F453584

General Info

Members Datasets Scaffolds Average Seq Length
488 330 976 257

Family's Representative Sequence

Representative Sequence 3300006237|Ga0097621_100011117|Ga0097621_1000111172
Length 297
Sequence MSTAGPPKSAQLHAASGGSAAVELANEAASLGAHQSRVGIEARHLRVTYDHFVAVADTSLAVAAGESFGIVGESGSGKSTVLRALCGLVPAGAGTIRLVANAEQGIEAARASQSLPAPGTKAFRRLVQMVFQDPYGSLHPRQTVDRILAEPLAIHGIADAESRIEQALDEVGLGTGFRFRYPHQLSGGQRQRIAVARALILEPQVLLLDEPTSSLDASVQAEVLNLLEDLRRRRGLTFIMVSHDLAVVTHLCDRLMVMQRGETVELVSSADLASSRVTHDYTRQLMDASIGFRRRAA

Samples

Sample ID Description Type Environment
1 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
4 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
5 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
6 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
7 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
8 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
11 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
12 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
13 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
14 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
15 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
16 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
17 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
18 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
19 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
20 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
21 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
22 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
23 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
24 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
25 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
26 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
27 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
28 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
29 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
30 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
31 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
32 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
33 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
34 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
35 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
36 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
39 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
40 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
65 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
70 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
71 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
72 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
73 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
82 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
83 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
84 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
92 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
93 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
98 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
99 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
100 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
102 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
103 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
104 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
105 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
107 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
108 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
109 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
111 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
149 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
151 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
154 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
155 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
156 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
157 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
158 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
159 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
160 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
161 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
162 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
163 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
164 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
