 Ga0436361_0237503 3300039447 Bacteria 21139
317 Ga0436361_0945626 3300039447 Bacteria 955
318 Ga0436362_0721411 3300039453 Bacteria 9214
319 Ga0466963_0181295 3300044694 Bacteria 1470
320 Ga0453684_1095632 3300044712 Bacteria 842
321 Ga0466959_0413893 3300045049 Bacteria 915
322 Ga0466967_0282360 3300045976 Bacteria 1593
323 Ga0466967_1030659 3300045976 Bacteria 819
324 Ga0495651_0123580 3300046462 Bacteria 1898
325 Ga0495653_0045816 3300046463 Bacteria 3389
326 Ga0495650_0000009 3300046471 Bacteria 653845
327 Ga0495650_0010354 3300046471 Bacteria 5211
328 Ga0495580_0022567 3300046472 Bacteria 4631
329 Ga0495580_0046450 3300046472 Bacteria 3081
330 Ga0495580_0062115 3300046472 Bacteria 2622
331 Ga0495582_0023325 3300046473 Bacteria 3386
332 Ga0495582_0036838 3300046473 Bacteria 2691
333 Ga0495582_0093641 3300046473 Bacteria 1677
334 Ga0495639_0074403 3300046475 Bacteria 1574
335 Ga0495639_0192948 3300046475 Bacteria 995
336 Ga0495662_0249717 3300046476 Bacteria 874
337 Ga0495664_0081794 3300046477 Bacteria 1936
338 Ga0495664_0173585 3300046477 Bacteria 1308
339 Ga0495585_0239781 3300046492 Bacteria 908
340 Ga0495594_0007411 3300046499 Bacteria 5644
341 Ga0495594_0008550 3300046499 Bacteria 5278
342 Ga0495583_0016976 3300046506 Bacteria 3884
343 Ga0495583_0027068 3300046506 Bacteria 2833
344 Ga0495606_0076321 3300046507 Bacteria 2095
345 Ga0495606_0115687 3300046507 Bacteria 1612
346 Ga0495606_0179743 3300046507 Bacteria 1221
347 Ga0495606_0203124 3300046507 Bacteria 1128
348 Ga0495616_0310489 3300046513 Bacteria 664
349 Ga0495618_0251397 3300046514 Bacteria 1109
350 Ga0495628_0007330 3300046516 Bacteria 9551
351 Ga0495628_0091260 3300046516 Bacteria 2358
352 Ga0495630_0016721 3300046517 Bacteria 5366
353 Ga0495630_0132981 3300046517 Bacteria 1890
354 Ga0495631_0096138 3300046518 Bacteria 1275
355 Ga0495643_0025385 3300046522 Bacteria 3353
356 Ga0495644_0007470 3300046523 Bacteria 4211
357 Ga0495666_0071491 3300046526 Bacteria 1649
358 Ga0495642_0235541 3300046528 Bacteria 800
359 Ga0495652_0044035 3300046529 Bacteria 3844
360 Ga0495652_0134954 3300046529 Bacteria 1948
361 Ga0495665_0034507 3300046531 Bacteria 2705
362 Ga0495640_0094955 3300046533 Bacteria 1963
363 Ga0495586_0026242 3300046535 Bacteria 3117
364 Ga0495587_0069764 3300046536 Bacteria 2046
365 Ga0495587_0196935 3300046536 Bacteria 1140
366 Ga0495609_0013170 3300046538 Bacteria 3911
367 Ga0495609_0078833 3300046538 Bacteria 1441
368 Ga0495645_0003041 3300046543 Bacteria 11351
369 Ga0495645_0038809 3300046543 Bacteria 3473
370 Ga0495645_0102861 3300046543 Bacteria 2030
371 Ga0495622_0282210 3300046557 Bacteria 726
372 Ga0495633_0025201 3300046558 Bacteria 2930
373 Ga0495667_0018377 3300046559 Bacteria 4721
374 Ga0495668_0192192 3300046616 Bacteria 1118
