F453584
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 488 | 330 | 976 | 257 |
Family's Representative Sequence
| Representative Sequence | 3300006237|Ga0097621_100011117|Ga0097621_1000111172 |
| Length | 297 |
| Sequence | MSTAGPPKSAQLHAASGGSAAVELANEAASLGAHQSRVGIEARHLRVTYDHFVAVADTSLAVAAGESFGIVGESGSGKSTVLRALCGLVPAGAGTIRLVANAEQGIEAARASQSLPAPGTKAFRRLVQMVFQDPYGSLHPRQTVDRILAEPLAIHGIADAESRIEQALDEVGLGTGFRFRYPHQLSGGQRQRIAVARALILEPQVLLLDEPTSSLDASVQAEVLNLLEDLRRRRGLTFIMVSHDLAVVTHLCDRLMVMQRGETVELVSSADLASSRVTHDYTRQLMDASIGFRRRAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 4 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 5 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 6 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 7 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 8 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 9 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 10 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 11 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 12 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 13 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 14 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 15 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 16 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 17 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 18 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 19 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 20 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 21 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 22 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 23 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 24 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 25 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 26 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 29 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 31 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 32 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 45 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 52 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 54 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 55 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 56 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 57 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 58 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 59 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 60 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 61 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 62 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 63 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 64 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 65 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 66 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 67 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 68 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 70 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 71 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 92 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 93 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 94 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 95 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 96 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 97 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 98 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 99 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 100 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 101 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 103 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 105 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 106 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 107 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 108 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 109 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 110 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 111 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 112 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 149 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 151 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 154 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 155 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 156 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 157 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 158 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 159 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 160 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 161 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 162 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 163 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 164 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 165 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 166 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 167 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 168 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 169 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 170 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 171 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 172 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 173 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 174 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 175 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 176 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 177 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 203 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 204 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 205 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 206 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 207 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 208 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 209 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 210 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 211 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 212 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 213 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 214 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 215 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 216 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 217 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 218 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 219 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 220 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 223 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 224 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 225 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 226 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 227 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 228 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 229 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 230 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 231 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 232 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 233 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 234 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 235 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 236 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 237 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 238 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 239 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 240 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 241 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 242 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 243 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 244 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 245 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 246 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 247 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 248 | 2508501114 | Microvirga lotononidis WSM3557 | Isolate | Nodule |
