F453559

General Info

Members Datasets Scaffolds Average Seq Length
488 311 976 266

Family's Representative Sequence

Representative Sequence 3300005444|Ga0070694_100114182|Ga0070694_1001141822
Length 281
Sequence MLSWFRNRGDPSTPIDTALWRSATAPWLFMRGLDDDEAARLRALSERFLARKNFSGTHGLEISDVMRVEIAAQASILVLELGLEWYDGWSDIIVYPSQFAPEREVMDETGVVHLTNDPLAGEAWLGGPVILSYEDVALAGDEEMRVAGYNVVIHEFAHKLDMRSGDPNGSPPLHPQMSAARWKQAFSQAYDDFCRKVDRADRRAGRDGGAALDALPIDPYAASSAGEFFAVTSEAFFETPELLEPAYPRVYEELRAFYKQNPLARLAKAERESRGDSPSRR

Samples

Sample ID Description Type Environment
1 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
2 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
3 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
4 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
5 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
6 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
7 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
22 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
27 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
28 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
29 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
32 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
33 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
35 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
37 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
38 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
39 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
40 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
41 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
42 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
43 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
44 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
45 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
48 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
49 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
50 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
51 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
52 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
53 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
54 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
55 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
56 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
57 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
58 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
59 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
60 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
61 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
96 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
97 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
98 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
99 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
100 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
101 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
102 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
103 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
104 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
105 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
106 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
107 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
108 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
109 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
110 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
111 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
112 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
113 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
114 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
115 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
116 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
117 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
118 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
119 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
120 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
121 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
122 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
123 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
124 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
125 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
126 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
127 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
128 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
129 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
130 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
131 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
132 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
133 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
134 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
135 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
136 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
137 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
138 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
139 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
140 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
141 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
142 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
143 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
144 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
145 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
146 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
147 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
148 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
149 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
150 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
151 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
152 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
153 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
154 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
155 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
156 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
157 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
158 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