375 Ga0495634_0004299 3300046642 Bacteria 11229
376 Ga0495625_0002999 3300046660 Bacteria 17421
377 Ga0495625_0010705 3300046660 Bacteria 7554
378 Ga0495625_0023127 3300046660 Bacteria 4751
379 Ga0495625_0050003 3300046660 Bacteria 3002
380 Ga0495635_0021251 3300046663 Bacteria 4524
381 Ga0495635_0140664 3300046663 Bacteria 1644
382 Ga0495657_0216649 3300046675 Unclassified 1162
383 Ga0495599_0019017 3300046678 Bacteria 4283
384 Ga0495599_0171130 3300046678 Bacteria 1340
385 Ga0495623_0297856 3300046679 Bacteria 892
386 Ga0495623_0465207 3300046679 Bacteria 671
387 Ga0495623_0574460 3300046679 Bacteria 588
388 Ga0495646_0001478 3300046680 Bacteria 13962
389 Ga0495647_0091502 3300046681 Bacteria 1248
390 Ga0495669_0001984 3300046684 Bacteria 8402
391 Ga0495669_0077825 3300046684 Bacteria 1519
392 Ga0495613_0005290 3300046689 Bacteria 9696
393 Ga0495613_0005924 3300046689 Bacteria 9147
394 Ga0495613_0301385 3300046689 Bacteria 1109
395 Ga0495624_0067477 3300046690 Bacteria 2231
396 Ga0495670_0023633 3300046691 Bacteria 3034
397 Ga0495649_0041128 3300046694 Bacteria 2529
398 Ga0495600_0017970 3300046809 Bacteria 4501
399 Ga0495581_0014642 3300047315 Bacteria 4547
400 Ga0495581_0094010 3300047315 Bacteria 1740
401 Ga0495581_0155565 3300047315 Unclassified 1336
402 Ga0495604_0053835 3300047317 Bacteria 3108
403 Ga0495604_0073403 3300047317 Bacteria 2583
404 Ga0495674_0024426 3300047319 Bacteria 5554
405 Ga0495672_0001768 3300047320 Bacteria 20768
406 Ga0495676_0009451 3300047321 Bacteria 8880
407 Ga0495683_0206777 3300047323 Bacteria 882
408 Ga0495675_0030553 3300047444 Bacteria 3437
409 Ga0495677_0023902 3300047445 Bacteria 2217
410 Ga0495673_0066776 3300047469 Bacteria 1524
411 Ga0495673_0104518 3300047469 Bacteria 1140
412 Ga0495684_0078299 3300047471 Bacteria 2509
413 Ga0495684_0146481 3300047471 Bacteria 1768
414 Ga0495686_0000031 3300047472 Bacteria 350171
415 Ga0495686_0000563 3300047472 Bacteria 52840
416 Ga0495686_0005986 3300047472 Bacteria 9464
417 Ga0495686_0006557 3300047472 Bacteria 8880
418 Ga0495686_0009576 3300047472 Bacteria 6963
419 Ga0495602_0184638 3300048088 Bacteria 1605
420 Ga0495614_0030488 3300048089 Bacteria 2322
421 Ga0495614_0060755 3300048089 Bacteria 1623
422 Ga0496100_0258358 3300048903 Bacteria 1291
423 Ga0496101_0422570 3300048904 Bacteria 1051
424 Ga0496102_0599472 3300048905 Unclassified 1025
425 Ga0496103_0025252 3300048906 Bacteria 3590
426 Ga0496104_0000276 3300048907 Bacteria 45779
427 Ga0496104_0013808 3300048907 Bacteria 7286
428 Ga0496104_0123436 3300048907 Bacteria 2486
429 Ga0496104_0133019 3300048907 Bacteria 2390
430 Ga0496104_0454045 3300048907 Bacteria 1193
431 Ga0496107_0061064 3300048910 Bacteria 2729
432 Ga0496107_0193083 3300048910 Unclassified 1513