165 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
166 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
167 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
168 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
169 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
170 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
171 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
172 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
173 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
174 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
175 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
176 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
177 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
178 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
179 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
180 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
181 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
182 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
183 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
184 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
185 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
186 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
187 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
188 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
189 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
190 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
191 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
192 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
193 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
194 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
195 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
196 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
197 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
198 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
199 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
200 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
201 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
202 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
203 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
204 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
205 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
206 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
207 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
208 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
209 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
210 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
211 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
212 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
213 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
214 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
215 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
216 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
217 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
218 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
219 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
220 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
221 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
222 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
228 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
229 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
230 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
231 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
232 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
233 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
234 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
235 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
236 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
237 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
238 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
239 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
240 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
241 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
242 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
243 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
244 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
245 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
246 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
247 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
248 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
249 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
250 2511231025 Pantoea sp. YR343 Isolate Rhizosphere
251 2511231035 Pantoea sp. GM01 Isolate Rhizosphere
252 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
253 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
254 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
255 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
256 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
257 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
258 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
259 2585427591 Rahnella aquatilis OV744 Isolate Rhizosphere
260 2585427592 Rahnella aquatilis OV588 Isolate Rhizosphere
261 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
262 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
263 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
264 2643221618 Ensifer sp. Root231 Isolate Unclassified
265 2643221626 Ensifer sp. Root31 Isolate Unclassified
266 2643221655 Ensifer sp. Root1252 Isolate Unclassified
267 2643221659 Ensifer sp. Root127 Isolate Unclassified
268 2643221698 Ensifer sp. Root142 Isolate Unclassified
269 2643221712 Ensifer sp. Root258 Isolate Unclassified
270 2667528173 Rahnella sp. NFIX50 Isolate Rhizoplane
271 2706794495 Dickeya zeae ZJU1202 Isolate Unclassified
272 2713897090 Paracoccus sphaerophysae HAMBI 3106 Isolate Nodule
273 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
274 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
275 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
276 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
277 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
278 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
279 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
280 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
281 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
282 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
283 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
284 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
285 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
286 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
287 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
288 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
289 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
290 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
291 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
292 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
293 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
294 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
295 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
296 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
297 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
298 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
299 2842775625 Roseomonas sp. R-71825 Isolate Unclassified
300 2844163670 Ensifer sp. 1H6 Isolate Unclassified
301 2854601825 Dickeya dianthicola SS70 Isolate Stem Tuber
302 2854911287 Brucella lupini LUP21 Isolate Unclassified
303 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
304 2876601092 Pantoea endophytica 596 Isolate Unclassified
305 2883291878 Hypericibacter terrae R5913 Isolate Rhizosphere
306 2883354860 Hypericibacter adhaerens R5959 Isolate Rhizosphere
307 2884298095 Microvirga thermotolerans HR1 Isolate Rhizosphere
308 2891048133 Martelella lutilitoris GH2-6 Isolate Rhizosphere
309 2899275550 Paracoccus hibiscisoli CCTCC AB2016182 Isolate Rhizosphere
310 2904474040 Rahnella aquatilis 4485 Isolate Rhizosphere
311 2904504865 Serratia marcescens 1822 Isolate Unclassified
312 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
313 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
314 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
315 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
316 2919150387 Rahnella aceris 1817 Isolate Unclassified
317 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
318 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
319 2927143783 Rahnella sp. 2050 Isolate Unclassified
320 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
321 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
322 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