159 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
160 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
161 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
162 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
163 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
164 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
165 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
166 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
167 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
168 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
169 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
170 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
171 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
172 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
173 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
174 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
175 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
176 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
177 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
178 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
179 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
180 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
181 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
182 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
183 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
184 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
185 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
186 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
187 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
188 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
189 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
190 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
191 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
192 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
193 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
194 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
195 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
196 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
197 2511231006 Pseudomonas sp. GM17 Isolate Nodule
198 2511231010 Pseudomonas sp. GM25 Isolate Nodule
199 2511231015 Pseudomonas sp. GM49 Isolate Nodule
200 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
201 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
202 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
203 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
204 2599185155 Pseudomonas sp. NFACC10-1 Isolate Rhizoplane
205 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
206 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
207 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
208 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
209 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
210 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
211 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
212 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
213 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
214 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
215 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
216 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
217 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
218 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
219 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
220 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
221 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
222 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
223 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
224 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
225 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
226 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
227 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
228 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
229 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
230 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
231 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
232 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
233 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
234 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
235 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
236 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
237 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
238 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
239 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
240 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
241 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
242 2600255283 Pseudomonas sp. NFR16 Isolate Rhizoplane
243 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
244 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
245 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
246 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
247 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
248 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
249 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
250 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
251 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
252 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
253 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
254 2718217725 Pseudomonas fluorescens CREA-C16 Isolate Rhizosphere
255 2738541271 Pseudomonas sp. GV021 Isolate Unclassified
256 2738543016 Pseudomonas sp. GV012 Isolate Unclassified
257 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
258 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
259 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
260 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
261 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
262 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
263 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
264 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
265 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
266 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
267 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