433 Ga0496108_0162869 3300048911 Bacteria 1928
434 Ga0496109_0215297 3300048912 Unclassified 1806
435 Ga0496109_0352267 3300048912 Bacteria 1391
436 Ga0496109_1333325 3300048912 Bacteria 653
437 Ga0496110_0024668 3300048913 Bacteria 5128
438 Ga0496110_0377993 3300048913 Bacteria 1291
439 Ga0496111_0138531 3300048914 Bacteria 1803
440 Ga0496111_0256962 3300048914 Bacteria 1296
441 Ga0496111_0259054 3300048914 Bacteria 1291
442 Ga0496112_0013108 3300048915 Bacteria 7650
443 Ga0496112_0194297 3300048915 Bacteria 1990
444 Ga0496112_0391186 3300048915 Unclassified 1331
445 Ga0496113_0000340 3300048916 Bacteria 22214
446 Ga0496113_0151034 3300048916 Unclassified 1832
447 Ga0496114_0117019 3300048917 Bacteria 2289
448 Ga0496115_0106225 3300048918 Bacteria 2305
449 Ga0496126_0000074 3300048929 Bacteria 235643
450 Ga0496126_0000460 3300048929 Bacteria 81061
451 Ga0496126_0000853 3300048929 Bacteria 53738
452 Ga0496126_0001440 3300048929 Bacteria 37295
453 Ga0496126_0518971 3300048929 Bacteria 950
454 Ga0496126_0610952 3300048929 Bacteria 858
455 Ga0495682_0021214 3300049460 Bacteria 2435
456 Ga0501033_0005058 3300049570 Bacteria 10500
457 Ga0501034_0017119 3300049571 Bacteria 7436
458 Ga0501034_0055245 3300049571 Bacteria 3996
459 Ga0501036_0028140 3300049572 Bacteria 4751
460 Ga0501037_0012325 3300049573 Bacteria 6293
461 Ga0501037_0289371 3300049573 Bacteria 1140
462 Ga0501038_0011015 3300049574 Bacteria 8256
463 Ga0501043_0001456 3300049579 Bacteria 20697
464 Ga0501043_0100481 3300049579 Bacteria 2274
465 Ga0501046_0000405 3300049580 Bacteria 43084
466 Ga0501046_0121708 3300049580 Bacteria 1985
467 Ga0501047_0000245 3300049581 Bacteria 64482
468 Ga0501047_0030886 3300049581 Bacteria 5165
469 Ga0501048_0481677 3300049582 Bacteria 889
470 Ga0501069_0464837 3300049585 Bacteria 753
471 Ga0501073_0046041 3300049589 Bacteria 3070
472 Ga0501073_0063242 3300049589 Bacteria 2582
473 Ga0501073_0156577 3300049589 Bacteria 1579
474 Ga0501073_0191032 3300049589 Bacteria 1417
475 Ga0501079_1124482 3300049741 Bacteria 619
476 Ga0501080_0078237 3300049742 Bacteria 3076
477 Ga0501035_0005392 3300049822 Bacteria 12090
478 Ga0501035_0011833 3300049822 Bacteria 8079
479 Ga0501044_0009496 3300049823 Bacteria 10591
480 Ga0501044_0244844 3300049823 Bacteria 1736
481 Ga0501044_0268293 3300049823 Bacteria 1643
482 Ga0495601_0275969 3300053077 Bacteria 1096
483 Ga0500578_0389471 3300053086 Bacteria 806
484 Ga0500643_196003 3300053087 Bacteria 542
485 Ga0500651_0000002 3300053093 Bacteria 476609
486 Ga0500595_000032 3300053119 Bacteria 111447
487 Ga0500573_0157279 3300053140 Bacteria 1240
488 Ga0500661_000139 3300055283 Bacteria 12333
489 Ga0070660_100087475
490 Ga0065715_10378056
491 Ga0070658_10005757
492 Ga0070658_10006882
493 Ga0070658_10145614