323 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
324 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
325 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
326 8016733728 Pantoea sp. SORGH_AS 659 Isolate Unclassified
327 8019499862 Kluyvera sp. 1366 Isolate Rhizosphere
328 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
329 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
330 8057132660 Paracoccus rhizosphaerae LMG 21293 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 82.99
Metatranscriptomes 0
Isolates 17.01

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 20.08
Nodule 6.15
Rhizoplane 2.46
Rhizosphere 56.15
Stem 0
Stem Tuber 0.2
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0097621_100011117 3300006237 Bacteria 6621
2 SwRhRL2b_contig_478082 2162886007 Bacteria 3137
3 JGI25162J39368_1000092 3300002737 Bacteria 100905
4 JGI25162J39368_1000675 3300002737 Bacteria 23944
5 JGI25163J39215_1000013 3300002771 Bacteria 86331
6 JGI25164J39214_1000071 3300002772 Bacteria 100905
7 JGI25159J45721_1000407 3300002987 Bacteria 19965
8 JGI25151J46595_10017735 3300003187 Bacteria 3077
9 JGI25165J46597_1000398 3300003214 Bacteria 45980
10 JGI25165J46597_1002788 3300003214 Bacteria 5066
11 rootH1_10194219 3300003323 Bacteria 2368
12 JGI25160J50197_1000172 3300003354 Bacteria 55781
13 JGI25161J50226_1000007 3300003374 Bacteria 256181
14 Ga0055538_1000064 3300003751 Bacteria 100905
15 Ga0055539_1000098 3300003752 Bacteria 100905
16 Ga0055533_1000108 3300003756 Bacteria 100905
17 Ga0055525_1000141 3300003759 Bacteria 100905
18 Ga0055526_1003566 3300003771 Bacteria 9799
19 Ga0055536_1005157 3300003781 Bacteria 6459
20 Ga0055536_1009577 3300003781 Bacteria 3980
21 Ga0055530_10000763 3300003791 Bacteria 26793
22 Ga0055530_10001299 3300003791 Bacteria 18844
23 Ga0055540_1000504 3300003792 Bacteria 29761
24 Ga0055540_1002428 3300003792 Bacteria 9845
25 Ga0055531_10003215 3300003794 Bacteria 10487
26 Ga0055531_10004306 3300003794 Bacteria 8724
27 Ga0055541_1000065 3300003841 Bacteria 100905
28 Ga0058692_1000171 3300003856 Bacteria 40209
29 Ga0058692_1000679 3300003856 Bacteria 14026
30 Ga0058692_1002252 3300003856 Bacteria 6551
31 Ga0055543_1011070 3300004625 Bacteria 1863
32 Ga0065165_1018011 3300005262 Bacteria 2577
33 Ga0065165_1027467 3300005262 Bacteria 1855
34 Ga0065165_1037185 3300005262 Bacteria 1477
35 Ga0065704_10000032 3300005289 Bacteria 15316
36 Ga0070670_100004009 3300005331 Bacteria 12288
37 Ga0070670_100004917 3300005331 Bacteria 11246
38 Ga0070670_100024623 3300005331 Bacteria 5176
39 Ga0070670_100071595 3300005331 Bacteria 2977
40 Ga0070677_10058845 3300005333 Bacteria 1579
41 Ga0068869_100000007 3300005334 Bacteria 78820
42 Ga0070680_100014122 3300005336 Bacteria 6237
43 Ga0068868_100497731 3300005338 Bacteria 1067
44 Ga0070689_100131032 3300005340 Bacteria 2011
45 Ga0070668_100005002 3300005347 Bacteria 9819
46 Ga0070668_100010303 3300005347 Bacteria 6941
47 Ga0070668_100070008 3300005347 Bacteria 2730
48 Ga0070669_100009394 3300005353 Bacteria 6964
49 Ga0070669_100031327 3300005353 Bacteria 3842
50 Ga0070669_100081349 3300005353 Bacteria 2412
51 Ga0070669_100202647 3300005353 Bacteria 1562
52 Ga0070675_100008830 3300005354 Bacteria 7832
53 Ga0070675_100008944 3300005354 Bacteria 7781
54 Ga0070674_100110942 3300005356 Bacteria 2014
55 Ga0070673_100005812 3300005364 Bacteria 7947
56 Ga0070673_100044158 3300005364 Bacteria 3449
57 Ga0070673_100115291 3300005364 Bacteria 2234
58 Ga0070673_100136030 3300005364 Bacteria 2068
59 Ga0070667_100001939 3300005367 Bacteria 18351
60 Ga0070667_100033931 3300005367 Bacteria 4269
61 Ga0070667_100086660 3300005367 Bacteria 2687
62 Ga0070709_10147855 3300005434 Bacteria 1621
63 Ga0070709_10242786 3300005434 Bacteria 1294
64 Ga0070705_100069014 3300005440 Bacteria 2130
65 Ga0070700_100291104 3300005441 Bacteria 1188
66 Ga0070678_100178204 3300005456 Bacteria 1737
67 Ga0070662_100032281 3300005457 Bacteria 3680
68 Ga0070662_100066591 3300005457 Bacteria 2643
69 Ga0070681_10051171 3300005458 Bacteria 4120
70 Ga0070681_10170879 3300005458 Bacteria 2096
71 Ga0068867_100035038 3300005459 Bacteria 3639
72 Ga0068867_100130131 3300005459 Bacteria 1955
73 Ga0070679_100090856 3300005530 Bacteria 3041
74 Ga0070672_100024379 3300005543 Bacteria 4470
75 Ga0070672_100055134 3300005543 Bacteria 3113
76 Ga0070672_100144065 3300005543 Bacteria 1968
77 Ga0070686_100109638 3300005544 Bacteria 1878