| 249 | 2511231002 | Polaromonas sp. CF318 | Isolate | Rhizosphere |
| 250 | 2511231025 | Pantoea sp. YR343 | Isolate | Rhizosphere |
| 251 | 2511231035 | Pantoea sp. GM01 | Isolate | Rhizosphere |
| 252 | 2513237351 | Mesorhizobium alhagi CCNWXJ12-2 | Isolate | Nodule |
| 253 | 2558860983 | Allorhizobium undicola ATCC 700741 | Isolate | Rhizoplane |
| 254 | 2582581308 | Rhizobium sp. OK494 | Isolate | Rhizosphere |
| 255 | 2582581315 | Agrobacterium rhizogenes YR147 | Isolate | Rhizosphere |
| 256 | 2582581316 | Agrobacterium rhizogenes OK036 | Isolate | Rhizosphere |
| 257 | 2585427527 | Rhizobium lusitanum YR374 | Isolate | Rhizosphere |
| 258 | 2585427530 | Rhizobium tropici YR635 | Isolate | Rhizosphere |
| 259 | 2585427591 | Rahnella aquatilis OV744 | Isolate | Rhizosphere |
| 260 | 2585427592 | Rahnella aquatilis OV588 | Isolate | Rhizosphere |
| 261 | 2585427634 | Neorhizobium galegae bv. orientalis HAMBI 540 | Isolate | Nodule |
| 262 | 2615840626 | Rhizobium lusitanum P1-7 | Isolate | Nodule |
| 263 | 2617270742 | Rhizobium miluonense HAMBI 2971 | Isolate | Nodule |
| 264 | 2643221618 | Ensifer sp. Root231 | Isolate | Unclassified |
| 265 | 2643221626 | Ensifer sp. Root31 | Isolate | Unclassified |
| 266 | 2643221655 | Ensifer sp. Root1252 | Isolate | Unclassified |
| 267 | 2643221659 | Ensifer sp. Root127 | Isolate | Unclassified |
| 268 | 2643221698 | Ensifer sp. Root142 | Isolate | Unclassified |
| 269 | 2643221712 | Ensifer sp. Root258 | Isolate | Unclassified |
| 270 | 2667528173 | Rahnella sp. NFIX50 | Isolate | Rhizoplane |
| 271 | 2706794495 | Dickeya zeae ZJU1202 | Isolate | Unclassified |
| 272 | 2713897090 | Paracoccus sphaerophysae HAMBI 3106 | Isolate | Nodule |
| 273 | 2765235802 | Phyllobacterium bourgognense 31-25a | Isolate | Rhizoplane |
| 274 | 2775506902 | Phyllobacterium zundukense Tri-48 | Isolate | Unclassified |
| 275 | 2775506904 | Phyllobacterium zundukense Tri-38 | Isolate | Unclassified |
| 276 | 2775507266 | Rhizobium tropici PRF 81 | Isolate | Nodule |
| 277 | 2791355082 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 278 | 2818991453 | Rhizobium lusitanum 1158 | Isolate | Unclassified |
| 279 | 2818991461 | Neorhizobium alkalisoli 1225 | Isolate | Unclassified |
| 280 | 2821123053 | Rhizobium cellulosilyticum 1193 | Isolate | Unclassified |
| 281 | 2838675328 | Agrobacterium radiobacter SEMIA 410 | Isolate | Nodule |
| 282 | 2838714209 | Agrobacterium radiobacter SEMIA 435 | Isolate | Nodule |
| 283 | 2838719591 | Agrobacterium radiobacter SEMIA 436 | Isolate | Nodule |
| 284 | 2838724970 | Agrobacterium radiobacter SEMIA 437 | Isolate | Nodule |
| 285 | 2838736955 | Rhizobium cellulosilyticum SEMIA 448 | Isolate | Nodule |
| 286 | 2839993093 | Phyllobacterium endophyticum PEPV15 | Isolate | Unclassified |
| 287 | 2841840854 | Rhizobium cellulosilyticum SEMIA 444 | Isolate | Nodule |
| 288 | 2841846520 | Agrobacterium radiobacter SEMIA 440 | Isolate | Nodule |
| 289 | 2842124991 | Agrobacterium radiobacter SEMIA 434 | Isolate | Nodule |
| 290 | 2842130223 | Agrobacterium radiobacter SEMIA 441 | Isolate | Nodule |
| 291 | 2842140634 | Rhizobium cellulosilyticum SEMIA 452 | Isolate | Nodule |
| 292 | 2842152218 | Agrobacterium radiobacter SEMIA 457 | Isolate | Nodule |
| 293 | 2842170452 | Agrobacterium radiobacter SEMIA 461 | Isolate | Nodule |
| 294 | 2842175837 | Agrobacterium radiobacter SEMIA 462 | Isolate | Nodule |
| 295 | 2842187318 | Agrobacterium radiobacter SEMIA 464 | Isolate | Nodule |
| 296 | 2842211629 | Agrobacterium radiobacter SEMIA 472 | Isolate | Nodule |
| 297 | 2842224351 | Agrobacterium radiobacter SEMIA 480 | Isolate | Nodule |
| 298 | 2842482326 | Rhizobium lusitanum SEMIA 4060 | Isolate | Nodule |
| 299 | 2842775625 | Roseomonas sp. R-71825 | Isolate | Unclassified |
| 300 | 2844163670 | Ensifer sp. 1H6 | Isolate | Unclassified |
| 301 | 2854601825 | Dickeya dianthicola SS70 | Isolate | Stem Tuber |
| 302 | 2854911287 | Brucella lupini LUP21 | Isolate | Unclassified |
| 303 | 2857531043 | Neorhizobium sp. R-72160 | Isolate | Unclassified |
| 304 | 2876601092 | Pantoea endophytica 596 | Isolate | Unclassified |
| 305 | 2883291878 | Hypericibacter terrae R5913 | Isolate | Rhizosphere |
| 306 | 2883354860 | Hypericibacter adhaerens R5959 | Isolate | Rhizosphere |
| 307 | 2884298095 | Microvirga thermotolerans HR1 | Isolate | Rhizosphere |
| 308 | 2891048133 | Martelella lutilitoris GH2-6 | Isolate | Rhizosphere |
| 309 | 2899275550 | Paracoccus hibiscisoli CCTCC AB2016182 | Isolate | Rhizosphere |
| 310 | 2904474040 | Rahnella aquatilis 4485 | Isolate | Rhizosphere |
| 311 | 2904504865 | Serratia marcescens 1822 | Isolate | Unclassified |
| 312 | 2904578770 | Phyllobacterium sp. 586 | Isolate | Unclassified |
| 313 | 2915650412 | Ochrobactrum sp. CM-21-5 | Isolate | Rhizosphere |
| 314 | 2919114240 | Agrobacterium tumefaciens 1457 | Isolate | Rhizosphere |
| 315 | 2919119836 | Phyllobacterium sp. 1468 | Isolate | Rhizosphere |
| 316 | 2919150387 | Rahnella aceris 1817 | Isolate | Unclassified |
| 317 | 2919171160 | Neorhizobium sp. 2083 | Isolate | Unclassified |
| 318 | 2926754445 | Agrobacterium radiobacter SLBN-94 | Isolate | Rhizosphere |
| 319 | 2927143783 | Rahnella sp. 2050 | Isolate | Unclassified |
| 320 | 2928521798 | Phyllobacterium ifriqiyense 1451 | Isolate | Rhizosphere |
| 321 | 2929138655 | Agrobacterium sp. R-72433 Hybrid assembly | Isolate | Unclassified |
| 322 | 2933006813 | Rhizobium sp. SEMIA 439 | Isolate | Unclassified |
| 323 | 2941499720 | Ensifer sp. 4252 | Isolate | Rhizosphere |
| 324 | 2954011201 | Phyllobacterium ifrigiyense W4I11 | Isolate | Rhizosphere |
| 325 | 8005658619 | Rhizobium terrae CC-HIH110 | Isolate | Unclassified |
| 326 | 8016733728 | Pantoea sp. SORGH_AS 659 | Isolate | Unclassified |
| 327 | 8019499862 | Kluyvera sp. 1366 | Isolate | Rhizosphere |
| 328 | 8049293176 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 329 | 8055431914 | Allorhizobium sonneratiae BGMRC 0089 | Isolate | Unclassified |
| 330 | 8057132660 | Paracoccus rhizosphaerae LMG 21293 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 82.99 |
| Metatranscriptomes | 0 |
| Isolates | 17.01 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 20.08 |
| Nodule | 6.15 |
| Rhizoplane | 2.46 |
| Rhizosphere | 56.15 |
| Stem | 0 |
| Stem Tuber | 0.2 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0097621_100011117 | 3300006237 | Bacteria | 6621 |
| 2 | SwRhRL2b_contig_478082 | 2162886007 | Bacteria | 3137 |
| 3 | JGI25162J39368_1000092 | 3300002737 | Bacteria | 100905 |
| 4 | JGI25162J39368_1000675 | 3300002737 | Bacteria | 23944 |
| 5 | JGI25163J39215_1000013 | 3300002771 | Bacteria | 86331 |
| 6 | JGI25164J39214_1000071 | 3300002772 | Bacteria | 100905 |
| 7 | JGI25159J45721_1000407 | 3300002987 | Bacteria | 19965 |
| 8 | JGI25151J46595_10017735 | 3300003187 | Bacteria | 3077 |