268 2842805378 Pseudomonas sp. R-72599 Isolate Unclassified
269 2842815866 Pseudomonas sp. R-72210 Isolate Unclassified
270 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
271 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
272 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
273 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
274 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
275 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
276 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
277 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
278 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
279 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
280 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
281 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
282 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
283 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
284 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
285 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
286 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
287 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
288 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
289 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
290 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
291 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
292 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
293 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
294 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
295 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
296 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
297 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
298 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
299 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
300 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere
301 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
302 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
303 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
304 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
305 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
306 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
307 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
308 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
309 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
310 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
311 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 75.41
Metatranscriptomes 1.02
Isolates 23.57

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.89
Nodule 1.43
Rhizoplane 9.43
Rhizosphere 73.57
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070694_100114182 3300005444 Bacteria 1928
2 Ga0055538_1000042 3300003751 Bacteria 164754
3 Ga0055536_1000448 3300003781 Bacteria 28991
4 Ga0055536_1004823 3300003781 Bacteria 6747
5 Ga0055536_1005167 3300003781 Bacteria 6451
6 Ga0055530_10004828 3300003791 Bacteria 6747
7 Ga0055530_10005008 3300003791 Bacteria 6533
8 Ga0055540_1004272 3300003792 Bacteria 6536
9 Ga0055540_1004947 3300003792 Bacteria 5805
10 Ga0055531_10000125 3300003794 Bacteria 86349
11 Ga0065714_10067243 3300005288 Bacteria 5738
12 Ga0065714_10098570 3300005288 Bacteria 1699
13 Ga0065714_10115431 3300005288 Bacteria 1416
14 Ga0065712_10069723 3300005290 Bacteria 6806
15 Ga0070690_100026100 3300005330 Bacteria 3601
16 Ga0070670_100040209 3300005331 Bacteria 4021
17 Ga0070689_100015651 3300005340 Bacteria 5536
18 Ga0070689_100503393 3300005340 Bacteria 1038
19 Ga0070661_100000436 3300005344 Bacteria 31918
20 Ga0070669_100000218 3300005353 Bacteria 47769
21 Ga0070669_100002174 3300005353 Bacteria 14183
22 Ga0070675_100001764 3300005354 Bacteria 15948
23 Ga0070688_100145029 3300005365 Bacteria 1617
24 Ga0070662_100021586 3300005457 Bacteria 4398
25 Ga0070681_10194199 3300005458 Bacteria 1949
26 Ga0068867_100134717 3300005459 Bacteria 1924
27 Ga0070685_10231307 3300005466 Bacteria 1216
28 Ga0068853_100044480 3300005539 Bacteria 3801
29 Ga0070693_100003096 3300005547 Bacteria 7717
30 Ga0070704_100136088 3300005549 Bacteria 1911
31 Ga0068855_100065358 3300005563 Bacteria 4241
32 Ga0070664_100000412 3300005564 Bacteria 31918
33 Ga0070664_100263617 3300005564 Bacteria 1551
34 Ga0068857_100057185 3300005577 Bacteria 3462
35 Ga0068854_100003618 3300005578 Bacteria 9671
36 Ga0068859_100376254 3300005617 Bacteria 1516
37 Ga0068861_100396802 3300005719 Bacteria 1223
38 Ga0068861_100506447 3300005719 Bacteria 1092
39 Ga0068851_10000002 3300005834 Bacteria 302756
40 Ga0068858_100056248 3300005842 Bacteria 3637
41 Ga0068858_100150480 3300005842 Bacteria 2188
42 Ga0075364_10152684 3300006051 Bacteria 1557
43 Ga0075432_10051784 3300006058 Bacteria 1449
44 Ga0097621_100005842 3300006237 Bacteria 8692
45 Ga0097621_100104346 3300006237 Bacteria 2389
46 Ga0068871_100027975 3300006358 Bacteria 4415
47 Ga0097620_100376217 3300006931 Bacteria 1516
48 Ga0079104_1000387 3300006946 Bacteria 51126
49 Ga0079104_1024525 3300006946 Bacteria 1586
50 Ga0105251_10000011 3300009011 Bacteria 180176
51 Ga0105251_10001195 3300009011 Bacteria 22471
52 Ga0105251_10006189 3300009011 Bacteria 7686
53 Ga0105251_10026245 3300009011 Bacteria 2968
54 Ga0105251_10041513 3300009011 Bacteria 2238
55 Ga0105251_10085303 3300009011 Bacteria 1456
56 Ga0105251_10158295 3300009011 Bacteria 1021
57 Ga0105251_10197152 3300009011 Bacteria 907
58 Ga0105244_10000154 3300009036 Bacteria 72483
59 Ga0105244_10017761 3300009036 Bacteria 4010
60 Ga0105244_10020361 3300009036 Bacteria 3688
61 Ga0105244_10117892 3300009036 Bacteria 1287
62 Ga0105250_10046596 3300009092 Bacteria 1738
63 Ga0105245_10077918 3300009098 Bacteria 3023
64 Ga0105245_10208423 3300009098 Bacteria 1880
65 Ga0105243_10009171 3300009148 Bacteria 7554
66 Ga0105243_10034146 3300009148 Bacteria 3936
67 Ga0105243_10282894 3300009148 Bacteria 1495
68 Ga0105242_10013808 3300009176 Bacteria 6250
69 Ga0105242_10083199 3300009176 Bacteria 2679
70 Ga0105248_10004020 3300009177 Bacteria 16258
71 Ga0105248_10041309 3300009177 Bacteria 5170
72 Ga0105248_10350419 3300009177 Bacteria 1662
73 Ga0105237_10001451 3300009545 Bacteria 31307
74 Ga0105249_10140032 3300009553 Bacteria 2319
75 Ga0105239_10772100 3300010375 Bacteria 1100