78 Ga0070696_100602262 3300005546 Bacteria 886
79 Ga0070665_100209853 3300005548 Bacteria 1948
80 Ga0070665_100307093 3300005548 Bacteria 1590
81 Ga0070704_100149449 3300005549 Bacteria 1835
82 Ga0068855_100007441 3300005563 Bacteria 13261
83 Ga0068855_100089487 3300005563 Bacteria 3554
84 Ga0068855_100446394 3300005563 Bacteria 1412
85 Ga0070664_100291025 3300005564 Bacteria 1475
86 Ga0068857_100000676 3300005577 Bacteria 25307
87 Ga0068854_100175485 3300005578 Bacteria 1670
88 Ga0068852_100332330 3300005616 Bacteria 1479
89 Ga0068852_100563961 3300005616 Bacteria 1140
90 Ga0068859_100003514 3300005617 Bacteria 15961
91 Ga0068864_100001466 3300005618 Bacteria 19448
92 Ga0068864_100018957 3300005618 Bacteria 5752
93 Ga0068864_100031537 3300005618 Bacteria 4497
94 Ga0068861_100001688 3300005719 Bacteria 14166
95 Ga0068861_100075375 3300005719 Bacteria 2626
96 Ga0068861_100354798 3300005719 Bacteria 1288
97 Ga0068870_10068447 3300005840 Bacteria 1929
98 Ga0068863_100001574 3300005841 Bacteria 22566
99 Ga0068863_100010047 3300005841 Bacteria 9211
100 Ga0068858_100013010 3300005842 Bacteria 7847
101 Ga0068858_100332144 3300005842 Bacteria 1454
102 Ga0068858_100370102 3300005842 Bacteria 1374
103 Ga0068860_100005878 3300005843 Bacteria 12351
104 Ga0068860_100073368 3300005843 Bacteria 3253
105 Ga0068860_100074894 3300005843 Bacteria 3220
106 Ga0068860_100113446 3300005843 Bacteria 2591
107 Ga0068860_100252183 3300005843 Bacteria 1719
108 Ga0068862_100002922 3300005844 Bacteria 14933
109 Ga0068862_100018133 3300005844 Bacteria 5861
110 Ga0075363_100109893 3300006048 Bacteria 1532
111 Ga0075364_10000309 3300006051 Bacteria 23917
112 Ga0075364_10007527 3300006051 Bacteria 6472
113 Ga0075364_10118036 3300006051 Bacteria 1774
114 Ga0075364_10139922 3300006051 Bacteria 1627
115 Ga0097621_100341607 3300006237 Bacteria 1330
116 Ga0068871_100060006 3300006358 Bacteria 3101
117 Ga0068871_100237404 3300006358 Bacteria 1584
118 Ga0068865_100315353 3300006881 Bacteria 1256
119 Ga0097620_100003514 3300006931 Bacteria 15961
120 Ga0079104_1000230 3300006946 Bacteria 75473
121 Ga0099826_10003742 3300006948 Bacteria 10449
122 Ga0105251_10025854 3300009011 Bacteria 2996
123 Ga0105244_10000798 3300009036 Bacteria 26814
124 Ga0105244_10018475 3300009036 Bacteria 3912
125 Ga0105250_10000002 3300009092 Bacteria 566949
126 Ga0105250_10004268 3300009092 Bacteria 6607
127 Ga0105240_10000097 3300009093 Bacteria 179135
128 Ga0105245_10358753 3300009098 Bacteria 1446
129 Ga0105248_10001664 3300009177 Bacteria 24713
130 Ga0105248_10024292 3300009177 Bacteria 6739
131 Ga0105248_10049509 3300009177 Bacteria 4713
132 Ga0105248_10304263 3300009177 Bacteria 1795
133 Ga0105248_10861788 3300009177 Bacteria 1023
134 Ga0105237_10001364 3300009545 Bacteria 32311
135 Ga0105238_10045331 3300009551 Bacteria 4442
136 Ga0105249_10104647 3300009553 Bacteria 2667
137 Ga0105239_10000258 3300010375 Bacteria 78849
138 Ga0157373_10000189 3300013100 Bacteria 50406
139 Ga0157371_10000008 3300013102 Bacteria 393028
140 Ga0157371_10006536 3300013102 Bacteria 9590
141 Ga0157370_10178722 3300013104 Bacteria 1972
142 Ga0157369_10353027 3300013105 Bacteria 1527
143 Ga0163162_10045639 3300013306 Bacteria 4390
144 Ga0163162_10107547 3300013306 Bacteria 2885
145 Ga0163162_10211508 3300013306 Bacteria 2069
146 Ga0157375_10001469 3300013308 Bacteria 20277
147 Ga0157375_10165655 3300013308 Bacteria 2355
148 Ga0157375_10306556 3300013308 Bacteria 1752
149 Ga0163163_10001547 3300014325 Bacteria 19382
150 Ga0163163_10036645 3300014325 Bacteria 4766
151 Ga0163163_10267306 3300014325 Bacteria 1761
152 Ga0157380_10265672 3300014326 Bacteria 1561
153 Ga0157379_10000142 3300014968 Bacteria 51727
154 Ga0157379_10372149 3300014968 Bacteria 1310
155 Ga0157376_10029249 3300014969 Bacteria 4389
156 Ga0157376_10746754 3300014969 Bacteria 987
157 Ga0209760_100078 3300025207 Bacteria 77832
158 Ga0209436_107041 3300025208 Bacteria 2399
159 Ga0209784_100001 3300025224 Bacteria 3600592
160 Ga0209566_100001 3300025225 Bacteria 3600765
161 Ga0209674_100002 3300025226 Bacteria 3600592
162 Ga0209563_100002 3300025230 Bacteria 2045675
163 Ga0207427_100020 3300025231 Bacteria 507515
164 Ga0209437_100001 3300025233 Bacteria 2045675
165 Ga0209437_100042 3300025233 Bacteria 444095
166 Ga0209437_105280 3300025233 Bacteria 2208
167 Ga0207425_1001535 3300025245 Bacteria 9474
168 Ga0209677_100002 3300025253 Bacteria 2045675
169 Ga0209677_100172 3300025253 Bacteria 55396