| 9 | JGI25165J46597_1000398 | 3300003214 | Bacteria | 45980 |
| 10 | JGI25165J46597_1002788 | 3300003214 | Bacteria | 5066 |
| 11 | rootH1_10194219 | 3300003323 | Bacteria | 2368 |
| 12 | JGI25160J50197_1000172 | 3300003354 | Bacteria | 55781 |
| 13 | JGI25161J50226_1000007 | 3300003374 | Bacteria | 256181 |
| 14 | Ga0055538_1000064 | 3300003751 | Bacteria | 100905 |
| 15 | Ga0055539_1000098 | 3300003752 | Bacteria | 100905 |
| 16 | Ga0055533_1000108 | 3300003756 | Bacteria | 100905 |
| 17 | Ga0055525_1000141 | 3300003759 | Bacteria | 100905 |
| 18 | Ga0055526_1003566 | 3300003771 | Bacteria | 9799 |
| 19 | Ga0055536_1005157 | 3300003781 | Bacteria | 6459 |
| 20 | Ga0055536_1009577 | 3300003781 | Bacteria | 3980 |
| 21 | Ga0055530_10000763 | 3300003791 | Bacteria | 26793 |
| 22 | Ga0055530_10001299 | 3300003791 | Bacteria | 18844 |
| 23 | Ga0055540_1000504 | 3300003792 | Bacteria | 29761 |
| 24 | Ga0055540_1002428 | 3300003792 | Bacteria | 9845 |
| 25 | Ga0055531_10003215 | 3300003794 | Bacteria | 10487 |
| 26 | Ga0055531_10004306 | 3300003794 | Bacteria | 8724 |
| 27 | Ga0055541_1000065 | 3300003841 | Bacteria | 100905 |
| 28 | Ga0058692_1000171 | 3300003856 | Bacteria | 40209 |
| 29 | Ga0058692_1000679 | 3300003856 | Bacteria | 14026 |
| 30 | Ga0058692_1002252 | 3300003856 | Bacteria | 6551 |
| 31 | Ga0055543_1011070 | 3300004625 | Bacteria | 1863 |
| 32 | Ga0065165_1018011 | 3300005262 | Bacteria | 2577 |
| 33 | Ga0065165_1027467 | 3300005262 | Bacteria | 1855 |
| 34 | Ga0065165_1037185 | 3300005262 | Bacteria | 1477 |
| 35 | Ga0065704_10000032 | 3300005289 | Bacteria | 15316 |
| 36 | Ga0070670_100004009 | 3300005331 | Bacteria | 12288 |
| 37 | Ga0070670_100004917 | 3300005331 | Bacteria | 11246 |
| 38 | Ga0070670_100024623 | 3300005331 | Bacteria | 5176 |
| 39 | Ga0070670_100071595 | 3300005331 | Bacteria | 2977 |
| 40 | Ga0070677_10058845 | 3300005333 | Bacteria | 1579 |
| 41 | Ga0068869_100000007 | 3300005334 | Bacteria | 78820 |
| 42 | Ga0070680_100014122 | 3300005336 | Bacteria | 6237 |
| 43 | Ga0068868_100497731 | 3300005338 | Bacteria | 1067 |
| 44 | Ga0070689_100131032 | 3300005340 | Bacteria | 2011 |
| 45 | Ga0070668_100005002 | 3300005347 | Bacteria | 9819 |
| 46 | Ga0070668_100010303 | 3300005347 | Bacteria | 6941 |
| 47 | Ga0070668_100070008 | 3300005347 | Bacteria | 2730 |
| 48 | Ga0070669_100009394 | 3300005353 | Bacteria | 6964 |
| 49 | Ga0070669_100031327 | 3300005353 | Bacteria | 3842 |
| 50 | Ga0070669_100081349 | 3300005353 | Bacteria | 2412 |
| 51 | Ga0070669_100202647 | 3300005353 | Bacteria | 1562 |
| 52 | Ga0070675_100008830 | 3300005354 | Bacteria | 7832 |
| 53 | Ga0070675_100008944 | 3300005354 | Bacteria | 7781 |
| 54 | Ga0070674_100110942 | 3300005356 | Bacteria | 2014 |
| 55 | Ga0070673_100005812 | 3300005364 | Bacteria | 7947 |
| 56 | Ga0070673_100044158 | 3300005364 | Bacteria | 3449 |
| 57 | Ga0070673_100115291 | 3300005364 | Bacteria | 2234 |
| 58 | Ga0070673_100136030 | 3300005364 | Bacteria | 2068 |
| 59 | Ga0070667_100001939 | 3300005367 | Bacteria | 18351 |
| 60 | Ga0070667_100033931 | 3300005367 | Bacteria | 4269 |
| 61 | Ga0070667_100086660 | 3300005367 | Bacteria | 2687 |
| 62 | Ga0070709_10147855 | 3300005434 | Bacteria | 1621 |
| 63 | Ga0070709_10242786 | 3300005434 | Bacteria | 1294 |
| 64 | Ga0070705_100069014 | 3300005440 | Bacteria | 2130 |
| 65 | Ga0070700_100291104 | 3300005441 | Bacteria | 1188 |
| 66 | Ga0070678_100178204 | 3300005456 | Bacteria | 1737 |
| 67 | Ga0070662_100032281 | 3300005457 | Bacteria | 3680 |
| 68 | Ga0070662_100066591 | 3300005457 | Bacteria | 2643 |
| 69 | Ga0070681_10051171 | 3300005458 | Bacteria | 4120 |
| 70 | Ga0070681_10170879 | 3300005458 | Bacteria | 2096 |
| 71 | Ga0068867_100035038 | 3300005459 | Bacteria | 3639 |
| 72 | Ga0068867_100130131 | 3300005459 | Bacteria | 1955 |
| 73 | Ga0070679_100090856 | 3300005530 | Bacteria | 3041 |
| 74 | Ga0070672_100024379 | 3300005543 | Bacteria | 4470 |
| 75 | Ga0070672_100055134 | 3300005543 | Bacteria | 3113 |
| 76 | Ga0070672_100144065 | 3300005543 | Bacteria | 1968 |
| 77 | Ga0070686_100109638 | 3300005544 | Bacteria | 1878 |
| 78 | Ga0070696_100602262 | 3300005546 | Bacteria | 886 |
| 79 | Ga0070665_100209853 | 3300005548 | Bacteria | 1948 |
| 80 | Ga0070665_100307093 | 3300005548 | Bacteria | 1590 |
| 81 | Ga0070704_100149449 | 3300005549 | Bacteria | 1835 |
| 82 | Ga0068855_100007441 | 3300005563 | Bacteria | 13261 |
| 83 | Ga0068855_100089487 | 3300005563 | Bacteria | 3554 |
| 84 | Ga0068855_100446394 | 3300005563 | Bacteria | 1412 |
| 85 | Ga0070664_100291025 | 3300005564 | Bacteria | 1475 |
| 86 | Ga0068857_100000676 | 3300005577 | Bacteria | 25307 |
| 87 | Ga0068854_100175485 | 3300005578 | Bacteria | 1670 |
| 88 | Ga0068852_100332330 | 3300005616 | Bacteria | 1479 |
| 89 | Ga0068852_100563961 | 3300005616 | Bacteria | 1140 |
| 90 | Ga0068859_100003514 | 3300005617 | Bacteria | 15961 |
| 91 | Ga0068864_100001466 | 3300005618 | Bacteria | 19448 |
| 92 | Ga0068864_100018957 | 3300005618 | Bacteria | 5752 |
| 93 | Ga0068864_100031537 | 3300005618 | Bacteria | 4497 |
| 94 | Ga0068861_100001688 | 3300005719 | Bacteria | 14166 |
| 95 | Ga0068861_100075375 | 3300005719 | Bacteria | 2626 |
| 96 | Ga0068861_100354798 | 3300005719 | Bacteria | 1288 |
| 97 | Ga0068870_10068447 | 3300005840 | Bacteria | 1929 |
| 98 | Ga0068863_100001574 | 3300005841 | Bacteria | 22566 |
| 99 | Ga0068863_100010047 | 3300005841 | Bacteria | 9211 |
| 100 | Ga0068858_100013010 | 3300005842 | Bacteria | 7847 |
| 101 | Ga0068858_100332144 | 3300005842 | Bacteria | 1454 |
| 102 | Ga0068858_100370102 | 3300005842 | Bacteria | 1374 |
| 103 | Ga0068860_100005878 | 3300005843 | Bacteria | 12351 |
| 104 | Ga0068860_100073368 | 3300005843 | Bacteria | 3253 |
| 105 | Ga0068860_100074894 | 3300005843 | Bacteria | 3220 |
| 106 | Ga0068860_100113446 | 3300005843 | Bacteria | 2591 |
| 107 | Ga0068860_100252183 | 3300005843 | Bacteria | 1719 |
| 108 | Ga0068862_100002922 | 3300005844 | Bacteria | 14933 |
| 109 | Ga0068862_100018133 | 3300005844 | Bacteria | 5861 |
| 110 | Ga0075363_100109893 | 3300006048 | Bacteria | 1532 |
| 111 | Ga0075364_10000309 | 3300006051 | Bacteria | 23917 |
| 112 | Ga0075364_10007527 | 3300006051 | Bacteria | 6472 |
| 113 | Ga0075364_10118036 | 3300006051 | Bacteria | 1774 |
| 114 | Ga0075364_10139922 | 3300006051 | Bacteria | 1627 |
| 115 | Ga0097621_100341607 | 3300006237 | Bacteria | 1330 |
| 116 | Ga0068871_100060006 | 3300006358 | Bacteria | 3101 |
| 117 | Ga0068871_100237404 | 3300006358 | Bacteria | 1584 |
| 118 | Ga0068865_100315353 | 3300006881 | Bacteria | 1256 |
| 119 | Ga0097620_100003514 | 3300006931 | Bacteria | 15961 |
| 120 | Ga0079104_1000230 | 3300006946 | Bacteria | 75473 |
| 121 | Ga0099826_10003742 | 3300006948 | Bacteria | 10449 |
| 122 | Ga0105251_10025854 | 3300009011 | Bacteria | 2996 |
| 123 | Ga0105244_10000798 | 3300009036 | Bacteria | 26814 |
| 124 | Ga0105244_10018475 | 3300009036 | Bacteria | 3912 |
| 125 | Ga0105250_10000002 | 3300009092 | Bacteria | 566949 |
| 126 | Ga0105250_10004268 | 3300009092 | Bacteria | 6607 |
| 127 | Ga0105240_10000097 | 3300009093 | Bacteria | 179135 |
| 128 | Ga0105245_10358753 | 3300009098 | Bacteria | 1446 |
| 129 | Ga0105248_10001664 | 3300009177 | Bacteria | 24713 |
| 130 | Ga0105248_10024292 | 3300009177 | Bacteria | 6739 |
| 131 | Ga0105248_10049509 | 3300009177 | Bacteria | 4713 |
| 132 | Ga0105248_10304263 | 3300009177 | Bacteria | 1795 |
| 133 | Ga0105248_10861788 | 3300009177 | Bacteria | 1023 |
| 134 | Ga0105237_10001364 | 3300009545 | Bacteria | 32311 |
| 135 | Ga0105238_10045331 | 3300009551 | Bacteria | 4442 |