494 Ga0070658_10428095
495 Ga0070658_10913350
496 Ga0070658_11524891
497 Ga0070683_100037424
498 Ga0070683_100188085
499 Ga0070683_100731490
500 Ga0070670_101542938
501 Ga0070666_10021612
502 Ga0070666_10426446
503 Ga0070680_100219461
504 Ga0070680_100229158
505 Ga0070682_101449200
506 Ga0068868_100061728
507 Ga0068868_100683228
508 Ga0070660_100287570
509 Ga0070691_10361448
510 Ga0070687_100447915
511 Ga0070661_100030465
512 Ga0070661_100208670
513 Ga0070661_100214365
514 Ga0070671_100012322
515 Ga0070671_100444033
516 Ga0070659_100000258
517 Ga0070659_100037809
518 Ga0070659_100100001
519 Ga0070659_100373465
520 Ga0070667_100237429
521 Ga0070714_100061820
522 Ga0070713_100024588
523 Ga0070710_10217407
524 Ga0070711_100616548
525 Ga0070663_100008093
526 Ga0070663_100091428
527 Ga0070663_100202794
528 Ga0070663_100313665
529 Ga0070663_100644942
530 Ga0070678_100568278
531 Ga0070662_100064077
532 Ga0070681_10035080
533 Ga0070681_10110984
534 Ga0070681_10150692
535 Ga0070681_10238142
536 Ga0070681_11372928
537 Ga0068867_100250469
538 Ga0070679_100003252
539 Ga0070679_100004416
540 Ga0070679_100036457
541 Ga0070679_100067377
542 Ga0070679_100472890
543 Ga0068853_100000014
544 Ga0068853_100017042
545 Ga0068853_100022025
546 Ga0068853_100692456
547 Ga0068853_100850281
548 Ga0070672_100529140
549 Ga0070693_100307580
550 Ga0070665_100025901
551 Ga0070665_100320058
552 Ga0070665_100681105
553 Ga0068855_100017920
554 Ga0068855_100027496
555 Ga0068855_100042598
556 Ga0068855_100047550
557 Ga0068855_100108643
558 Ga0068855_100123742
559 Ga0068855_100134804
560 Ga0068855_100218518
561 Ga0068855_100227323
562 Ga0068855_100739350
563 Ga0070664_100776903
564 Ga0070664_100906943
565 Ga0070664_101187115
566 Ga0068857_100107417
567 Ga0068857_100246902
568 Ga0068857_101397256
569 Ga0068854_100000014
570 Ga0068854_100002084
571 Ga0068854_100090856
572 Ga0068856_100605189
573 Ga0068856_100690640
574 Ga0068856_100744015
575 Ga0068852_100070101
576 Ga0068852_100238760
577 Ga0068852_102270892
578 Ga0068851_10015174
579 Ga0068863_100003591
580 Ga0070717_10078215
581 Ga0070717_10297230
582 Ga0070717_11177476
583 Ga0070716_100026900
584 Ga0070716_100948332
585 Ga0097621_100124356
586 Ga0068871_100085875
587 Ga0105240_10000002
588 Ga0105240_10000437
589 Ga0105240_10021109
590 Ga0105240_10029782
591 Ga0105240_10155979
592 Ga0105240_10323599
593 Ga0105240_10348954
594 Ga0105240_10754481
595 Ga0105241_10650142
596 Ga0105241_10706703
597 Ga0105248_10062929
598 Ga0105248_10078666
599 Ga0105248_10970224
600 Ga0105237_10010761
601 Ga0105238_10018133
602 Ga0105238_10065077
603 Ga0105238_10093289
604 Ga0105238_10131139
605 Ga0105238_10184249
606 Ga0105238_10200483
607 Ga0105238_10218133
608 Ga0105238_10484347
609 Ga0105239_10109490
610 Ga0105239_11145714