170 Ga0209233_1000054 3300025261 Bacteria 439669
171 Ga0209233_1000218 3300025261 Bacteria 105353
172 Ga0209233_1000956 3300025261 Bacteria 12493
173 Ga0209565_1000333 3300025263 Bacteria 42094
174 Ga0209130_1000245 3300025284 Bacteria 68668
175 Ga0209130_1000708 3300025284 Bacteria 29740
176 Ga0209675_1003873 3300025291 Bacteria 6883
177 Ga0209676_1000013 3300025292 Bacteria 816080
178 Ga0209676_1003354 3300025292 Bacteria 9980
179 Ga0209676_1014480 3300025292 Bacteria 2961
180 Ga0209025_1004718 3300025294 Bacteria 11627
181 Ga0209025_1009265 3300025294 Bacteria 6894
182 Ga0209025_1010428 3300025294 Bacteria 6294
183 Ga0209564_1002543 3300025295 Bacteria 14056
184 Ga0209564_1051481 3300025295 Bacteria 999
185 Ga0209758_1000341 3300025297 Bacteria 86460
186 Ga0209050_1000008 3300025298 Bacteria 1144179
187 Ga0209050_1001244 3300025298 Bacteria 29472
188 Ga0209050_1015111 3300025298 Bacteria 3270
189 Ga0209050_1020339 3300025298 Bacteria 2473
190 Ga0207426_1000091 3300025302 Bacteria 280561
191 Ga0207426_1005778 3300025302 Bacteria 5555
192 Ga0209051_1000005 3300025303 Bacteria 1142353
193 Ga0209051_1002584 3300025303 Bacteria 12746
194 Ga0209257_1000048 3300025304 Bacteria 455536
195 Ga0209257_1003097 3300025304 Bacteria 14917
196 Ga0207696_1000239 3300025711 Bacteria 75936
197 Ga0207696_1000390 3300025711 Bacteria 41986
198 Ga0207696_1001181 3300025711 Bacteria 14876
199 Ga0207655_1007482 3300025728 Bacteria 7078
200 Ga0207655_1020750 3300025728 Bacteria 3363
201 Ga0207682_10033201 3300025893 Bacteria 2077
202 Ga0207699_10044524 3300025906 Bacteria 2584
203 Ga0207699_10092477 3300025906 Bacteria 1901
204 Ga0207645_10009537 3300025907 Bacteria 6709
205 Ga0207645_10085566 3300025907 Bacteria 2024
206 Ga0207643_10065858 3300025908 Bacteria 2076
207 Ga0207707_10316847 3300025912 Bacteria 1347
208 Ga0207695_10000187 3300025913 Bacteria 179183
209 Ga0207671_10001438 3300025914 Bacteria 27603
210 Ga0207681_10095331 3300025923 Bacteria 2134
211 Ga0207681_10115306 3300025923 Bacteria 1961
212 Ga0207681_10154774 3300025923 Bacteria 1722
213 Ga0207694_10146995 3300025924 Bacteria 1897
214 Ga0207650_10024013 3300025925 Bacteria 4329
215 Ga0207650_10054175 3300025925 Bacteria 2975
216 Ga0207650_10095453 3300025925 Bacteria 2279
217 Ga0207650_10135639 3300025925 Bacteria 1930
218 Ga0207650_10139975 3300025925 Bacteria 1901
219 Ga0207659_10016896 3300025926 Bacteria 4758
220 Ga0207706_10008309 3300025933 Bacteria 9570
221 Ga0207706_10047586 3300025933 Bacteria 3794
222 Ga0207686_10192554 3300025934 Bacteria 1455
223 Ga0207670_10260325 3300025936 Bacteria 1344
224 Ga0207669_10137330 3300025937 Bacteria 1691
225 Ga0207691_10000111 3300025940 Bacteria 72961
226 Ga0207711_10041717 3300025941 Bacteria 3909
227 Ga0207711_10122206 3300025941 Bacteria 2326
228 Ga0207689_10000142 3300025942 Bacteria 61457
229 Ga0207667_10018605 3300025949 Bacteria 7785
230 Ga0207651_10123230 3300025960 Bacteria 1970
231 Ga0207651_10518521 3300025960 Bacteria 1032
232 Ga0207668_10013845 3300025972 Bacteria 4980
233 Ga0207668_10015772 3300025972 Bacteria 4701
234 Ga0207658_10067054 3300025986 Bacteria 2702
235 Ga0207658_10094652 3300025986 Bacteria 2325
236 Ga0207677_10224328 3300026023 Bacteria 1509
237 Ga0207703_10000195 3300026035 Bacteria 70480
238 Ga0207639_10383123 3300026041 Bacteria 1263
239 Ga0207702_10349260 3300026078 Bacteria 1415
240 Ga0207641_10018427 3300026088 Bacteria 5724
241 Ga0207641_10207885 3300026088 Bacteria 1808
242 Ga0207648_10016833 3300026089 Bacteria 6666
243 Ga0207648_10581497 3300026089 Bacteria 1031
244 Ga0207676_10001696 3300026095 Bacteria 16247
245 Ga0207676_10002462 3300026095 Bacteria 13209
246 Ga0207676_10108092 3300026095 Bacteria 2321
247 Ga0207674_10002098 3300026116 Bacteria 25266
248 Ga0207675_100004037 3300026118 Bacteria 14223
249 Ga0207675_100050221 3300026118 Bacteria 3892
250 Ga0207675_100129573 3300026118 Bacteria 2392
251 Ga0207683_10026873 3300026121 Bacteria 4972
252 Ga0207683_10354885 3300026121 Bacteria 1346
253 Ga0207698_10380201 3300026142 Bacteria 1343
254 Ga0209281_1000179 3300027111 Bacteria 148102
255 Ga0209371_1000417 3300027312 Bacteria 43898
256 Ga0209371_1000830 3300027312 Bacteria 25445
257 Ga0209282_1012967 3300027666 Bacteria 5304
258 Ga0268265_10002425 3300028380 Bacteria 14080
259 Ga0268264_10000606 3300028381 Bacteria 43164
260 Ga0268264_10057162 3300028381 Bacteria 3262
261 Ga0268264_10196698 3300028381 Bacteria 1841
262 Ga0268264_10213045 3300028381 Bacteria 1774