| 136 | Ga0105249_10104647 | 3300009553 | Bacteria | 2667 |
| 137 | Ga0105239_10000258 | 3300010375 | Bacteria | 78849 |
| 138 | Ga0157373_10000189 | 3300013100 | Bacteria | 50406 |
| 139 | Ga0157371_10000008 | 3300013102 | Bacteria | 393028 |
| 140 | Ga0157371_10006536 | 3300013102 | Bacteria | 9590 |
| 141 | Ga0157370_10178722 | 3300013104 | Bacteria | 1972 |
| 142 | Ga0157369_10353027 | 3300013105 | Bacteria | 1527 |
| 143 | Ga0163162_10045639 | 3300013306 | Bacteria | 4390 |
| 144 | Ga0163162_10107547 | 3300013306 | Bacteria | 2885 |
| 145 | Ga0163162_10211508 | 3300013306 | Bacteria | 2069 |
| 146 | Ga0157375_10001469 | 3300013308 | Bacteria | 20277 |
| 147 | Ga0157375_10165655 | 3300013308 | Bacteria | 2355 |
| 148 | Ga0157375_10306556 | 3300013308 | Bacteria | 1752 |
| 149 | Ga0163163_10001547 | 3300014325 | Bacteria | 19382 |
| 150 | Ga0163163_10036645 | 3300014325 | Bacteria | 4766 |
| 151 | Ga0163163_10267306 | 3300014325 | Bacteria | 1761 |
| 152 | Ga0157380_10265672 | 3300014326 | Bacteria | 1561 |
| 153 | Ga0157379_10000142 | 3300014968 | Bacteria | 51727 |
| 154 | Ga0157379_10372149 | 3300014968 | Bacteria | 1310 |
| 155 | Ga0157376_10029249 | 3300014969 | Bacteria | 4389 |
| 156 | Ga0157376_10746754 | 3300014969 | Bacteria | 987 |
| 157 | Ga0209760_100078 | 3300025207 | Bacteria | 77832 |
| 158 | Ga0209436_107041 | 3300025208 | Bacteria | 2399 |
| 159 | Ga0209784_100001 | 3300025224 | Bacteria | 3600592 |
| 160 | Ga0209566_100001 | 3300025225 | Bacteria | 3600765 |
| 161 | Ga0209674_100002 | 3300025226 | Bacteria | 3600592 |
| 162 | Ga0209563_100002 | 3300025230 | Bacteria | 2045675 |
| 163 | Ga0207427_100020 | 3300025231 | Bacteria | 507515 |
| 164 | Ga0209437_100001 | 3300025233 | Bacteria | 2045675 |
| 165 | Ga0209437_100042 | 3300025233 | Bacteria | 444095 |
| 166 | Ga0209437_105280 | 3300025233 | Bacteria | 2208 |
| 167 | Ga0207425_1001535 | 3300025245 | Bacteria | 9474 |
| 168 | Ga0209677_100002 | 3300025253 | Bacteria | 2045675 |
| 169 | Ga0209677_100172 | 3300025253 | Bacteria | 55396 |
| 170 | Ga0209233_1000054 | 3300025261 | Bacteria | 439669 |
| 171 | Ga0209233_1000218 | 3300025261 | Bacteria | 105353 |
| 172 | Ga0209233_1000956 | 3300025261 | Bacteria | 12493 |
| 173 | Ga0209565_1000333 | 3300025263 | Bacteria | 42094 |
| 174 | Ga0209130_1000245 | 3300025284 | Bacteria | 68668 |
| 175 | Ga0209130_1000708 | 3300025284 | Bacteria | 29740 |
| 176 | Ga0209675_1003873 | 3300025291 | Bacteria | 6883 |
| 177 | Ga0209676_1000013 | 3300025292 | Bacteria | 816080 |
| 178 | Ga0209676_1003354 | 3300025292 | Bacteria | 9980 |
| 179 | Ga0209676_1014480 | 3300025292 | Bacteria | 2961 |
| 180 | Ga0209025_1004718 | 3300025294 | Bacteria | 11627 |
| 181 | Ga0209025_1009265 | 3300025294 | Bacteria | 6894 |
| 182 | Ga0209025_1010428 | 3300025294 | Bacteria | 6294 |
| 183 | Ga0209564_1002543 | 3300025295 | Bacteria | 14056 |
| 184 | Ga0209564_1051481 | 3300025295 | Bacteria | 999 |
| 185 | Ga0209758_1000341 | 3300025297 | Bacteria | 86460 |
| 186 | Ga0209050_1000008 | 3300025298 | Bacteria | 1144179 |
| 187 | Ga0209050_1001244 | 3300025298 | Bacteria | 29472 |
| 188 | Ga0209050_1015111 | 3300025298 | Bacteria | 3270 |
| 189 | Ga0209050_1020339 | 3300025298 | Bacteria | 2473 |
| 190 | Ga0207426_1000091 | 3300025302 | Bacteria | 280561 |
| 191 | Ga0207426_1005778 | 3300025302 | Bacteria | 5555 |
| 192 | Ga0209051_1000005 | 3300025303 | Bacteria | 1142353 |
| 193 | Ga0209051_1002584 | 3300025303 | Bacteria | 12746 |
| 194 | Ga0209257_1000048 | 3300025304 | Bacteria | 455536 |
| 195 | Ga0209257_1003097 | 3300025304 | Bacteria | 14917 |
| 196 | Ga0207696_1000239 | 3300025711 | Bacteria | 75936 |
| 197 | Ga0207696_1000390 | 3300025711 | Bacteria | 41986 |
| 198 | Ga0207696_1001181 | 3300025711 | Bacteria | 14876 |
| 199 | Ga0207655_1007482 | 3300025728 | Bacteria | 7078 |
| 200 | Ga0207655_1020750 | 3300025728 | Bacteria | 3363 |
| 201 | Ga0207682_10033201 | 3300025893 | Bacteria | 2077 |
| 202 | Ga0207699_10044524 | 3300025906 | Bacteria | 2584 |
| 203 | Ga0207699_10092477 | 3300025906 | Bacteria | 1901 |
| 204 | Ga0207645_10009537 | 3300025907 | Bacteria | 6709 |
| 205 | Ga0207645_10085566 | 3300025907 | Bacteria | 2024 |
| 206 | Ga0207643_10065858 | 3300025908 | Bacteria | 2076 |
| 207 | Ga0207707_10316847 | 3300025912 | Bacteria | 1347 |
| 208 | Ga0207695_10000187 | 3300025913 | Bacteria | 179183 |
| 209 | Ga0207671_10001438 | 3300025914 | Bacteria | 27603 |
| 210 | Ga0207681_10095331 | 3300025923 | Bacteria | 2134 |
| 211 | Ga0207681_10115306 | 3300025923 | Bacteria | 1961 |
| 212 | Ga0207681_10154774 | 3300025923 | Bacteria | 1722 |
| 213 | Ga0207694_10146995 | 3300025924 | Bacteria | 1897 |
| 214 | Ga0207650_10024013 | 3300025925 | Bacteria | 4329 |
| 215 | Ga0207650_10054175 | 3300025925 | Bacteria | 2975 |
| 216 | Ga0207650_10095453 | 3300025925 | Bacteria | 2279 |
| 217 | Ga0207650_10135639 | 3300025925 | Bacteria | 1930 |
| 218 | Ga0207650_10139975 | 3300025925 | Bacteria | 1901 |
| 219 | Ga0207659_10016896 | 3300025926 | Bacteria | 4758 |
| 220 | Ga0207706_10008309 | 3300025933 | Bacteria | 9570 |
| 221 | Ga0207706_10047586 | 3300025933 | Bacteria | 3794 |
| 222 | Ga0207686_10192554 | 3300025934 | Bacteria | 1455 |
| 223 | Ga0207670_10260325 | 3300025936 | Bacteria | 1344 |
| 224 | Ga0207669_10137330 | 3300025937 | Bacteria | 1691 |
| 225 | Ga0207691_10000111 | 3300025940 | Bacteria | 72961 |
| 226 | Ga0207711_10041717 | 3300025941 | Bacteria | 3909 |
| 227 | Ga0207711_10122206 | 3300025941 | Bacteria | 2326 |
| 228 | Ga0207689_10000142 | 3300025942 | Bacteria | 61457 |
| 229 | Ga0207667_10018605 | 3300025949 | Bacteria | 7785 |
| 230 | Ga0207651_10123230 | 3300025960 | Bacteria | 1970 |
| 231 | Ga0207651_10518521 | 3300025960 | Bacteria | 1032 |
| 232 | Ga0207668_10013845 | 3300025972 | Bacteria | 4980 |
| 233 | Ga0207668_10015772 | 3300025972 | Bacteria | 4701 |
| 234 | Ga0207658_10067054 | 3300025986 | Bacteria | 2702 |
| 235 | Ga0207658_10094652 | 3300025986 | Bacteria | 2325 |
| 236 | Ga0207677_10224328 | 3300026023 | Bacteria | 1509 |
| 237 | Ga0207703_10000195 | 3300026035 | Bacteria | 70480 |
| 238 | Ga0207639_10383123 | 3300026041 | Bacteria | 1263 |
| 239 | Ga0207702_10349260 | 3300026078 | Bacteria | 1415 |
| 240 | Ga0207641_10018427 | 3300026088 | Bacteria | 5724 |
| 241 | Ga0207641_10207885 | 3300026088 | Bacteria | 1808 |
| 242 | Ga0207648_10016833 | 3300026089 | Bacteria | 6666 |
| 243 | Ga0207648_10581497 | 3300026089 | Bacteria | 1031 |
| 244 | Ga0207676_10001696 | 3300026095 | Bacteria | 16247 |
| 245 | Ga0207676_10002462 | 3300026095 | Bacteria | 13209 |
| 246 | Ga0207676_10108092 | 3300026095 | Bacteria | 2321 |
| 247 | Ga0207674_10002098 | 3300026116 | Bacteria | 25266 |
| 248 | Ga0207675_100004037 | 3300026118 | Bacteria | 14223 |
| 249 | Ga0207675_100050221 | 3300026118 | Bacteria | 3892 |
| 250 | Ga0207675_100129573 | 3300026118 | Bacteria | 2392 |
| 251 | Ga0207683_10026873 | 3300026121 | Bacteria | 4972 |
| 252 | Ga0207683_10354885 | 3300026121 | Bacteria | 1346 |
| 253 | Ga0207698_10380201 | 3300026142 | Bacteria | 1343 |
| 254 | Ga0209281_1000179 | 3300027111 | Bacteria | 148102 |
| 255 | Ga0209371_1000417 | 3300027312 | Bacteria | 43898 |
| 256 | Ga0209371_1000830 | 3300027312 | Bacteria | 25445 |
| 257 | Ga0209282_1012967 | 3300027666 | Bacteria | 5304 |
| 258 | Ga0268265_10002425 | 3300028380 | Bacteria | 14080 |
| 259 | Ga0268264_10000606 | 3300028381 | Bacteria | 43164 |
| 260 | Ga0268264_10057162 | 3300028381 | Bacteria | 3262 |
| 261 | Ga0268264_10196698 | 3300028381 | Bacteria | 1841 |
| 262 | Ga0268264_10213045 | 3300028381 | Bacteria | 1774 |