611 Ga0105239_12571219
612 Ga0157373_10038905
613 Ga0157373_10153120
614 Ga0157373_10236748
615 Ga0157371_10217862
616 Ga0157370_10014698
617 Ga0157370_10025029
618 Ga0157370_10036576
619 Ga0157370_10042769
620 Ga0157370_10088565
621 Ga0157370_10118813
622 Ga0157370_10194396
623 Ga0157370_10227529
624 Ga0157370_10229133
625 Ga0157370_10314584
626 Ga0157370_10371983
627 Ga0157370_10444929
628 Ga0157369_10005245
629 Ga0157369_10012215
630 Ga0157369_10016931
631 Ga0157369_10038881
632 Ga0157369_10076808
633 Ga0157369_10087685
634 Ga0157369_10149001
635 Ga0157369_11198964
636 Ga0157374_10006610
637 Ga0157374_10133110
638 Ga0157374_10139100
639 Ga0157374_10164969
640 Ga0157374_10197849
641 Ga0157374_10292299
642 Ga0157378_10390705
643 Ga0157378_10586627
644 Ga0163162_10000825
645 Ga0163162_10097641
646 Ga0163162_10421359
647 Ga0163162_10617984
648 Ga0157372_10014463
649 Ga0157372_10015145
650 Ga0157372_10079020
651 Ga0157372_10216723
652 Ga0157372_10278571
653 Ga0157372_10724295
654 Ga0157372_11122199
655 Ga0157375_10602921
656 Ga0163163_10080832
657 Ga0182008_10029360
658 Ga0157379_11045914
659 Ga0157376_10101603
660 Ga0157376_10122860
661 Ga0157376_10246518
662 Ga0157376_10814503
663 Ga0157376_11086388
664 Ga0157376_12310537
665 Ga0182007_10030780
666 Ga0182005_1027529
667 Ga0197907_10671735
668 Ga0213872_10007492
669 Ga0213876_10257220
670 Ga0213871_10000497
671 Ga0209233_1001766
672 Ga0209233_1070702
673 Ga0207656_10059654
674 Ga0207692_10261060
675 Ga0207680_10152192
676 Ga0207647_10042909
677 Ga0207647_10102738
678 Ga0207705_10000517
679 Ga0207705_10056745
680 Ga0207705_10070533
681 Ga0207705_10113157
682 Ga0207705_10168005
683 Ga0207707_10014903
684 Ga0207695_10000002
685 Ga0207695_10000432
686 Ga0207695_10005047
687 Ga0207695_10109398
688 Ga0207695_10367056
689 Ga0207671_10025877
690 Ga0207693_10226127
691 Ga0207662_10445370
692 Ga0207657_10000647
693 Ga0207657_10004649
694 Ga0207657_10042770
695 Ga0207657_10151107
696 Ga0207649_10144557
697 Ga0207649_10171280
698 Ga0207652_10000732
699 Ga0207652_10017625
700 Ga0207652_10263885
701 Ga0207694_10008629
702 Ga0207694_10015841
703 Ga0207694_10131118
704 Ga0207694_10257008
705 Ga0207694_10298303
706 Ga0207694_10451159
707 Ga0207694_10779698
708 Ga0207687_10006171
709 Ga0207687_10119029
710 Ga0207700_10007835
711 Ga0207664_10092357
712 Ga0207644_10029784
713 Ga0207690_10001142
714 Ga0207690_10169792
715 Ga0207690_10354058
716 Ga0207706_10030768
717 Ga0207711_10141421
718 Ga0207711_10178251
719 Ga0207711_10557443
720 Ga0207661_10457071
721 Ga0207661_10729314
722 Ga0207661_11419515
723 Ga0207679_10387003
724 Ga0207679_10742814
725 Ga0207679_11120319
726 Ga0207667_10002365
727 Ga0207667_10012083
728 Ga0207667_10019687
729 Ga0207667_10024740
730 Ga0207667_10093005