76 Ga0105246_10000344 3300011119 Bacteria 24772
77 Ga0105246_10001291 3300011119 Bacteria 14686
78 Ga0105246_10040458 3300011119 Bacteria 3146
79 Ga0157373_10048337 3300013100 Bacteria 3033
80 Ga0157373_10054895 3300013100 Bacteria 2830
81 Ga0157373_10106459 3300013100 Bacteria 1972
82 Ga0157373_10146426 3300013100 Bacteria 1661
83 Ga0157371_10031968 3300013102 Bacteria 3789
84 Ga0157371_10205091 3300013102 Bacteria 1414
85 Ga0157370_10032537 3300013104 Bacteria 5093
86 Ga0157370_10318485 3300013104 Bacteria 1435
87 Ga0157369_10022826 3300013105 Bacteria 6977
88 Ga0157369_10143211 3300013105 Bacteria 2528
89 Ga0157369_10325302 3300013105 Bacteria 1598
90 Ga0157369_10339334 3300013105 Bacteria 1561
91 Ga0157374_10054819 3300013296 Bacteria 3720
92 Ga0157378_10065237 3300013297 Bacteria 3259
93 Ga0157378_10187380 3300013297 Bacteria 1949
94 Ga0157375_10059472 3300013308 Bacteria 3786
95 Ga0157375_10068269 3300013308 Bacteria 3556
96 Ga0157375_10746800 3300013308 Bacteria 1130
97 Ga0157380_10399401 3300014326 Bacteria 1304
98 Ga0182008_10014053 3300014497 Bacteria 4199
99 Ga0182008_10024537 3300014497 Bacteria 3069
100 Ga0182008_10085087 3300014497 Bacteria 1558
101 Ga0157377_10114684 3300014745 Bacteria 1625
102 Ga0182006_1013365 3300015261 Bacteria 3564
103 Ga0209759_1001413 3300025256 Bacteria 13698
104 Ga0209675_1009621 3300025291 Bacteria 3392
105 Ga0209676_1000076 3300025292 Bacteria 301393
106 Ga0209676_1000314 3300025292 Bacteria 94905
107 Ga0209676_1000337 3300025292 Bacteria 89361
108 Ga0209050_1000063 3300025298 Bacteria 314955
109 Ga0209050_1000106 3300025298 Bacteria 224396
110 Ga0209051_1000045 3300025303 Bacteria 297882
111 Ga0209051_1000260 3300025303 Bacteria 88213
112 Ga0209257_1000185 3300025304 Bacteria 155047
113 Ga0207656_10000010 3300025321 Bacteria 192224
114 Ga0207696_1003771 3300025711 Bacteria 6757
115 Ga0207696_1005090 3300025711 Bacteria 5520
116 Ga0207655_1000120 3300025728 Bacteria 157018
117 Ga0207655_1001039 3300025728 Bacteria 27979
118 Ga0207655_1001579 3300025728 Bacteria 20452
119 Ga0207655_1002652 3300025728 Bacteria 14109
120 Ga0207655_1029079 3300025728 Bacteria 2595
121 Ga0207713_1000073 3300025735 Bacteria 181519
122 Ga0207713_1000261 3300025735 Bacteria 65024
123 Ga0207713_1002074 3300025735 Bacteria 14980
124 Ga0207713_1003626 3300025735 Bacteria 10395
125 Ga0207713_1016862 3300025735 Bacteria 3690
126 Ga0207713_1097782 3300025735 Bacteria 1019
127 Ga0207688_10047833 3300025901 Bacteria 2389
128 Ga0207645_10232023 3300025907 Bacteria 1218
129 Ga0207643_10036985 3300025908 Bacteria 2738
130 Ga0207695_10017342 3300025913 Bacteria 8382
131 Ga0207671_10000897 3300025914 Bacteria 37640
132 Ga0207662_10157655 3300025918 Bacteria 1448
133 Ga0207649_10000126 3300025920 Bacteria 64678
134 Ga0207681_10000148 3300025923 Bacteria 58793
135 Ga0207681_10028947 3300025923 Bacteria 3592
136 Ga0207650_10000620 3300025925 Bacteria 28400
137 Ga0207659_10121224 3300025926 Bacteria 2004
138 Ga0207706_10007161 3300025933 Bacteria 10315
139 Ga0207686_10001185 3300025934 Bacteria 15098
140 Ga0207686_10008156 3300025934 Bacteria 5649
141 Ga0207709_10000030 3300025935 Bacteria 331710
142 Ga0207709_10007259 3300025935 Bacteria 6181
143 Ga0207670_10423112 3300025936 Bacteria 1069
144 Ga0207669_10289388 3300025937 Bacteria 1240
145 Ga0207691_10041891 3300025940 Bacteria 4224
146 Ga0207711_10051323 3300025941 Bacteria 3531
147 Ga0207711_10064467 3300025941 Bacteria 3165
148 Ga0207711_10589455 3300025941 Bacteria 1037
149 Ga0207689_10016249 3300025942 Bacteria 6304
150 Ga0207679_10000017 3300025945 Bacteria 253004
151 Ga0207679_10117780 3300025945 Bacteria 2108
152 Ga0207667_10019591 3300025949 Bacteria 7547
153 Ga0207651_10549689 3300025960 Bacteria 1004
154 Ga0207640_10044759 3300025981 Bacteria 2838
155 Ga0207703_10042134 3300026035 Bacteria 3661
156 Ga0207639_10011186 3300026041 Bacteria 6226
157 Ga0207676_10373772 3300026095 Bacteria 1325
158 Ga0207674_10027682 3300026116 Bacteria 5992
159 Ga0209281_1006506 3300027111 Bacteria 3041
160 Ga0307517_10085771 3300028786 Bacteria 2635
161 Ga0314311_1081897 3300030733 Bacteria 1219
162 Ga0316179_1015510 3300030734 Bacteria 4203
163 Ga0316178_1130694 3300030735 Bacteria 47589
164 Ga0307408_100010567 3300031548 Bacteria 6088
165 Ga0307408_100306393 3300031548 Bacteria 1332
166 Ga0307408_100744900 3300031548 Bacteria 884
167 Ga0316576_10004141 3300031727 Bacteria 8655
168 Ga0316576_10043105 3300031727 Bacteria 3254
169 Ga0316578_10003687 3300031728 Bacteria 7066
170 Ga0316578_10006049 3300031728 Bacteria 5931
171 Ga0316578_10006785 3300031728 Bacteria 5680
172 Ga0316578_10061025 3300031728 Bacteria 2220
173 Ga0316577_10000360 3300031733 Bacteria 17079
174 Ga0316577_10007178 3300031733 Bacteria 5928
175 Ga0316577_10033173 3300031733 Bacteria 2884
176 Ga0307406_10068357 3300031901 Bacteria 2319
177 Ga0307412_10130008 3300031911 Bacteria 1827
178 Ga0307412_10315476 3300031911 Bacteria 1241
179 Ga0307416_100450922 3300032002 Bacteria 1339
180 Ga0307411_10066397 3300032005 Bacteria 2423
181 Ga0316585_10027733 3300032137 Bacteria 1769
182 Ga0316580_10004054 3300032139 Bacteria 4220
183 Ga0316580_10005091 3300032139 Bacteria 3825
184 Ga0316593_10000870 3300032168 Bacteria 6122
185 Ga0316593_10026671 3300032168 Bacteria 1849
186 Ga0316588_1006482 3300033528 Bacteria 2340
187 Ga0316588_1006693 3300033528 Bacteria 2314
188 Ga0316588_1009385 3300033528 Bacteria 2040
189 Ga0316574_0003620 3300035398 Bacteria 7993
190 Ga0316574_0113405 3300035398 Bacteria 1738
191 Ga0373935_0039607 3300035692 Bacteria 2955
192 Ga0316582_0009517 3300036647 Bacteria 5277
193 Ga0316582_0029777 3300036647 Bacteria 3319
194 Ga0316584_0001594 3300036712 Bacteria 13786
195 Ga0316584_0003344 3300036712 Bacteria 10395
196 Ga0316584_0005230 3300036712 Bacteria 8679
197 Ga0316584_0011239 3300036712 Bacteria 6284
198 Ga0439438_037553 3300041405 Bacteria 1266
199 Ga0439438_037554 3300041405 Bacteria 1266
200 Ga0439447_013944 3300041407 Bacteria 2267
201 Ga0439447_022772 3300041407 Bacteria 1637
202 Ga0439466_0009360 3300041411 Bacteria 3661
203 Ga0439466_0031258 3300041411 Bacteria 1822
204 Ga0439445_0042510 3300042004 Bacteria 1210
205 Ga0439432_000139 3300042006 Bacteria 24587
206 Ga0439432_022233 3300042006 Bacteria 2094
207 Ga0439452_000211 3300042010 Bacteria 41304