| 263 | Ga0307515_10057315 | 3300028794 | Bacteria | 5640 |
| 264 | Ga0268256_1000202 | 3300030500 | Bacteria | 67837 |
| 265 | Ga0268256_1003757 | 3300030500 | Bacteria | 6657 |
| 266 | Ga0316181_1033551 | 3300030744 | Bacteria | 4006 |
| 267 | Ga0265339_10050302 | 3300031249 | Bacteria | 2279 |
| 268 | Ga0265331_10007054 | 3300031250 | Bacteria | 6551 |
| 269 | Ga0265316_10373113 | 3300031344 | Bacteria | 1030 |
| 270 | Ga0307513_10000206 | 3300031456 | Bacteria | 85338 |
| 271 | Ga0265313_10000021 | 3300031595 | Bacteria | 144949 |
| 272 | Ga0316576_10018776 | 3300031727 | Bacteria | 4729 |
| 273 | Ga0307413_10141381 | 3300031824 | Bacteria | 1664 |
| 274 | Ga0307410_10185745 | 3300031852 | Bacteria | 1577 |
| 275 | Ga0307409_100500388 | 3300031995 | Bacteria | 1183 |
| 276 | Ga0307416_100086679 | 3300032002 | Bacteria | 2670 |
| 277 | Ga0307415_100267398 | 3300032126 | Bacteria | 1399 |
| 278 | Ga0373927_0035055 | 3300035695 | Bacteria | 3263 |
| 279 | Ga0373933_0287633 | 3300035724 | Bacteria | 1063 |
| 280 | Ga0316584_0100544 | 3300036712 | Bacteria | 2165 |
| 281 | Ga0316584_0302134 | 3300036712 | Bacteria | 1158 |
| 282 | Ga0395899_0000589 | 3300037312 | Bacteria | 38294 |
| 283 | Ga0395900_0000375 | 3300037418 | Bacteria | 64534 |
| 284 | Ga0395898_0000629 | 3300037466 | Bacteria | 64534 |
| 285 | Ga0395905_0000361 | 3300037471 | Bacteria | 64517 |
| 286 | Ga0395901_0000273 | 3300038443 | Bacteria | 64425 |
| 287 | Ga0436365_0009921 | 3300039437 | Bacteria | 1461 |
| 288 | Ga0436360_0657748 | 3300039438 | Bacteria | 1698 |
| 289 | Ga0495617_008308 | 3300046452 | Bacteria | 3581 |
| 290 | Ga0495591_000111 | 3300046458 | Bacteria | 93733 |
| 291 | Ga0495591_002389 | 3300046458 | Bacteria | 10507 |
| 292 | Ga0495650_0000043 | 3300046471 | Bacteria | 357197 |
| 293 | Ga0495580_0003875 | 3300046472 | Bacteria | 12664 |
| 294 | Ga0495605_0193258 | 3300046474 | Bacteria | 889 |
| 295 | Ga0495607_0146249 | 3300046501 | Bacteria | 1214 |
| 296 | Ga0495606_0001398 | 3300046507 | Bacteria | 32519 |
| 297 | Ga0495616_0042943 | 3300046513 | Bacteria | 2299 |
| 298 | Ga0495631_0141056 | 3300046518 | Bacteria | 1035 |
| 299 | Ga0495643_0029652 | 3300046522 | Bacteria | 3060 |
| 300 | Ga0495648_0009512 | 3300046524 | Bacteria | 7512 |
| 301 | Ga0495654_0000147 | 3300046530 | Bacteria | 72993 |
| 302 | Ga0495654_0000250 | 3300046530 | Bacteria | 49614 |
| 303 | Ga0495654_0003284 | 3300046530 | Bacteria | 9972 |
| 304 | Ga0495668_0005994 | 3300046616 | Bacteria | 8071 |
| 305 | Ga0495625_0119943 | 3300046660 | Bacteria | 1791 |
| 306 | Ga0495588_0001469 | 3300046674 | Bacteria | 10112 |
| 307 | Ga0495671_0002319 | 3300046692 | Bacteria | 12088 |
| 308 | Ga0495649_0022825 | 3300046694 | Bacteria | 3499 |
| 309 | Ga0495589_0017398 | 3300046794 | Bacteria | 3690 |
| 310 | Ga0495660_0000012 | 3300046810 | Bacteria | 350701 |
| 311 | Ga0495660_0000020 | 3300046810 | Bacteria | 304768 |
| 312 | Ga0495672_0000011 | 3300047320 | Bacteria | 535362 |
| 313 | Ga0495680_0267401 | 3300047322 | Bacteria | 1208 |
| 314 | Ga0495683_0022959 | 3300047323 | Bacteria | 3207 |
| 315 | Ga0495673_0000020 | 3300047469 | Bacteria | 548327 |
| 316 | Ga0495681_0027166 | 3300047470 | Bacteria | 2966 |
| 317 | Ga0495686_0009938 | 3300047472 | Bacteria | 6811 |
| 318 | Ga0496100_0000286 | 3300048903 | Bacteria | 25474 |
| 319 | Ga0496100_0087102 | 3300048903 | Bacteria | 2123 |
| 320 | Ga0496101_0000164 | 3300048904 | Bacteria | 56560 |
| 321 | Ga0496101_0116726 | 3300048904 | Bacteria | 2014 |
| 322 | Ga0496102_0001007 | 3300048905 | Bacteria | 26439 |
| 323 | Ga0496103_0009151 | 3300048906 | Bacteria | 5865 |
| 324 | Ga0496104_0014452 | 3300048907 | Bacteria | 7131 |
| 325 | Ga0496106_0069435 | 3300048909 | Bacteria | 2689 |
| 326 | Ga0496108_0179310 | 3300048911 | Bacteria | 1834 |
| 327 | Ga0496116_0000066 | 3300048919 | Bacteria | 264035 |
| 328 | Ga0496116_0023132 | 3300048919 | Bacteria | 4636 |
| 329 | Ga0496116_0094523 | 3300048919 | Bacteria | 1806 |
| 330 | Ga0496117_0000997 | 3300048920 | Bacteria | 43330 |
| 331 | Ga0496117_0002474 | 3300048920 | Bacteria | 23204 |
| 332 | Ga0496117_0009777 | 3300048920 | Bacteria | 8847 |
| 333 | Ga0496118_0001178 | 3300048921 | Bacteria | 40345 |
| 334 | Ga0496118_0005581 | 3300048921 | Bacteria | 14241 |
| 335 | Ga0496118_0008115 | 3300048921 | Bacteria | 10935 |
| 336 | Ga0496118_0056669 | 3300048921 | Bacteria | 2944 |
| 337 | Ga0496118_0193894 | 3300048921 | Bacteria | 1212 |
| 338 | Ga0496119_0012240 | 3300048922 | Bacteria | 6992 |
| 339 | Ga0496119_0018206 | 3300048922 | Bacteria | 5244 |
| 340 | Ga0496119_0023643 | 3300048922 | Bacteria | 4349 |
| 341 | Ga0496119_0031778 | 3300048922 | Bacteria | 3531 |
| 342 | Ga0496120_0001859 | 3300048923 | Bacteria | 23494 |
| 343 | Ga0496120_0010251 | 3300048923 | Bacteria | 6560 |
| 344 | Ga0496120_0044838 | 3300048923 | Bacteria | 2566 |
| 345 | Ga0496121_0000033 | 3300048924 | Bacteria | 377542 |
| 346 | Ga0496121_0000084 | 3300048924 | Bacteria | 225942 |
| 347 | Ga0496121_0000216 | 3300048924 | Bacteria | 127028 |
| 348 | Ga0496121_0005558 | 3300048924 | Bacteria | 16101 |
| 349 | Ga0496122_0000110 | 3300048925 | Bacteria | 190142 |
| 350 | Ga0496122_0002781 | 3300048925 | Bacteria | 24065 |
| 351 | Ga0496122_0011709 | 3300048925 | Bacteria | 8839 |
| 352 | Ga0496123_0000081 | 3300048926 | Bacteria | 190142 |
| 353 | Ga0496123_0002476 | 3300048926 | Bacteria | 22795 |
| 354 | Ga0496123_0030641 | 3300048926 | Bacteria | 3933 |
| 355 | Ga0496123_0052200 | 3300048926 | Bacteria | 2715 |
| 356 | Ga0496124_0000066 | 3300048927 | Bacteria | 222815 |
| 357 | Ga0496124_0008929 | 3300048927 | Bacteria | 10387 |
| 358 | Ga0496124_0018729 | 3300048927 | Bacteria | 6472 |
| 359 | Ga0496124_0020408 | 3300048927 | Bacteria | 6122 |
| 360 | Ga0496124_0073191 | 3300048927 | Bacteria | 2836 |
| 361 | Ga0496124_0161115 | 3300048927 | Bacteria | 1748 |
| 362 | Ga0496125_0000033 | 3300048928 | Bacteria | 351850 |
| 363 | Ga0496125_0000218 | 3300048928 | Bacteria | 117272 |
| 364 | Ga0496125_0002983 | 3300048928 | Bacteria | 21244 |
| 365 | Ga0496126_0000420 | 3300048929 | Bacteria | 85425 |
| 366 | Ga0496126_0027736 | 3300048929 | Bacteria | 5404 |
| 367 | Ga0496126_0065937 | 3300048929 | Bacteria | 3238 |
| 368 | Ga0495678_000551 | 3300049459 | Bacteria | 36076 |
| 369 | Ga0495678_041843 | 3300049459 | Bacteria | 1830 |
| 370 | Ga0495682_0000005 | 3300049460 | Bacteria | 360387 |
| 371 | Ga0501032_0105053 | 3300049569 | Bacteria | 1871 |
| 372 | Ga0501033_0048133 | 3300049570 | Bacteria | 3167 |
| 373 | Ga0501034_0425400 | 3300049571 | Bacteria | 1248 |
| 374 | Ga0501038_0058174 | 3300049574 | Bacteria | 3315 |
| 375 | Ga0501039_0054997 | 3300049575 | Bacteria | 3082 |
| 376 | Ga0501083_0002976 | 3300049744 | Bacteria | 11757 |
| 377 | Ga0501035_0240839 | 3300049822 | Bacteria | 1538 |
| 378 | nmdc:mga00v17_104_c1 | 3300050491 | Bacteria | 50343 |
| 379 | nmdc:mga00v17_109618_c1 | 3300050491 | Bacteria | 1750 |
| 380 | nmdc:mga00v17_7500_c1 | 3300050491 | Bacteria | 5823 |
| 381 | nmdc:mga00v17_95488_c1 | 3300050491 | Bacteria | 1872 |
| 382 | nmdc:mga07m45_252781_c1 | 3300050496 | Bacteria | 1025 |
| 383 | nmdc:mga0sz30_60112_c1 | 3300050516 | Bacteria | 1622 |
| 384 | Ga0500650_0114579 | 3300053098 | Bacteria | 1258 |
| 385 | Ga0500593_000456 | 3300053117 | Bacteria | 16197 |
| 386 | Ga0500607_106720 | 3300053121 | Bacteria | 1381 |
| 387 | Ga0500618_000008 | 3300053125 | Bacteria | 214678 |
| 388 | Ga0500618_000122 | 3300053125 | Bacteria | 63970 |
| 389 | Ga0500618_001174 | 3300053125 | Bacteria | 12644 |