731 Ga0207667_10207561
732 Ga0207667_10226844
733 Ga0207667_10256305
734 Ga0207667_11111768
735 Ga0207712_10005487
736 Ga0207668_10260091
737 Ga0207640_10000010
738 Ga0207640_10004770
739 Ga0207677_10655412
740 Ga0207639_10000247
741 Ga0207639_10095100
742 Ga0207639_10315234
743 Ga0207678_10020091
744 Ga0207678_10057549
745 Ga0207678_10290795
746 Ga0207678_10699862
747 Ga0207678_10777319
748 Ga0207702_10110276
749 Ga0207702_10329348
750 Ga0207702_10629178
751 Ga0207702_10938417
752 Ga0207641_10493338
753 Ga0207648_10466595
754 Ga0207676_10041300
755 Ga0207674_10001485
756 Ga0207683_10277441
757 Ga0207698_10101451
758 Ga0207698_10156364
759 Ga0207698_10502788
760 Ga0268266_10004481
761 Ga0268266_10194120
762 Ga0268266_10421107
763 Ga0268266_10545250
764 Ga0268266_10928444
765 Ga0268266_11280144
766 Ga0265338_10049813
767 Ga0265338_10254010
768 Ga0265330_10059152
769 Ga0265331_10099916
770 Ga0265316_10524456
771 Ga0307510_10017839
772 Ga0307510_10063899
773 Ga0307510_10315968
774 Ga0373926_0004572
775 Ga0373923_0097916
776 Ga0373923_0124449
777 Ga0373945_0010050
778 Ga0373956_0249787
779 Ga0373943_0020856
780 Ga0373946_0005180
781 Ga0373924_0000147
782 Ga0373924_0075651
783 Ga0373935_0006079
784 Ga0373935_0050300
785 Ga0373935_0183229
786 Ga0373935_0470694
787 Ga0373927_0102286
788 Ga0373927_0107447
789 Ga0373933_0416731
790 Ga0373947_0087795
791 Ga0373937_0026535
792 Ga0373937_0101474
793 Ga0373937_1251049
794 Ga0373925_0005534
795 Ga0373925_0107340
796 Ga0373925_0110331
797 Ga0373925_1192136
798 Ga0395900_0174521
799 Ga0395900_0355814
800 Ga0436365_1281494
801 Ga0436360_0293936
802 Ga0436360_1126178
803 Ga0436361_0209357
804 Ga0436361_0237503
805 Ga0436361_0945626
806 Ga0436362_0721411
807 Ga0466963_0181295
808 Ga0453684_1095632
809 Ga0466959_0413893
810 Ga0466967_0282360
811 Ga0466967_1030659
812 Ga0495651_0123580
813 Ga0495653_0045816
814 Ga0495650_0000009
815 Ga0495650_0010354
816 Ga0495580_0022567
817 Ga0495580_0046450
818 Ga0495580_0062115
819 Ga0495582_0023325
820 Ga0495582_0036838
821 Ga0495582_0093641
822 Ga0495639_0074403
823 Ga0495639_0192948
824 Ga0495662_0249717
825 Ga0495664_0081794
826 Ga0495664_0173585
827 Ga0495585_0239781
828 Ga0495594_0007411
829 Ga0495594_0008550
830 Ga0495583_0016976
831 Ga0495583_0027068
832 Ga0495606_0076321
833 Ga0495606_0115687
834 Ga0495606_0179743
835 Ga0495606_0203124
836 Ga0495616_0310489
837 Ga0495618_0251397
838 Ga0495628_0007330
839 Ga0495628_0091260
840 Ga0495630_0016721
841 Ga0495630_0132981
842 Ga0495631_0096138
843 Ga0495643_0025385
844 Ga0495644_0007470
845 Ga0495666_0071491
846 Ga0495642_0235541
847 Ga0495652_0044035
848 Ga0495652_0134954
849 Ga0495665_0034507
850 Ga0495640_0094955
851 Ga0495586_0026242
852 Ga0495587_0069764
853 Ga0495587_0196935