208 Ga0439463_004166 3300042016 Bacteria 3626
209 Ga0439463_015665 3300042016 Bacteria 1875
210 Ga0439463_016032 3300042016 Bacteria 1853
211 Ga0439463_018043 3300042016 Bacteria 1754
212 Ga0450911_000136 3300042115 Bacteria 29345
213 Ga0450902_000577 3300042137 Bacteria 4648
214 Ga0450902_004263 3300042137 Bacteria 2121
215 Ga0450904_002438 3300042139 Bacteria 2220
216 Ga0450905_006991 3300042142 Bacteria 1531
217 Ga0450906_000847 3300042145 Bacteria 6743
218 Ga0495617_063078 3300046452 Bacteria 1224
219 Ga0495627_000037 3300046453 Bacteria 198542
220 Ga0495627_005610 3300046453 Bacteria 5021
221 Ga0495627_009502 3300046453 Bacteria 3577
222 Ga0495591_000259 3300046458 Bacteria 50438
223 Ga0495591_000732 3300046458 Bacteria 23757
224 Ga0495591_002014 3300046458 Bacteria 11822
225 Ga0495591_046685 3300046458 Bacteria 1202
226 Ga0495638_0014623 3300046460 Bacteria 5296
227 Ga0495651_0116088 3300046462 Bacteria 1973
228 Ga0495650_0000311 3300046471 Bacteria 87755
229 Ga0495650_0009563 3300046471 Bacteria 5500
230 Ga0495650_0015985 3300046471 Bacteria 3822
231 Ga0495605_0000033 3300046474 Bacteria 209203
232 Ga0495605_0000453 3300046474 Bacteria 36766
233 Ga0495605_0002622 3300046474 Bacteria 11038
234 Ga0495605_0148220 3300046474 Bacteria 1048
235 Ga0495584_0004057 3300046491 Bacteria 7905
236 Ga0495585_0000684 3300046492 Bacteria 30886
237 Ga0495585_0024625 3300046492 Bacteria 3449
238 Ga0495594_0034719 3300046499 Bacteria 2744
239 Ga0495596_0000283 3300046500 Bacteria 33843
240 Ga0495607_0000385 3300046501 Bacteria 45205
241 Ga0495607_0000614 3300046501 Bacteria 34704
242 Ga0495607_0000749 3300046501 Bacteria 31120
243 Ga0495607_0001635 3300046501 Bacteria 19408
244 Ga0495607_0002046 3300046501 Bacteria 16870
245 Ga0495607_0009598 3300046501 Bacteria 6539
246 Ga0495607_0023984 3300046501 Bacteria 3810
247 Ga0495583_0000031 3300046506 Bacteria 253982
248 Ga0495583_0000855 3300046506 Bacteria 37041
249 Ga0495583_0001402 3300046506 Bacteria 24561
250 Ga0495583_0006515 3300046506 Bacteria 7619
251 Ga0495583_0008093 3300046506 Bacteria 6479
252 Ga0495583_0011462 3300046506 Bacteria 5087
253 Ga0495583_0023874 3300046506 Bacteria 3084
254 Ga0495606_0000722 3300046507 Bacteria 51115
255 Ga0495606_0008743 3300046507 Bacteria 8706
256 Ga0495606_0008912 3300046507 Bacteria 8592
257 Ga0495606_0020415 3300046507 Bacteria 4884
258 Ga0495608_0044546 3300046511 Bacteria 2961
259 Ga0495610_0018008 3300046512 Bacteria 4004
260 Ga0495610_0118464 3300046512 Bacteria 1163
261 Ga0495620_0000038 3300046515 Bacteria 114064
262 Ga0495620_0000190 3300046515 Bacteria 47173
263 Ga0495620_0001679 3300046515 Bacteria 13056
264 Ga0495628_0087249 3300046516 Bacteria 2419
265 Ga0495631_0003524 3300046518 Bacteria 8556
266 Ga0495632_0001408 3300046519 Bacteria 20097
267 Ga0495637_0000064 3300046520 Bacteria 92793
268 Ga0495637_0000610 3300046520 Bacteria 25464
269 Ga0495637_0016359 3300046520 Bacteria 3467
270 Ga0495637_0116308 3300046520 Bacteria 1032
271 Ga0495644_0006268 3300046523 Bacteria 4619
272 Ga0495648_0008410 3300046524 Bacteria 8125
273 Ga0495648_0019608 3300046524 Bacteria 4747
274 Ga0495648_0068205 3300046524 Bacteria 2076
275 Ga0495652_0258926 3300046529 Bacteria 1285
276 Ga0495654_0000483 3300046530 Bacteria 32849
277 Ga0495654_0012898 3300046530 Bacteria 4481
278 Ga0495654_0040711 3300046530 Bacteria 2314
279 Ga0495654_0103842 3300046530 Bacteria 1304
280 Ga0495587_0104598 3300046536 Bacteria 1629
281 Ga0495609_0000018 3300046538 Bacteria 302609
282 Ga0495609_0000056 3300046538 Bacteria 146060
283 Ga0495609_0000161 3300046538 Bacteria 69842
284 Ga0495609_0040798 3300046538 Bacteria 2088
285 Ga0495609_0115307 3300046538 Bacteria 1157
286 Ga0495621_0036944 3300046539 Bacteria 1697
287 Ga0495597_0015152 3300046542 Bacteria 3654
288 Ga0495645_0020725 3300046543 Bacteria 4747
289 Ga0495622_0003773 3300046557 Bacteria 7086
290 Ga0495622_0098965 3300046557 Bacteria 1337
291 Ga0495633_0000062 3300046558 Bacteria 142101
292 Ga0495668_0107014 3300046616 Bacteria 1529
293 Ga0495668_0132813 3300046616 Bacteria 1362
294 Ga0495668_0169688 3300046616 Bacteria 1195
295 Ga0495611_0001911 3300046648 Bacteria 9908
296 Ga0495611_0003334 3300046648 Bacteria 7093
297 Ga0495625_0000194 3300046660 Bacteria 96964
298 Ga0495635_0120459 3300046663 Bacteria 1790
299 Ga0495661_0000016 3300046665 Bacteria 213593
300 Ga0495661_0000093 3300046665 Bacteria 109808
301 Ga0495661_0000140 3300046665 Bacteria 85015
302 Ga0495661_0000662 3300046665 Bacteria 34527
303 Ga0495661_0007799 3300046665 Bacteria 7446
304 Ga0495661_0046621 3300046665 Bacteria 2645
305 Ga0495661_0077957 3300046665 Bacteria 1918
306 Ga0495599_0011069 3300046678 Bacteria 5535
307 Ga0495623_0055522 3300046679 Bacteria 2497
308 Ga0495670_0033389 3300046691 Bacteria 2560
309 Ga0495671_0007890 3300046692 Bacteria 6020
310 Ga0495671_0041189 3300046692 Bacteria 2326
311 Ga0495649_0264083 3300046694 Bacteria 882
312 Ga0495589_0000246 3300046794 Bacteria 44673
313 Ga0495600_0097911 3300046809 Bacteria 1912
314 Ga0495660_0001057 3300046810 Bacteria 19940
315 Ga0495660_0011381 3300046810 Bacteria 5165
316 Ga0495672_0026878 3300047320 Bacteria 3665
317 Ga0495672_0049308 3300047320 Bacteria 2492
318 Ga0495676_0000052 3300047321 Bacteria 97049
319 Ga0495683_0000092 3300047323 Bacteria 91056
320 Ga0495683_0113351 3300047323 Bacteria 1292
321 Ga0495679_000136 3300047446 Bacteria 65848
322 Ga0495679_000241 3300047446 Bacteria 45465
323 Ga0495679_038687 3300047446 Bacteria 1492
324 Ga0495673_0000667 3300047469 Bacteria 33805
325 Ga0495673_0007475 3300047469 Bacteria 6277
326 Ga0495673_0007636 3300047469 Bacteria 6185
327 Ga0495673_0032960 3300047469 Bacteria 2409
328 Ga0495673_0047963 3300047469 Bacteria 1885
329 Ga0495673_0084388 3300047469 Bacteria 1309
330 Ga0495681_0041227 3300047470 Bacteria 2242
331 Ga0495684_0071692 3300047471 Bacteria 2632
332 Ga0495686_0049385 3300047472 Bacteria 2647
333 Ga0495626_0000126 3300048091 Bacteria 99054
334 Ga0496102_0187107 3300048905 Bacteria 1952
335 Ga0496116_0036032 3300048919 Bacteria 3468
336 Ga0496116_0162732 3300048919 Bacteria 1222
337 Ga0496117_0002760 3300048920 Bacteria 21509
338 Ga0496117_0039789 3300048920 Bacteria 3465
339 Ga0496117_0061282 3300048920 Bacteria 2587
340 Ga0496117_0206158 3300048920 Bacteria 1106