| 390 | Ga0500618_028116 | 3300053125 | Bacteria | 1333 |
| 391 | Ga0500618_057580 | 3300053125 | Bacteria | 875 |
| 392 | Ga0500621_000014 | 3300053126 | Bacteria | 126576 |
| 393 | Ga0500568_0000116 | 3300053139 | Bacteria | 71883 |
| 394 | Ga0500573_0001480 | 3300053140 | Bacteria | 11280 |
| 395 | Ga0500573_0007401 | 3300053140 | Bacteria | 5986 |
| 396 | Ga0500586_060140 | 3300053145 | Bacteria | 1321 |
| 397 | Ga0500616_0000587 | 3300053153 | Bacteria | 44254 |
| 398 | Ga0500624_000776 | 3300053157 | Bacteria | 7557 |
| 399 | Ga0500627_0007993 | 3300053158 | Bacteria | 3728 |
| 400 | Ga0500634_0002607 | 3300053161 | Bacteria | 7670 |
| 401 | Ga0500636_0039826 | 3300053177 | Bacteria | 2780 |
| 402 | Ga0500611_003527 | 3300053727 | Bacteria | 2015 |
| 403 | Ga0500645_004768 | 3300053730 | Bacteria | 5132 |
| 404 | Ga0501082_0145772 | 3300060353 | Bacteria | 2055 |
| 405 | Ga0501082_0377170 | 3300060353 | Bacteria | 1237 |
| 406 | 2509076505 | 2508501114 | Bacteria | 7082538 |
| 407 | 2511245294 | 2511231002 | Bacteria | 5042903 |
| 408 | 2511380870 | 2511231025 | Bacteria | 5324661 |
| 409 | 2511436779 | 2511231035 | Bacteria | 5341610 |
| 410 | 2514587037 | 2513237351 | Bacteria | 6968952 |
| 411 | 2561467997 | 2558860983 | Bacteria | 4133860 |
| 412 | 2585277904 | 2582581308 | Bacteria | 7413247 |
| 413 | 2585326850 | 2582581315 | Bacteria | 7318924 |
| 414 | 2585332526 | 2582581316 | Bacteria | 7774528 |
| 415 | 2585533232 | 2585427527 | Bacteria | 7273426 |
| 416 | 2585555653 | 2585427530 | Bacteria | 7383882 |
| 417 | 2585828527 | 2585427591 | Bacteria | 5482980 |
| 418 | 2585832929 | 2585427592 | Bacteria | 5370892 |
| 419 | 2586000578 | 2585427634 | Bacteria | 6455027 |
| 420 | 2616309173 | 2615840626 | Bacteria | 7921970 |
| 421 | 2617381182 | 2617270742 | Bacteria | 6808054 |
| 422 | 2644104353 | 2643221618 | Bacteria | 7717186 |
| 423 | 2644147551 | 2643221626 | Bacteria | 8069654 |
| 424 | 2644313346 | 2643221655 | Bacteria | 7722067 |
| 425 | 2644331649 | 2643221659 | Bacteria | 7890716 |
| 426 | 2644541819 | 2643221698 | Bacteria | 7756764 |
| 427 | 2644612971 | 2643221712 | Bacteria | 7729434 |
| 428 | 2671110079 | 2667528173 | Bacteria | 5375747 |
| 429 | 2707101564 | 2706794495 | Bacteria | 4536932 |
| 430 | 2715500377 | 2713897090 | Bacteria | 3353799 |
| 431 | 2765463880 | 2765235802 | Bacteria | 5618596 |
| 432 | 2776269010 | 2775506902 | Bacteria | 6208009 |
| 433 | 2776283853 | 2775506904 | Bacteria | 5954060 |
| 434 | 2778175261 | 2775507266 | Bacteria | 7392367 |
| 435 | 2792581517 | 2791355082 | Bacteria | 5973319 |
| 436 | 2819641863 | 2818991453 | Bacteria | 7181617 |
| 437 | 2819683635 | 2818991461 | Bacteria | 7026071 |
| 438 | 2821126542 | 2821123053 | Bacteria | 7836056 |
| 439 | 2838675362 | 2838675328 | Bacteria | 4909118 |
| 440 | 2838714243 | 2838714209 | Bacteria | 5525906 |
| 441 | 2838721955 | 2838719591 | Bacteria | 5523910 |
| 442 | 2838725004 | 2838724970 | Bacteria | 4908691 |
| 443 | 2838736983 | 2838736955 | Bacteria | 5760694 |
| 444 | 2839993833 | 2839993093 | Bacteria | 5512535 |
| 445 | 2841842648 | 2841840854 | Bacteria | 5761912 |
| 446 | 2841848934 | 2841846520 | Bacteria | 5345850 |
| 447 | 2842125035 | 2842124991 | Bacteria | 5346824 |
| 448 | 2842130257 | 2842130223 | Bacteria | 4909145 |
| 449 | 2842142428 | 2842140634 | Bacteria | 5759631 |
| 450 | 2842154573 | 2842152218 | Bacteria | 4908957 |
| 451 | 2842170486 | 2842170452 | Bacteria | 5525737 |
| 452 | 2842178193 | 2842175837 | Bacteria | 4908771 |
| 453 | 2842187352 | 2842187318 | Bacteria | 5524014 |
| 454 | 2842211663 | 2842211629 | Bacteria | 5523832 |
| 455 | 2842226717 | 2842224351 | Bacteria | 5524473 |
| 456 | 2842486839 | 2842482326 | Bacteria | 7212537 |
| 457 | 2842777113 | 2842775625 | Bacteria | 5587290 |
| 458 | 2844167101 | 2844163670 | Bacteria | 7266046 |
| 459 | 2854603711 | 2854601825 | Bacteria | 4797592 |
| 460 | 2854916447 | 2854911287 | Bacteria | 5582813 |
| 461 | 2857533104 | 2857531043 | Bacteria | 6754041 |
| 462 | 2876601763 | 2876601092 | Bacteria | 5114497 |
| 463 | 2883294861 | 2883291878 | Bacteria | 5894118 |
| 464 | 2883356653 | 2883354860 | Bacteria | 5865246 |
| 465 | 2884301217 | 2884298095 | Bacteria | 3823049 |
| 466 | 2891049054 | 2891048133 | Bacteria | 4447501 |
| 467 | 2899275830 | 2899275550 | Bacteria | 3958688 |
| 468 | 2904477086 | 2904474040 | Bacteria | 5504324 |
| 469 | 2904508688 | 2904504865 | Bacteria | 5152820 |
| 470 | 2904579479 | 2904578770 | Bacteria | 5302906 |
| 471 | 2915652661 | 2915650412 | Bacteria | 4288180 |
| 472 | 2919114274 | 2919114240 | Bacteria | 5700270 |
| 473 | 2919120854 | 2919119836 | Bacteria | 5208557 |
| 474 | 2919153253 | 2919150387 | Bacteria | 5500879 |
| 475 | 2919172771 | 2919171160 | Bacteria | 6499771 |
| 476 | 2926755294 | 2926754445 | Bacteria | 5964435 |
| 477 | 2927143879 | 2927143783 | Bacteria | 5504251 |
| 478 | 2928522280 | 2928521798 | Bacteria | 4960112 |
| 479 | 2929144074 | 2929138655 | Bacteria | 5810547 |
| 480 | 2933009218 | 2933006813 | Bacteria | 4912075 |
| 481 | 2941504251 | 2941499720 | Bacteria | 7599444 |
| 482 | 2954014295 | 2954011201 | Bacteria | 4762601 |
| 483 | 8005661683 | 8005658619 | Bacteria | 4500593 |
| 484 | 8016733960 | 8016733728 | Bacteria | 5274317 |
| 485 | 8019504541 | 8019499862 | Bacteria | 5169538 |
| 486 | 8049295598 | 8049293176 | Bacteria | 6128433 |
| 487 | 8055431960 | 8055431914 | Bacteria | 4551896 |
| 488 | 8057134069 | 8057132660 | Bacteria | 4061191 |
| 489 | Ga0097621_100011117 | |||
| 490 | SwRhRL2b_contig_478082 | |||
| 491 | JGI25162J39368_1000092 | |||
| 492 | JGI25162J39368_1000675 | |||
| 493 | JGI25163J39215_1000013 | |||
| 494 | JGI25164J39214_1000071 | |||
| 495 | JGI25159J45721_1000407 | |||
| 496 | JGI25151J46595_10017735 | |||
| 497 | JGI25165J46597_1000398 | |||
| 498 | JGI25165J46597_1002788 | |||
| 499 | rootH1_10194219 | |||
| 500 | JGI25160J50197_1000172 | |||
| 501 | JGI25161J50226_1000007 | |||
| 502 | Ga0055538_1000064 | |||
| 503 | Ga0055539_1000098 | |||
| 504 | Ga0055533_1000108 | |||
| 505 | Ga0055525_1000141 | |||
| 506 | Ga0055526_1003566 | |||
| 507 | Ga0055536_1005157 | |||
| 508 | Ga0055536_1009577 | |||
| 509 | Ga0055530_10000763 | |||
| 510 | Ga0055530_10001299 | |||
| 511 | Ga0055540_1000504 | |||
| 512 | Ga0055540_1002428 | |||
| 513 | Ga0055531_10003215 | |||
| 514 | Ga0055531_10004306 | |||
| 515 | Ga0055541_1000065 | |||
| 516 | Ga0058692_1000171 | |||
| 517 | Ga0058692_1000679 | |||
| 518 | Ga0058692_1002252 | |||
| 519 | Ga0055543_1011070 | |||
| 520 | Ga0065165_1018011 | |||
| 521 | Ga0065165_1027467 | |||
| 522 | Ga0065165_1037185 | |||
| 523 | Ga0065704_10000032 | |||
| 524 | Ga0070670_100004009 | |||
| 525 | Ga0070670_100004917 | |||
| 526 | Ga0070670_100024623 | |||
| 527 | Ga0070670_100071595 | |||
| 528 | Ga0070677_10058845 | |||
| 529 | Ga0068869_100000007 | |||
| 530 | Ga0070680_100014122 | |||
| 531 | Ga0068868_100497731 | |||
| 532 | Ga0070689_100131032 | |||
| 533 | Ga0070668_100005002 | |||
| 534 | Ga0070668_100010303 | |||
| 535 | Ga0070668_100070008 | |||
| 536 | Ga0070669_100009394 | |||
| 537 | Ga0070669_100031327 | |||
| 538 | Ga0070669_100081349 | |||
| 539 | Ga0070669_100202647 | |||
| 540 | Ga0070675_100008830 | |||
| 541 | Ga0070675_100008944 | |||
| 542 | Ga0070674_100110942 | |||
| 543 | Ga0070673_100005812 | |||
| 544 | Ga0070673_100044158 | |||
| 545 | Ga0070673_100115291 | |||
| 546 | Ga0070673_100136030 | |||
| 547 | Ga0070667_100001939 | |||
| 548 | Ga0070667_100033931 | |||
| 549 | Ga0070667_100086660 | |||
| 550 | Ga0070709_10147855 | |||