263 Ga0307515_10057315 3300028794 Bacteria 5640
264 Ga0268256_1000202 3300030500 Bacteria 67837
265 Ga0268256_1003757 3300030500 Bacteria 6657
266 Ga0316181_1033551 3300030744 Bacteria 4006
267 Ga0265339_10050302 3300031249 Bacteria 2279
268 Ga0265331_10007054 3300031250 Bacteria 6551
269 Ga0265316_10373113 3300031344 Bacteria 1030
270 Ga0307513_10000206 3300031456 Bacteria 85338
271 Ga0265313_10000021 3300031595 Bacteria 144949
272 Ga0316576_10018776 3300031727 Bacteria 4729
273 Ga0307413_10141381 3300031824 Bacteria 1664
274 Ga0307410_10185745 3300031852 Bacteria 1577
275 Ga0307409_100500388 3300031995 Bacteria 1183
276 Ga0307416_100086679 3300032002 Bacteria 2670
277 Ga0307415_100267398 3300032126 Bacteria 1399
278 Ga0373927_0035055 3300035695 Bacteria 3263
279 Ga0373933_0287633 3300035724 Bacteria 1063
280 Ga0316584_0100544 3300036712 Bacteria 2165
281 Ga0316584_0302134 3300036712 Bacteria 1158
282 Ga0395899_0000589 3300037312 Bacteria 38294
283 Ga0395900_0000375 3300037418 Bacteria 64534
284 Ga0395898_0000629 3300037466 Bacteria 64534
285 Ga0395905_0000361 3300037471 Bacteria 64517
286 Ga0395901_0000273 3300038443 Bacteria 64425
287 Ga0436365_0009921 3300039437 Bacteria 1461
288 Ga0436360_0657748 3300039438 Bacteria 1698
289 Ga0495617_008308 3300046452 Bacteria 3581
290 Ga0495591_000111 3300046458 Bacteria 93733
291 Ga0495591_002389 3300046458 Bacteria 10507
292 Ga0495650_0000043 3300046471 Bacteria 357197
293 Ga0495580_0003875 3300046472 Bacteria 12664
294 Ga0495605_0193258 3300046474 Bacteria 889
295 Ga0495607_0146249 3300046501 Bacteria 1214
296 Ga0495606_0001398 3300046507 Bacteria 32519
297 Ga0495616_0042943 3300046513 Bacteria 2299
298 Ga0495631_0141056 3300046518 Bacteria 1035
299 Ga0495643_0029652 3300046522 Bacteria 3060
300 Ga0495648_0009512 3300046524 Bacteria 7512
301 Ga0495654_0000147 3300046530 Bacteria 72993
302 Ga0495654_0000250 3300046530 Bacteria 49614
303 Ga0495654_0003284 3300046530 Bacteria 9972
304 Ga0495668_0005994 3300046616 Bacteria 8071
305 Ga0495625_0119943 3300046660 Bacteria 1791
306 Ga0495588_0001469 3300046674 Bacteria 10112
307 Ga0495671_0002319 3300046692 Bacteria 12088
308 Ga0495649_0022825 3300046694 Bacteria 3499
309 Ga0495589_0017398 3300046794 Bacteria 3690
310 Ga0495660_0000012 3300046810 Bacteria 350701
311 Ga0495660_0000020 3300046810 Bacteria 304768
312 Ga0495672_0000011 3300047320 Bacteria 535362
313 Ga0495680_0267401 3300047322 Bacteria 1208
314 Ga0495683_0022959 3300047323 Bacteria 3207
315 Ga0495673_0000020 3300047469 Bacteria 548327
316 Ga0495681_0027166 3300047470 Bacteria 2966
317 Ga0495686_0009938 3300047472 Bacteria 6811
318 Ga0496100_0000286 3300048903 Bacteria 25474
319 Ga0496100_0087102 3300048903 Bacteria 2123
320 Ga0496101_0000164 3300048904 Bacteria 56560
321 Ga0496101_0116726 3300048904 Bacteria 2014
322 Ga0496102_0001007 3300048905 Bacteria 26439
323 Ga0496103_0009151 3300048906 Bacteria 5865
324 Ga0496104_0014452 3300048907 Bacteria 7131
325 Ga0496106_0069435 3300048909 Bacteria 2689
326 Ga0496108_0179310 3300048911 Bacteria 1834
327 Ga0496116_0000066 3300048919 Bacteria 264035
328 Ga0496116_0023132 3300048919 Bacteria 4636
329 Ga0496116_0094523 3300048919 Bacteria 1806
330 Ga0496117_0000997 3300048920 Bacteria 43330
331 Ga0496117_0002474 3300048920 Bacteria 23204
332 Ga0496117_0009777 3300048920 Bacteria 8847
333 Ga0496118_0001178 3300048921 Bacteria 40345
334 Ga0496118_0005581 3300048921 Bacteria 14241
335 Ga0496118_0008115 3300048921 Bacteria 10935
336 Ga0496118_0056669 3300048921 Bacteria 2944
337 Ga0496118_0193894 3300048921 Bacteria 1212
338 Ga0496119_0012240 3300048922 Bacteria 6992
339 Ga0496119_0018206 3300048922 Bacteria 5244
340 Ga0496119_0023643 3300048922 Bacteria 4349
341 Ga0496119_0031778 3300048922 Bacteria 3531
342 Ga0496120_0001859 3300048923 Bacteria 23494
343 Ga0496120_0010251 3300048923 Bacteria 6560
344 Ga0496120_0044838 3300048923 Bacteria 2566
345 Ga0496121_0000033 3300048924 Bacteria 377542
346 Ga0496121_0000084 3300048924 Bacteria 225942
347 Ga0496121_0000216 3300048924 Bacteria 127028
348 Ga0496121_0005558 3300048924 Bacteria 16101
349 Ga0496122_0000110 3300048925 Bacteria 190142
350 Ga0496122_0002781 3300048925 Bacteria 24065
351 Ga0496122_0011709 3300048925 Bacteria 8839
352 Ga0496123_0000081 3300048926 Bacteria 190142
353 Ga0496123_0002476 3300048926 Bacteria 22795
354 Ga0496123_0030641 3300048926 Bacteria 3933
355 Ga0496123_0052200 3300048926 Bacteria 2715