341 Ga0496118_0044927 3300048921 Bacteria 3453
342 Ga0496118_0124972 3300048921 Bacteria 1667
343 Ga0496119_0183778 3300048922 Bacteria 1094
344 Ga0496120_0162831 3300048923 Bacteria 1110
345 Ga0496121_0002045 3300048924 Bacteria 31934
346 Ga0496121_0004065 3300048924 Bacteria 20095
347 Ga0496122_0000434 3300048925 Bacteria 87536
348 Ga0496122_0028772 3300048925 Bacteria 4703
349 Ga0496122_0044502 3300048925 Bacteria 3462
350 Ga0496122_0081897 3300048925 Bacteria 2244
351 Ga0496122_0106781 3300048925 Bacteria 1852
352 Ga0496123_0000318 3300048926 Bacteria 91911
353 Ga0496123_0018041 3300048926 Bacteria 5644
354 Ga0496123_0070907 3300048926 Bacteria 2177
355 Ga0496123_0164793 3300048926 Bacteria 1177
356 Ga0496124_0000689 3300048927 Bacteria 55376
357 Ga0496124_0003367 3300048927 Bacteria 19638
358 Ga0496124_0008488 3300048927 Bacteria 10732
359 Ga0496124_0103835 3300048927 Bacteria 2298
360 Ga0496124_0229930 3300048927 Bacteria 1387
361 Ga0496124_0287858 3300048927 Bacteria 1194
362 Ga0496124_0302432 3300048927 Bacteria 1154
363 Ga0496125_0002909 3300048928 Bacteria 21542
364 Ga0496125_0003066 3300048928 Bacteria 20858
365 Ga0496125_0230647 3300048928 Bacteria 1184
366 Ga0496125_0358109 3300048928 Bacteria 868
367 Ga0495678_000021 3300049459 Bacteria 239150
368 Ga0495678_000169 3300049459 Bacteria 76063
369 Ga0495678_023851 3300049459 Bacteria 2651
370 Ga0495682_0001069 3300049460 Bacteria 16115
371 Ga0495682_0034629 3300049460 Bacteria 1861
372 Ga0495601_0002762 3300053077 Bacteria 9969
373 Ga0495619_0012343 3300053085 Bacteria 5377
374 2511264601 2511231006 Bacteria 6794709
375 2511292216 2511231010 Bacteria 6373152
376 2511317878 2511231015 Bacteria 6598026
377 2512328003 2512047018 Bacteria 6663241
378 2583794913 2582580891 Bacteria 6800976
379 2597860460 2597489887 Bacteria 6666321
380 2597872045 2597489889 Bacteria 6297495
381 2599327227 2599185155 Bacteria 5827168
382 2599401303 2599185167 Bacteria 6353609
383 2599453028 2599185179 Bacteria 6611171
384 2599486699 2599185185 Bacteria 6652270
385 2599504919 2599185188 Bacteria 6164180
386 2599515033 2599185190 Bacteria 6285678
387 2599520194 2599185191 Bacteria 6297582
388 2599616601 2599185212 Bacteria 6765997
389 2599772965 2599185248 Bacteria 6696816
390 2599807177 2599185257 Bacteria 6492581
391 2599888278 2599185289 Bacteria 6778765
392 2599894413 2599185290 Bacteria 6289611
393 2599900940 2599185291 Bacteria 6775623
394 2599945004 2599185302 Bacteria 5954930
395 2599955267 2599185304 Bacteria 5951361
396 2599962670 2599185305 Bacteria 6748700
397 2599967128 2599185306 Bacteria 6637356
398 2599974701 2599185307 Bacteria 6194719
399 2599981215 2599185308 Bacteria 6621546
400 2599984000 2599185309 Bacteria 5969593
401 2599990282 2599185310 Bacteria 6014457
402 2599997736 2599185311 Bacteria 6354990
403 2600001776 2599185312 Bacteria 5912071
404 2600009380 2599185313 Bacteria 6658188
405 2600013855 2599185314 Bacteria 6621749
406 2600021229 2599185315 Bacteria 6771107
407 2600026869 2599185316 Bacteria 6320029
408 2600032799 2599185317 Bacteria 6435722
409 2600039099 2599185318 Bacteria 6961590
410 2600044693 2599185319 Bacteria 6637840
411 2600048816 2599185320 Bacteria 5963263
412 2600056225 2599185321 Bacteria 6764560
413 2600062320 2599185322 Bacteria 6763055
414 2600068490 2599185323 Bacteria 6688755
415 2600074649 2599185324 Bacteria 6590677
416 2600079612 2599185325 Bacteria 6324919
417 2600360417 2600254930 Bacteria 6431253
418 2600367842 2600254931 Bacteria 6734225
419 2601628672 2600255283 Bacteria 6061572
420 2601800560 2600255318 Bacteria 6383414
421 2606078632 2603880185 Bacteria 6379190
422 2606125708 2603880199 Bacteria 6377649
423 2624482977 2623620443 Bacteria 6427864
424 2643870856 2643221571 Bacteria 6228673
425 2671093834 2667528170 Bacteria 6786960
426 2671129912 2667528176 Bacteria 6724917
427 2671773263 2671180172 Bacteria 6495783
428 2677898471 2675903420 Bacteria 6247433
429 2715752402 2713897148 Bacteria 5883533
430 2715759150 2713897149 Bacteria 6506249
431 2718636187 2718217725 Bacteria 5758958
432 2738691029 2738541271 Bacteria 5657310
433 2739266834 2738543016 Bacteria 5657564
434 2743740007 2740892503 Bacteria 6855563
435 2808857322 2808606361 Bacteria 6136259
436 2808926371 2808606376 Bacteria 6248667
437 2808937374 2808606378 Bacteria 6177535
438 2808948532 2808606380 Bacteria 6248705
439 2808965704 2808606383 Bacteria 6138645
440 2808977515 2808606385 Bacteria 6711065
441 2808992827 2808606388 Bacteria 6706662
442 2809000697 2808606389 Bacteria 6138126
443 2826582841 2826581358 Bacteria 5963467
444 2834033173 2834028612 Bacteria 6354979
445 2842808418 2842805378 Bacteria 5385175
446 2842819891 2842815866 Bacteria 5947510
447 2842836903 2842832357 Bacteria 5959113
448 2842847637 2842843487 Bacteria 6004777
449 2842852865 2842849001 Bacteria 5924277
450 2844666559 2844665904 Bacteria 6817974
451 2852618077 2852612431 Bacteria 6885235
452 2852673135 2852667396 Bacteria 6885555
453 2878034910 2878029506 Bacteria 6418441
454 2919067709 2919063839 Bacteria 6302690
455 2919390572 2919385768 Bacteria 5897293
456 2919485935 2919481497 Bacteria 6907839
457 2919490884 2919487758 Bacteria 5929766
458 2923159098 2923153595 Bacteria 6870622
459 2929194726 2929189879 Bacteria 5930554
460 2931396000 2931390751 Bacteria 6273349
461 2945931332 2945928738 Bacteria 6053221
462 2945966352 2945961074 Bacteria 7342064
463 2946007380 2946006987 Bacteria 6705746
464 2946033216 2946027586 Bacteria 6049274
465 2974294541 2974289157 Bacteria 6080362
466 2984287072 2984286254 Bacteria 6702062
467 2988731017 2988728565 Bacteria 6124362
468 2998144969 2998139840 Bacteria 6073514
469 3007398723 3007395558 Bacteria 6755444
470 3007425289 3007419365 Bacteria 7026924
471 3007516755 3007511990 Bacteria 6481491
472 3007721330 3007718800 Bacteria 5971527
473 3007860172 3007855910 Bacteria 5637581
474 3007866425 3007861166 Bacteria 6045338
475 3007867204 3007866637 Bacteria 5899198
476 8015693175 8015687852 Bacteria 6613826
477 8019771260 8019769354 Bacteria 6924660
478 8029995928 8029995093 Bacteria 5990776
479 8054289434 8054285046 Bacteria 6919322
480 8054508503 8054503363 Bacteria 6101651
481 8055776424 8055770955 Bacteria 6827675
482 8055823462 8055817908 Bacteria 6609162
483 8056136904 8056131705 Bacteria 6107031
484 8056150157 8056148874 Bacteria 6479865