| 551 | Ga0070709_10242786 | |||
| 552 | Ga0070705_100069014 | |||
| 553 | Ga0070700_100291104 | |||
| 554 | Ga0070678_100178204 | |||
| 555 | Ga0070662_100032281 | |||
| 556 | Ga0070662_100066591 | |||
| 557 | Ga0070681_10051171 | |||
| 558 | Ga0070681_10170879 | |||
| 559 | Ga0068867_100035038 | |||
| 560 | Ga0068867_100130131 | |||
| 561 | Ga0070679_100090856 | |||
| 562 | Ga0070672_100024379 | |||
| 563 | Ga0070672_100055134 | |||
| 564 | Ga0070672_100144065 | |||
| 565 | Ga0070686_100109638 | |||
| 566 | Ga0070696_100602262 | |||
| 567 | Ga0070665_100209853 | |||
| 568 | Ga0070665_100307093 | |||
| 569 | Ga0070704_100149449 | |||
| 570 | Ga0068855_100007441 | |||
| 571 | Ga0068855_100089487 | |||
| 572 | Ga0068855_100446394 | |||
| 573 | Ga0070664_100291025 | |||
| 574 | Ga0068857_100000676 | |||
| 575 | Ga0068854_100175485 | |||
| 576 | Ga0068852_100332330 | |||
| 577 | Ga0068852_100563961 | |||
| 578 | Ga0068859_100003514 | |||
| 579 | Ga0068864_100001466 | |||
| 580 | Ga0068864_100018957 | |||
| 581 | Ga0068864_100031537 | |||
| 582 | Ga0068861_100001688 | |||
| 583 | Ga0068861_100075375 | |||
| 584 | Ga0068861_100354798 | |||
| 585 | Ga0068870_10068447 | |||
| 586 | Ga0068863_100001574 | |||
| 587 | Ga0068863_100010047 | |||
| 588 | Ga0068858_100013010 | |||
| 589 | Ga0068858_100332144 | |||
| 590 | Ga0068858_100370102 | |||
| 591 | Ga0068860_100005878 | |||
| 592 | Ga0068860_100073368 | |||
| 593 | Ga0068860_100074894 | |||
| 594 | Ga0068860_100113446 | |||
| 595 | Ga0068860_100252183 | |||
| 596 | Ga0068862_100002922 | |||
| 597 | Ga0068862_100018133 | |||
| 598 | Ga0075363_100109893 | |||
| 599 | Ga0075364_10000309 | |||
| 600 | Ga0075364_10007527 | |||
| 601 | Ga0075364_10118036 | |||
| 602 | Ga0075364_10139922 | |||
| 603 | Ga0097621_100341607 | |||
| 604 | Ga0068871_100060006 | |||
| 605 | Ga0068871_100237404 | |||
| 606 | Ga0068865_100315353 | |||
| 607 | Ga0097620_100003514 | |||
| 608 | Ga0079104_1000230 | |||
| 609 | Ga0099826_10003742 | |||
| 610 | Ga0105251_10025854 | |||
| 611 | Ga0105244_10000798 | |||
| 612 | Ga0105244_10018475 | |||
| 613 | Ga0105250_10000002 | |||
| 614 | Ga0105250_10004268 | |||
| 615 | Ga0105240_10000097 | |||
| 616 | Ga0105245_10358753 | |||
| 617 | Ga0105248_10001664 | |||
| 618 | Ga0105248_10024292 | |||
| 619 | Ga0105248_10049509 | |||
| 620 | Ga0105248_10304263 | |||
| 621 | Ga0105248_10861788 | |||
| 622 | Ga0105237_10001364 | |||
| 623 | Ga0105238_10045331 | |||
| 624 | Ga0105249_10104647 | |||
| 625 | Ga0105239_10000258 | |||
| 626 | Ga0157373_10000189 | |||
| 627 | Ga0157371_10000008 | |||
| 628 | Ga0157371_10006536 | |||
| 629 | Ga0157370_10178722 | |||
| 630 | Ga0157369_10353027 | |||
| 631 | Ga0163162_10045639 | |||
| 632 | Ga0163162_10107547 | |||
| 633 | Ga0163162_10211508 | |||
| 634 | Ga0157375_10001469 | |||
| 635 | Ga0157375_10165655 | |||
| 636 | Ga0157375_10306556 | |||
| 637 | Ga0163163_10001547 | |||
| 638 | Ga0163163_10036645 | |||
| 639 | Ga0163163_10267306 | |||
| 640 | Ga0157380_10265672 | |||
| 641 | Ga0157379_10000142 | |||
| 642 | Ga0157379_10372149 | |||
| 643 | Ga0157376_10029249 | |||
| 644 | Ga0157376_10746754 | |||
| 645 | Ga0209760_100078 | |||
| 646 | Ga0209436_107041 | |||
| 647 | Ga0209784_100001 | |||
| 648 | Ga0209566_100001 | |||
| 649 | Ga0209674_100002 | |||
| 650 | Ga0209563_100002 | |||
| 651 | Ga0207427_100020 | |||
| 652 | Ga0209437_100001 | |||
| 653 | Ga0209437_100042 | |||
| 654 | Ga0209437_105280 | |||
| 655 | Ga0207425_1001535 | |||
| 656 | Ga0209677_100002 | |||
| 657 | Ga0209677_100172 | |||
| 658 | Ga0209233_1000054 | |||
| 659 | Ga0209233_1000218 | |||
| 660 | Ga0209233_1000956 | |||
| 661 | Ga0209565_1000333 | |||
| 662 | Ga0209130_1000245 | |||
| 663 | Ga0209130_1000708 | |||
| 664 | Ga0209675_1003873 | |||
| 665 | Ga0209676_1000013 | |||
| 666 | Ga0209676_1003354 | |||
| 667 | Ga0209676_1014480 | |||
| 668 | Ga0209025_1004718 | |||
| 669 | Ga0209025_1009265 | |||
| 670 | Ga0209025_1010428 | |||
| 671 | Ga0209564_1002543 | |||
| 672 | Ga0209564_1051481 | |||
| 673 | Ga0209758_1000341 | |||
| 674 | Ga0209050_1000008 | |||
| 675 | Ga0209050_1001244 | |||
| 676 | Ga0209050_1015111 | |||
| 677 | Ga0209050_1020339 | |||
| 678 | Ga0207426_1000091 | |||
| 679 | Ga0207426_1005778 | |||
| 680 | Ga0209051_1000005 | |||
| 681 | Ga0209051_1002584 | |||
| 682 | Ga0209257_1000048 | |||
| 683 | Ga0209257_1003097 | |||
| 684 | Ga0207696_1000239 | |||
| 685 | Ga0207696_1000390 | |||
| 686 | Ga0207696_1001181 | |||
| 687 | Ga0207655_1007482 | |||
| 688 | Ga0207655_1020750 | |||
| 689 | Ga0207682_10033201 | |||
| 690 | Ga0207699_10044524 | |||
| 691 | Ga0207699_10092477 | |||
| 692 | Ga0207645_10009537 | |||
| 693 | Ga0207645_10085566 | |||
| 694 | Ga0207643_10065858 | |||
| 695 | Ga0207707_10316847 | |||
| 696 | Ga0207695_10000187 | |||
| 697 | Ga0207671_10001438 | |||
| 698 | Ga0207681_10095331 | |||
| 699 | Ga0207681_10115306 | |||
| 700 | Ga0207681_10154774 | |||
| 701 | Ga0207694_10146995 | |||
| 702 | Ga0207650_10024013 | |||
| 703 | Ga0207650_10054175 | |||
| 704 | Ga0207650_10095453 | |||
| 705 | Ga0207650_10135639 | |||
| 706 | Ga0207650_10139975 | |||
| 707 | Ga0207659_10016896 | |||
| 708 | Ga0207706_10008309 | |||
| 709 | Ga0207706_10047586 | |||
| 710 | Ga0207686_10192554 | |||
| 711 | Ga0207670_10260325 | |||
| 712 | Ga0207669_10137330 | |||
| 713 | Ga0207691_10000111 | |||
| 714 | Ga0207711_10041717 | |||
| 715 | Ga0207711_10122206 | |||
| 716 | Ga0207689_10000142 | |||
| 717 | Ga0207667_10018605 | |||
| 718 | Ga0207651_10123230 | |||
| 719 | Ga0207651_10518521 | |||
| 720 | Ga0207668_10013845 | |||
| 721 | Ga0207668_10015772 | |||
| 722 | Ga0207658_10067054 | |||
| 723 | Ga0207658_10094652 | |||
| 724 | Ga0207677_10224328 | |||
| 725 | Ga0207703_10000195 | |||
| 726 | Ga0207639_10383123 | |||
| 727 | Ga0207702_10349260 | |||
| 728 | Ga0207641_10018427 | |||
| 729 | Ga0207641_10207885 | |||
| 730 | Ga0207648_10016833 | |||
| 731 | Ga0207648_10581497 | |||
| 732 | Ga0207676_10001696 | |||
| 733 | Ga0207676_10002462 | |||
| 734 | Ga0207676_10108092 | |||
| 735 | Ga0207674_10002098 | |||
| 736 | Ga0207675_100004037 | |||
| 737 | Ga0207675_100050221 | |||
| 738 | Ga0207675_100129573 | |||
| 739 | Ga0207683_10026873 | |||
| 740 | Ga0207683_10354885 | |||
| 741 | Ga0207698_10380201 | |||
| 742 | Ga0209281_1000179 | |||
| 743 | Ga0209371_1000417 | |||
| 744 | Ga0209371_1000830 | |||
| 745 | Ga0209282_1012967 | |||
| 746 | Ga0268265_10002425 | |||
| 747 | Ga0268264_10000606 | |||
| 748 | Ga0268264_10057162 | |||
| 749 | Ga0268264_10196698 | |||
| 750 | Ga0268264_10213045 | |||
| 751 | Ga0307515_10057315 | |||
| 752 | Ga0268256_1000202 | |||
| 753 | Ga0268256_1003757 | |||
| 754 | Ga0316181_1033551 | |||
| 755 | Ga0265339_10050302 | |||
| 756 | Ga0265331_10007054 | |||
| 757 | Ga0265316_10373113 | |||
| 758 | Ga0307513_10000206 | |||
| 759 | Ga0265313_10000021 | |||
| 760 | Ga0316576_10018776 | |||
| 761 | Ga0307413_10141381 | |||
| 762 | Ga0307410_10185745 | |||
| 763 | Ga0307409_100500388 | |||
| 764 | Ga0307416_100086679 | |||
| 765 | Ga0307415_100267398 | |||
| 766 | Ga0373927_0035055 | |||
| 767 | Ga0373933_0287633 | |||
| 768 | Ga0316584_0100544 | |||
| 769 | Ga0316584_0302134 | |||
| 770 | Ga0395899_0000589 | |||
| 771 | Ga0395900_0000375 | |||
| 772 | Ga0395898_0000629 | |||
| 773 | Ga0395905_0000361 | |||
| 774 | Ga0395901_0000273 | |||
| 775 | Ga0436365_0009921 | |||
| 776 | Ga0436360_0657748 | |||
| 777 | Ga0495617_008308 | |||
| 778 | Ga0495591_000111 | |||
| 779 | Ga0495591_002389 | |||
| 780 | Ga0495650_0000043 | |||
| 781 | Ga0495580_0003875 | |||
| 782 | Ga0495605_0193258 | |||