854 Ga0495609_0013170
855 Ga0495609_0078833
856 Ga0495645_0003041
857 Ga0495645_0038809
858 Ga0495645_0102861
859 Ga0495622_0282210
860 Ga0495633_0025201
861 Ga0495667_0018377
862 Ga0495668_0192192
863 Ga0495634_0004299
864 Ga0495625_0002999
865 Ga0495625_0010705
866 Ga0495625_0023127
867 Ga0495625_0050003
868 Ga0495635_0021251
869 Ga0495635_0140664
870 Ga0495657_0216649
871 Ga0495599_0019017
872 Ga0495599_0171130
873 Ga0495623_0297856
874 Ga0495623_0465207
875 Ga0495623_0574460
876 Ga0495646_0001478
877 Ga0495647_0091502
878 Ga0495669_0001984
879 Ga0495669_0077825
880 Ga0495613_0005290
881 Ga0495613_0005924
882 Ga0495613_0301385
883 Ga0495624_0067477
884 Ga0495670_0023633
885 Ga0495649_0041128
886 Ga0495600_0017970
887 Ga0495581_0014642
888 Ga0495581_0094010
889 Ga0495581_0155565
890 Ga0495604_0053835
891 Ga0495604_0073403
892 Ga0495674_0024426
893 Ga0495672_0001768
894 Ga0495676_0009451
895 Ga0495683_0206777
896 Ga0495675_0030553
897 Ga0495677_0023902
898 Ga0495673_0066776
899 Ga0495673_0104518
900 Ga0495684_0078299
901 Ga0495684_0146481
902 Ga0495686_0000031
903 Ga0495686_0000563
904 Ga0495686_0005986
905 Ga0495686_0006557
906 Ga0495686_0009576
907 Ga0495602_0184638
908 Ga0495614_0030488
909 Ga0495614_0060755
910 Ga0496100_0258358
911 Ga0496101_0422570
912 Ga0496102_0599472
913 Ga0496103_0025252
914 Ga0496104_0000276
915 Ga0496104_0013808
916 Ga0496104_0123436
917 Ga0496104_0133019
918 Ga0496104_0454045
919 Ga0496107_0061064
920 Ga0496107_0193083
921 Ga0496108_0162869
922 Ga0496109_0215297
923 Ga0496109_0352267
924 Ga0496109_1333325
925 Ga0496110_0024668
926 Ga0496110_0377993
927 Ga0496111_0138531
928 Ga0496111_0256962
929 Ga0496111_0259054
930 Ga0496112_0013108
931 Ga0496112_0194297
932 Ga0496112_0391186
933 Ga0496113_0000340
934 Ga0496113_0151034
935 Ga0496114_0117019
936 Ga0496115_0106225
937 Ga0496126_0000074
938 Ga0496126_0000460
939 Ga0496126_0000853
940 Ga0496126_0001440
941 Ga0496126_0518971
942 Ga0496126_0610952
943 Ga0495682_0021214
944 Ga0501033_0005058
945 Ga0501034_0017119
946 Ga0501034_0055245
947 Ga0501036_0028140
948 Ga0501037_0012325
949 Ga0501037_0289371
950 Ga0501038_0011015
951 Ga0501043_0001456
952 Ga0501043_0100481
953 Ga0501046_0000405
954 Ga0501046_0121708
955 Ga0501047_0000245
956 Ga0501047_0030886
957 Ga0501048_0481677
958 Ga0501069_0464837
959 Ga0501073_0046041
960 Ga0501073_0063242
961 Ga0501073_0156577
962 Ga0501073_0191032
963 Ga0501079_1124482
964 Ga0501080_0078237
965 Ga0501035_0005392
966 Ga0501035_0011833
967 Ga0501044_0009496
968 Ga0501044_0244844
969 Ga0501044_0268293
970 Ga0495601_0275969
971 Ga0500578_0389471
972 Ga0500643_196003
973 Ga0500651_0000002
974 Ga0500595_000032
975 Ga0500573_0157279
976 Ga0500661_000139

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map