485 8056163175 8056161164 Bacteria 6106669
486 8056171599 8056166840 Bacteria 5820959
487 8056172278 8056172158 Bacteria 6133900
488 8057805270 8057798959 Bacteria 6713499
489 Ga0070694_100114182
490 Ga0055538_1000042
491 Ga0055536_1000448
492 Ga0055536_1004823
493 Ga0055536_1005167
494 Ga0055530_10004828
495 Ga0055530_10005008
496 Ga0055540_1004272
497 Ga0055540_1004947
498 Ga0055531_10000125
499 Ga0065714_10067243
500 Ga0065714_10098570
501 Ga0065714_10115431
502 Ga0065712_10069723
503 Ga0070690_100026100
504 Ga0070670_100040209
505 Ga0070689_100015651
506 Ga0070689_100503393
507 Ga0070661_100000436
508 Ga0070669_100000218
509 Ga0070669_100002174
510 Ga0070675_100001764
511 Ga0070688_100145029
512 Ga0070662_100021586
513 Ga0070681_10194199
514 Ga0068867_100134717
515 Ga0070685_10231307
516 Ga0068853_100044480
517 Ga0070693_100003096
518 Ga0070704_100136088
519 Ga0068855_100065358
520 Ga0070664_100000412
521 Ga0070664_100263617
522 Ga0068857_100057185
523 Ga0068854_100003618
524 Ga0068859_100376254
525 Ga0068861_100396802
526 Ga0068861_100506447
527 Ga0068851_10000002
528 Ga0068858_100056248
529 Ga0068858_100150480
530 Ga0075364_10152684
531 Ga0075432_10051784
532 Ga0097621_100005842
533 Ga0097621_100104346
534 Ga0068871_100027975
535 Ga0097620_100376217
536 Ga0079104_1000387
537 Ga0079104_1024525
538 Ga0105251_10000011
539 Ga0105251_10001195
540 Ga0105251_10006189
541 Ga0105251_10026245
542 Ga0105251_10041513
543 Ga0105251_10085303
544 Ga0105251_10158295
545 Ga0105251_10197152
546 Ga0105244_10000154
547 Ga0105244_10017761
548 Ga0105244_10020361
549 Ga0105244_10117892
550 Ga0105250_10046596
551 Ga0105245_10077918
552 Ga0105245_10208423
553 Ga0105243_10009171
554 Ga0105243_10034146
555 Ga0105243_10282894
556 Ga0105242_10013808
557 Ga0105242_10083199
558 Ga0105248_10004020
559 Ga0105248_10041309
560 Ga0105248_10350419
561 Ga0105237_10001451
562 Ga0105249_10140032
563 Ga0105239_10772100
564 Ga0105246_10000344
565 Ga0105246_10001291
566 Ga0105246_10040458
567 Ga0157373_10048337
568 Ga0157373_10054895
569 Ga0157373_10106459
570 Ga0157373_10146426
571 Ga0157371_10031968
572 Ga0157371_10205091
573 Ga0157370_10032537
574 Ga0157370_10318485
575 Ga0157369_10022826
576 Ga0157369_10143211
577 Ga0157369_10325302
578 Ga0157369_10339334
579 Ga0157374_10054819
580 Ga0157378_10065237
581 Ga0157378_10187380
582 Ga0157375_10059472
583 Ga0157375_10068269
584 Ga0157375_10746800
585 Ga0157380_10399401
586 Ga0182008_10014053
587 Ga0182008_10024537
588 Ga0182008_10085087
589 Ga0157377_10114684
590 Ga0182006_1013365
591 Ga0209759_1001413
592 Ga0209675_1009621
593 Ga0209676_1000076
594 Ga0209676_1000314
595 Ga0209676_1000337
596 Ga0209050_1000063
597 Ga0209050_1000106
598 Ga0209051_1000045
599 Ga0209051_1000260
600 Ga0209257_1000185
601 Ga0207656_10000010
602 Ga0207696_1003771
603 Ga0207696_1005090
604 Ga0207655_1000120
605 Ga0207655_1001039
606 Ga0207655_1001579
607 Ga0207655_1002652
608 Ga0207655_1029079
609 Ga0207713_1000073
610 Ga0207713_1000261
611 Ga0207713_1002074
612 Ga0207713_1003626
613 Ga0207713_1016862
614 Ga0207713_1097782
615 Ga0207688_10047833
616 Ga0207645_10232023
617 Ga0207643_10036985
618 Ga0207695_10017342
619 Ga0207671_10000897
620 Ga0207662_10157655
621 Ga0207649_10000126
622 Ga0207681_10000148
623 Ga0207681_10028947
624 Ga0207650_10000620
625 Ga0207659_10121224
626 Ga0207706_10007161
627 Ga0207686_10001185
628 Ga0207686_10008156
629 Ga0207709_10000030
630 Ga0207709_10007259
631 Ga0207670_10423112
632 Ga0207669_10289388
633 Ga0207691_10041891
634 Ga0207711_10051323
635 Ga0207711_10064467
636 Ga0207711_10589455
637 Ga0207689_10016249
638 Ga0207679_10000017
639 Ga0207679_10117780
640 Ga0207667_10019591
641 Ga0207651_10549689
642 Ga0207640_10044759
643 Ga0207703_10042134
644 Ga0207639_10011186
645 Ga0207676_10373772
646 Ga0207674_10027682
647 Ga0209281_1006506
648 Ga0307517_10085771
649 Ga0314311_1081897
650 Ga0316179_1015510
651 Ga0316178_1130694
652 Ga0307408_100010567
653 Ga0307408_100306393
654 Ga0307408_100744900
655 Ga0316576_10004141
656 Ga0316576_10043105
657 Ga0316578_10003687
658 Ga0316578_10006049
659 Ga0316578_10006785
660 Ga0316578_10061025
661 Ga0316577_10000360
662 Ga0316577_10007178
663 Ga0316577_10033173
664 Ga0307406_10068357
665 Ga0307412_10130008
666 Ga0307412_10315476
667 Ga0307416_100450922
668 Ga0307411_10066397
669 Ga0316585_10027733
670 Ga0316580_10004054
671 Ga0316580_10005091
672 Ga0316593_10000870
673 Ga0316593_10026671
674 Ga0316588_1006482
675 Ga0316588_1006693
676 Ga0316588_1009385
677 Ga0316574_0003620
678 Ga0316574_0113405
679 Ga0373935_0039607
680 Ga0316582_0009517
681 Ga0316582_0029777
682 Ga0316584_0001594
683 Ga0316584_0003344
684 Ga0316584_0005230
685 Ga0316584_0011239
686 Ga0439438_037553
687 Ga0439438_037554
688 Ga0439447_013944
689 Ga0439447_022772
690 Ga0439466_0009360
691 Ga0439466_0031258
692 Ga0439445_0042510
693 Ga0439432_000139
694 Ga0439432_022233
695 Ga0439452_000211
696 Ga0439463_004166
697 Ga0439463_015665
698 Ga0439463_016032
699 Ga0439463_018043
700 Ga0450911_000136
701 Ga0450902_000577
702 Ga0450902_004263
703 Ga0450904_002438
704 Ga0450905_006991
705 Ga0450906_000847
706 Ga0495617_063078
707 Ga0495627_000037
708 Ga0495627_005610
709 Ga0495627_009502
710 Ga0495591_000259
711 Ga0495591_000732
712 Ga0495591_002014
713 Ga0495591_046685
714 Ga0495638_0014623
715 Ga0495651_0116088
716 Ga0495650_0000311
717 Ga0495650_0009563
718 Ga0495650_0015985
719 Ga0495605_0000033
720 Ga0495605_0000453
721 Ga0495605_0002622
722 Ga0495605_0148220
723 Ga0495584_0004057
724 Ga0495585_0000684
725 Ga0495585_0024625
726 Ga0495594_0034719
727 Ga0495596_0000283
728 Ga0495607_0000385
729 Ga0495607_0000614
730 Ga0495607_0000749
731 Ga0495607_0001635
732 Ga0495607_0002046
733 Ga0495607_0009598
734 Ga0495607_0023984
735 Ga0495583_0000031
736 Ga0495583_0000855
737 Ga0495583_0001402
738 Ga0495583_0006515
739 Ga0495583_0008093
740 Ga0495583_0011462
741 Ga0495583_0023874
742 Ga0495606_0000722
743 Ga0495606_0008743
744 Ga0495606_0008912
745 Ga0495606_0020415
746 Ga0495608_0044546
747 Ga0495610_0018008
748 Ga0495610_0118464
749 Ga0495620_0000038
750 Ga0495620_0000190
751 Ga0495620_0001679
752 Ga0495628_0087249
753 Ga0495631_0003524
754 Ga0495632_0001408
755 Ga0495637_0000064
756 Ga0495637_0000610
757 Ga0495637_0016359
758 Ga0495637_0116308
759 Ga0495644_0006268