| 783 | Ga0495607_0146249 | |||
| 784 | Ga0495606_0001398 | |||
| 785 | Ga0495616_0042943 | |||
| 786 | Ga0495631_0141056 | |||
| 787 | Ga0495643_0029652 | |||
| 788 | Ga0495648_0009512 | |||
| 789 | Ga0495654_0000147 | |||
| 790 | Ga0495654_0000250 | |||
| 791 | Ga0495654_0003284 | |||
| 792 | Ga0495668_0005994 | |||
| 793 | Ga0495625_0119943 | |||
| 794 | Ga0495588_0001469 | |||
| 795 | Ga0495671_0002319 | |||
| 796 | Ga0495649_0022825 | |||
| 797 | Ga0495589_0017398 | |||
| 798 | Ga0495660_0000012 | |||
| 799 | Ga0495660_0000020 | |||
| 800 | Ga0495672_0000011 | |||
| 801 | Ga0495680_0267401 | |||
| 802 | Ga0495683_0022959 | |||
| 803 | Ga0495673_0000020 | |||
| 804 | Ga0495681_0027166 | |||
| 805 | Ga0495686_0009938 | |||
| 806 | Ga0496100_0000286 | |||
| 807 | Ga0496100_0087102 | |||
| 808 | Ga0496101_0000164 | |||
| 809 | Ga0496101_0116726 | |||
| 810 | Ga0496102_0001007 | |||
| 811 | Ga0496103_0009151 | |||
| 812 | Ga0496104_0014452 | |||
| 813 | Ga0496106_0069435 | |||
| 814 | Ga0496108_0179310 | |||
| 815 | Ga0496116_0000066 | |||
| 816 | Ga0496116_0023132 | |||
| 817 | Ga0496116_0094523 | |||
| 818 | Ga0496117_0000997 | |||
| 819 | Ga0496117_0002474 | |||
| 820 | Ga0496117_0009777 | |||
| 821 | Ga0496118_0001178 | |||
| 822 | Ga0496118_0005581 | |||
| 823 | Ga0496118_0008115 | |||
| 824 | Ga0496118_0056669 | |||
| 825 | Ga0496118_0193894 | |||
| 826 | Ga0496119_0012240 | |||
| 827 | Ga0496119_0018206 | |||
| 828 | Ga0496119_0023643 | |||
| 829 | Ga0496119_0031778 | |||
| 830 | Ga0496120_0001859 | |||
| 831 | Ga0496120_0010251 | |||
| 832 | Ga0496120_0044838 | |||
| 833 | Ga0496121_0000033 | |||
| 834 | Ga0496121_0000084 | |||
| 835 | Ga0496121_0000216 | |||
| 836 | Ga0496121_0005558 | |||
| 837 | Ga0496122_0000110 | |||
| 838 | Ga0496122_0002781 | |||
| 839 | Ga0496122_0011709 | |||
| 840 | Ga0496123_0000081 | |||
| 841 | Ga0496123_0002476 | |||
| 842 | Ga0496123_0030641 | |||
| 843 | Ga0496123_0052200 | |||
| 844 | Ga0496124_0000066 | |||
| 845 | Ga0496124_0008929 | |||
| 846 | Ga0496124_0018729 | |||
| 847 | Ga0496124_0020408 | |||
| 848 | Ga0496124_0073191 | |||
| 849 | Ga0496124_0161115 | |||
| 850 | Ga0496125_0000033 | |||
| 851 | Ga0496125_0000218 | |||
| 852 | Ga0496125_0002983 | |||
| 853 | Ga0496126_0000420 | |||
| 854 | Ga0496126_0027736 | |||
| 855 | Ga0496126_0065937 | |||
| 856 | Ga0495678_000551 | |||
| 857 | Ga0495678_041843 | |||
| 858 | Ga0495682_0000005 | |||
| 859 | Ga0501032_0105053 | |||
| 860 | Ga0501033_0048133 | |||
| 861 | Ga0501034_0425400 | |||
| 862 | Ga0501038_0058174 | |||
| 863 | Ga0501039_0054997 | |||
| 864 | Ga0501083_0002976 | |||
| 865 | Ga0501035_0240839 | |||
| 866 | nmdc:mga00v17_104_c1 | |||
| 867 | nmdc:mga00v17_109618_c1 | |||
| 868 | nmdc:mga00v17_7500_c1 | |||
| 869 | nmdc:mga00v17_95488_c1 | |||
| 870 | nmdc:mga07m45_252781_c1 | |||
| 871 | nmdc:mga0sz30_60112_c1 | |||
| 872 | Ga0500650_0114579 | |||
| 873 | Ga0500593_000456 | |||
| 874 | Ga0500607_106720 | |||
| 875 | Ga0500618_000008 | |||
| 876 | Ga0500618_000122 | |||
| 877 | Ga0500618_001174 | |||
| 878 | Ga0500618_028116 | |||
| 879 | Ga0500618_057580 | |||
| 880 | Ga0500621_000014 | |||
| 881 | Ga0500568_0000116 | |||
| 882 | Ga0500573_0001480 | |||
| 883 | Ga0500573_0007401 | |||
| 884 | Ga0500586_060140 | |||
| 885 | Ga0500616_0000587 | |||
| 886 | Ga0500624_000776 | |||
| 887 | Ga0500627_0007993 | |||
| 888 | Ga0500634_0002607 | |||
| 889 | Ga0500636_0039826 | |||
| 890 | Ga0500611_003527 | |||
| 891 | Ga0500645_004768 | |||
| 892 | Ga0501082_0145772 | |||
| 893 | Ga0501082_0377170 | |||
| 894 | 2509076505 | |||
| 895 | 2511245294 | |||
| 896 | 2511380870 | |||
| 897 | 2511436779 | |||
| 898 | 2514587037 | |||
| 899 | 2561467997 | |||
| 900 | 2585277904 | |||
| 901 | 2585326850 | |||
| 902 | 2585332526 | |||
| 903 | 2585533232 | |||
| 904 | 2585555653 | |||
| 905 | 2585828527 | |||
| 906 | 2585832929 | |||
| 907 | 2586000578 | |||
| 908 | 2616309173 | |||
| 909 | 2617381182 | |||
| 910 | 2644104353 | |||
| 911 | 2644147551 | |||
| 912 | 2644313346 | |||
| 913 | 2644331649 | |||
| 914 | 2644541819 | |||
| 915 | 2644612971 | |||
| 916 | 2671110079 | |||
| 917 | 2707101564 | |||
| 918 | 2715500377 | |||
| 919 | 2765463880 | |||
| 920 | 2776269010 | |||
| 921 | 2776283853 | |||
| 922 | 2778175261 | |||
| 923 | 2792581517 | |||
| 924 | 2819641863 | |||
| 925 | 2819683635 | |||
| 926 | 2821126542 | |||
| 927 | 2838675362 | |||
| 928 | 2838714243 | |||
| 929 | 2838721955 | |||
| 930 | 2838725004 | |||
| 931 | 2838736983 | |||
| 932 | 2839993833 | |||
| 933 | 2841842648 | |||
| 934 | 2841848934 | |||
| 935 | 2842125035 | |||
| 936 | 2842130257 | |||
| 937 | 2842142428 | |||
| 938 | 2842154573 | |||
| 939 | 2842170486 | |||
| 940 | 2842178193 | |||
| 941 | 2842187352 | |||
| 942 | 2842211663 | |||
| 943 | 2842226717 | |||
| 944 | 2842486839 | |||
| 945 | 2842777113 | |||
| 946 | 2844167101 | |||
| 947 | 2854603711 | |||
| 948 | 2854916447 | |||
| 949 | 2857533104 | |||
| 950 | 2876601763 | |||
| 951 | 2883294861 | |||
| 952 | 2883356653 | |||
| 953 | 2884301217 | |||
| 954 | 2891049054 | |||
| 955 | 2899275830 | |||
| 956 | 2904477086 | |||
| 957 | 2904508688 | |||
| 958 | 2904579479 | |||
| 959 | 2915652661 | |||
| 960 | 2919114274 | |||
| 961 | 2919120854 | |||
| 962 | 2919153253 | |||
| 963 | 2919172771 | |||
| 964 | 2926755294 | |||
| 965 | 2927143879 | |||
| 966 | 2928522280 | |||
| 967 | 2929144074 | |||
| 968 | 2933009218 | |||
| 969 | 2941504251 | |||
| 970 | 2954014295 | |||
| 971 | 8005661683 | |||
| 972 | 8016733960 | |||
| 973 | 8019504541 | |||
| 974 | 8049295598 | |||
| 975 | 8055431960 | |||
| 976 | 8057134069 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7z19-assembly1.cif.gz_I | e. coli c-p lyase bound to a single phnk abc domain | 0.9346 | 17 | 253 |
| 7z17-assembly1.cif.gz_J | e. coli c-p lyase bound to a phnk abc dimer in an open conformation | 0.9311 | 17 | 254 |
| 4jbw-assembly1.cif.gz_A | crystal structure of e. coli maltose transporter malfgk2 in complex with its regulatory protein eiiaglc | 0.9301 | 15 | 237 |
| 7ahe-assembly1.cif.gz_C | opua inhibited inward facing | 0.9237 | 16 | 252 |
| 4tqu-assembly1.cif.gz_T | crystal structure of a bacterial abc transporter involved in the import of the acidic polysaccharide alginate | 0.922 | 15 | 237 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2G1F8_275_530_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9592 | 17 | 252 | 3.40.50.300 |
| af_O69724_1_242_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9449 | 17 | 251 | 3.40.50.300 |
| af_P75796_311_605_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.938 | 17 | 252 | 3.40.50.300 |
| af_I6Y482_6_279_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9377 | 17 | 257 | 3.40.50.300 |
| af_Q9XW49_1237_1482_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9366 | 12 | 239 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7W2BRZ0-F1-model_v4 | deleted | 0.9647 | 15 | 260 |
|
| AF-A0A174VRL1-F1-model_v4 | ABC transporter ATP-binding protein (Methionine import ATP-binding protein MetN (EC 3.6.3.-)) | 0.9591 | 17 | 234 |
GO:0005524
GO:0016887 GO:0055085 |
| AF-A0A366IF50-F1-model_v4 | Peptide/nickel transport system ATP-binding protein/oligopeptide transport system ATP-binding protein | 0.9581 | 17 | 252 |
GO:0005524
GO:0015833 GO:0016887 GO:0055085 |
| AF-A0A5D4LZT8-F1-model_v4 | ABC transporter ATP-binding protein | 0.9555 | 14 | 252 |
GO:0005524
GO:0015833 GO:0016887 GO:0055085 |
| AF-A0A1Q7CRB0-F1-model_v4 | Peptide ABC transporter substrate-binding protein | 0.9536 | 17 | 252 |
GO:0005524
GO:0015833 GO:0016887 GO:0055085 |