760 Ga0495648_0008410
761 Ga0495648_0019608
762 Ga0495648_0068205
763 Ga0495652_0258926
764 Ga0495654_0000483
765 Ga0495654_0012898
766 Ga0495654_0040711
767 Ga0495654_0103842
768 Ga0495587_0104598
769 Ga0495609_0000018
770 Ga0495609_0000056
771 Ga0495609_0000161
772 Ga0495609_0040798
773 Ga0495609_0115307
774 Ga0495621_0036944
775 Ga0495597_0015152
776 Ga0495645_0020725
777 Ga0495622_0003773
778 Ga0495622_0098965
779 Ga0495633_0000062
780 Ga0495668_0107014
781 Ga0495668_0132813
782 Ga0495668_0169688
783 Ga0495611_0001911
784 Ga0495611_0003334
785 Ga0495625_0000194
786 Ga0495635_0120459
787 Ga0495661_0000016
788 Ga0495661_0000093
789 Ga0495661_0000140
790 Ga0495661_0000662
791 Ga0495661_0007799
792 Ga0495661_0046621
793 Ga0495661_0077957
794 Ga0495599_0011069
795 Ga0495623_0055522
796 Ga0495670_0033389
797 Ga0495671_0007890
798 Ga0495671_0041189
799 Ga0495649_0264083
800 Ga0495589_0000246
801 Ga0495600_0097911
802 Ga0495660_0001057
803 Ga0495660_0011381
804 Ga0495672_0026878
805 Ga0495672_0049308
806 Ga0495676_0000052
807 Ga0495683_0000092
808 Ga0495683_0113351
809 Ga0495679_000136
810 Ga0495679_000241
811 Ga0495679_038687
812 Ga0495673_0000667
813 Ga0495673_0007475
814 Ga0495673_0007636
815 Ga0495673_0032960
816 Ga0495673_0047963
817 Ga0495673_0084388
818 Ga0495681_0041227
819 Ga0495684_0071692
820 Ga0495686_0049385
821 Ga0495626_0000126
822 Ga0496102_0187107
823 Ga0496116_0036032
824 Ga0496116_0162732
825 Ga0496117_0002760
826 Ga0496117_0039789
827 Ga0496117_0061282
828 Ga0496117_0206158
829 Ga0496118_0044927
830 Ga0496118_0124972
831 Ga0496119_0183778
832 Ga0496120_0162831
833 Ga0496121_0002045
834 Ga0496121_0004065
835 Ga0496122_0000434
836 Ga0496122_0028772
837 Ga0496122_0044502
838 Ga0496122_0081897
839 Ga0496122_0106781
840 Ga0496123_0000318
841 Ga0496123_0018041
842 Ga0496123_0070907
843 Ga0496123_0164793
844 Ga0496124_0000689
845 Ga0496124_0003367
846 Ga0496124_0008488
847 Ga0496124_0103835
848 Ga0496124_0229930
849 Ga0496124_0287858
850 Ga0496124_0302432
851 Ga0496125_0002909
852 Ga0496125_0003066
853 Ga0496125_0230647
854 Ga0496125_0358109
855 Ga0495678_000021
856 Ga0495678_000169
857 Ga0495678_023851
858 Ga0495682_0001069
859 Ga0495682_0034629
860 Ga0495601_0002762
861 Ga0495619_0012343
862 2511264601
863 2511292216
864 2511317878
865 2512328003
866 2583794913
867 2597860460
868 2597872045
869 2599327227
870 2599401303
871 2599453028
872 2599486699
873 2599504919
874 2599515033
875 2599520194
876 2599616601
877 2599772965
878 2599807177
879 2599888278
880 2599894413
881 2599900940
882 2599945004
883 2599955267
884 2599962670
885 2599967128
886 2599974701
887 2599981215
888 2599984000
889 2599990282
890 2599997736
891 2600001776
892 2600009380
893 2600013855
894 2600021229
895 2600026869
896 2600032799
897 2600039099
898 2600044693
899 2600048816
900 2600056225
901 2600062320
902 2600068490
903 2600074649
904 2600079612
905 2600360417
906 2600367842
907 2601628672
908 2601800560
909 2606078632
910 2606125708
911 2624482977
912 2643870856
913 2671093834
914 2671129912
915 2671773263
916 2677898471
917 2715752402
918 2715759150
919 2718636187
920 2738691029
921 2739266834
922 2743740007
923 2808857322
924 2808926371
925 2808937374
926 2808948532
927 2808965704
928 2808977515
929 2808992827
930 2809000697
931 2826582841
932 2834033173
933 2842808418
934 2842819891
935 2842836903
936 2842847637
937 2842852865
938 2844666559
939 2852618077
940 2852673135
941 2878034910
942 2919067709
943 2919390572
944 2919485935
945 2919490884
946 2923159098
947 2929194726
948 2931396000
949 2945931332
950 2945966352
951 2946007380
952 2946033216
953 2974294541
954 2984287072
955 2988731017
956 2998144969
957 3007398723
958 3007425289
959 3007516755
960 3007721330
961 3007860172
962 3007866425
963 3007867204
964 8015693175
965 8019771260
966 8029995928
967 8054289434
968 8054508503
969 8055776424
970 8055823462
971 8056136904
972 8056150157
973 8056163175
974 8056171599
975 8056172278
976 8057805270

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06167

Peptidase_M90

Glucose-regulated metallo-peptidase M90

1

259

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3dl1-assembly1.cif.gz_A crystal structure of a putative metal-dependent hydrolase (yp_001336084.1) from klebsiella pneumoniae subsp. pneumoniae mgh 78578 at 2.20 a resolution 0.9334 23 255
3dl1-assembly1.cif.gz_A crystal structure of a putative metal-dependent hydrolase (yp_001336084.1) from klebsiella pneumoniae subsp. pneumoniae mgh 78578 at 2.20 a resolution 0.9038 23 255
3khi-assembly1.cif.gz_A crystal structure of a putative metal-dependent hydrolase (yp_001336084.1) from klebsiella pneumoniae subsp. pneumoniae mgh 78578 at 1.95 a resolution 0.8871 19 255
3khi-assembly1.cif.gz_A crystal structure of a putative metal-dependent hydrolase (yp_001336084.1) from klebsiella pneumoniae subsp. pneumoniae mgh 78578 at 1.95 a resolution 0.8719 19 255
6r5c-assembly2.cif.gz_B crystal structure of ppep-1(w103f/e143a/y178f) in complex with substrate peptide ac-evnppvp-conh2 0.5645 44 248
ID Description Score Start End Superfamily
af_P76346_16_139_1.10.472.150 Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Glucose-regulated metallo-peptidase M90, N-terminal domain 0.938 23 145 1.10.472.150
3dl1A01 Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Glucose-regulated metallo-peptidase M90, N-terminal domain 0.9293 23 145 1.10.472.150
af_P76346_16_139_1.10.472.150 Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Glucose-regulated metallo-peptidase M90, N-terminal domain 0.9093 23 145 1.10.472.150
3dl1A01 Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Glucose-regulated metallo-peptidase M90, N-terminal domain 0.9021 23 145 1.10.472.150
af_P76346_140_265_3.40.390.10 Alpha Beta;3-Layer(aba) Sandwich;Collagenase (Catalytic Domain);Collagenase (Catalytic Domain) 0.8622 148 271 3.40.390.10
ID Description Score Start End GO Terms
AF-A0A3M3RD88-F1-model_v4 Uncharacterized protein 0.9967 177 268 GO:0004177
GO:0005829
GO:0008237
AF-A0A7X2RY16-F1-model_v4 Zinc-dependent peptidase 0.987 1 271 GO:0004177
GO:0005829
GO:0006508
GO:0008237
AF-A0A7Z8JR23-F1-model_v4 deleted 0.9863 1 271
AF-A0A1B3CZ29-F1-model_v4 Zinc-dependent peptidase 0.9846 1 271 GO:0004177
GO:0005829
GO:0006508
GO:0008237
AF-A0A7D5QQ81-F1-model_v4 deleted 0.9842 1 270

Map