356 Ga0496124_0000066 3300048927 Bacteria 222815
357 Ga0496124_0008929 3300048927 Bacteria 10387
358 Ga0496124_0018729 3300048927 Bacteria 6472
359 Ga0496124_0020408 3300048927 Bacteria 6122
360 Ga0496124_0073191 3300048927 Bacteria 2836
361 Ga0496124_0161115 3300048927 Bacteria 1748
362 Ga0496125_0000033 3300048928 Bacteria 351850
363 Ga0496125_0000218 3300048928 Bacteria 117272
364 Ga0496125_0002983 3300048928 Bacteria 21244
365 Ga0496126_0000420 3300048929 Bacteria 85425
366 Ga0496126_0027736 3300048929 Bacteria 5404
367 Ga0496126_0065937 3300048929 Bacteria 3238
368 Ga0495678_000551 3300049459 Bacteria 36076
369 Ga0495678_041843 3300049459 Bacteria 1830
370 Ga0495682_0000005 3300049460 Bacteria 360387
371 Ga0501032_0105053 3300049569 Bacteria 1871
372 Ga0501033_0048133 3300049570 Bacteria 3167
373 Ga0501034_0425400 3300049571 Bacteria 1248
374 Ga0501038_0058174 3300049574 Bacteria 3315
375 Ga0501039_0054997 3300049575 Bacteria 3082
376 Ga0501083_0002976 3300049744 Bacteria 11757
377 Ga0501035_0240839 3300049822 Bacteria 1538
378 nmdc:mga00v17_104_c1 3300050491 Bacteria 50343
379 nmdc:mga00v17_109618_c1 3300050491 Bacteria 1750
380 nmdc:mga00v17_7500_c1 3300050491 Bacteria 5823
381 nmdc:mga00v17_95488_c1 3300050491 Bacteria 1872
382 nmdc:mga07m45_252781_c1 3300050496 Bacteria 1025
383 nmdc:mga0sz30_60112_c1 3300050516 Bacteria 1622
384 Ga0500650_0114579 3300053098 Bacteria 1258
385 Ga0500593_000456 3300053117 Bacteria 16197
386 Ga0500607_106720 3300053121 Bacteria 1381
387 Ga0500618_000008 3300053125 Bacteria 214678
388 Ga0500618_000122 3300053125 Bacteria 63970
389 Ga0500618_001174 3300053125 Bacteria 12644
390 Ga0500618_028116 3300053125 Bacteria 1333
391 Ga0500618_057580 3300053125 Bacteria 875
392 Ga0500621_000014 3300053126 Bacteria 126576
393 Ga0500568_0000116 3300053139 Bacteria 71883
394 Ga0500573_0001480 3300053140 Bacteria 11280
395 Ga0500573_0007401 3300053140 Bacteria 5986
396 Ga0500586_060140 3300053145 Bacteria 1321
397 Ga0500616_0000587 3300053153 Bacteria 44254
398 Ga0500624_000776 3300053157 Bacteria 7557
399 Ga0500627_0007993 3300053158 Bacteria 3728
400 Ga0500634_0002607 3300053161 Bacteria 7670
401 Ga0500636_0039826 3300053177 Bacteria 2780
402 Ga0500611_003527 3300053727 Bacteria 2015
403 Ga0500645_004768 3300053730 Bacteria 5132
404 Ga0501082_0145772 3300060353 Bacteria 2055
405 Ga0501082_0377170 3300060353 Bacteria 1237
406 2509076505 2508501114 Bacteria 7082538
407 2511245294 2511231002 Bacteria 5042903
408 2511380870 2511231025 Bacteria 5324661
409 2511436779 2511231035 Bacteria 5341610
410 2514587037 2513237351 Bacteria 6968952
411 2561467997 2558860983 Bacteria 4133860
412 2585277904 2582581308 Bacteria 7413247
413 2585326850 2582581315 Bacteria 7318924
414 2585332526 2582581316 Bacteria 7774528
415 2585533232 2585427527 Bacteria 7273426
416 2585555653 2585427530 Bacteria 7383882
417 2585828527 2585427591 Bacteria 5482980
418 2585832929 2585427592 Bacteria 5370892
419 2586000578 2585427634 Bacteria 6455027
420 2616309173 2615840626 Bacteria 7921970
421 2617381182 2617270742 Bacteria 6808054
422 2644104353 2643221618 Bacteria 7717186
423 2644147551 2643221626 Bacteria 8069654
424 2644313346 2643221655 Bacteria 7722067
425 2644331649 2643221659 Bacteria 7890716
426 2644541819 2643221698 Bacteria 7756764
427 2644612971 2643221712 Bacteria 7729434
428 2671110079 2667528173 Bacteria 5375747
429 2707101564 2706794495 Bacteria 4536932
430 2715500377 2713897090 Bacteria 3353799
431 2765463880 2765235802 Bacteria 5618596
432 2776269010 2775506902 Bacteria 6208009
433 2776283853 2775506904 Bacteria 5954060
434 2778175261 2775507266 Bacteria 7392367
435 2792581517 2791355082 Bacteria 5973319
436 2819641863 2818991453 Bacteria 7181617
437 2819683635 2818991461 Bacteria 7026071
438 2821126542 2821123053 Bacteria 7836056
439 2838675362 2838675328 Bacteria 4909118
440 2838714243 2838714209 Bacteria 5525906
441 2838721955 2838719591 Bacteria 5523910
442 2838725004 2838724970 Bacteria 4908691
443 2838736983 2838736955 Bacteria 5760694
444 2839993833 2839993093 Bacteria 5512535
445 2841842648 2841840854 Bacteria 5761912
446 2841848934 2841846520 Bacteria 5345850
447 2842125035 2842124991 Bacteria 5346824
448 2842130257 2842130223 Bacteria 4909145
449 2842142428 2842140634 Bacteria 5759631
450 2842154573 2842152218 Bacteria 4908957
451 2842170486 2842170452 Bacteria 5525737
452 2842178193 2842175837 Bacteria 4908771
453 2842187352 2842187318 Bacteria 5524014
454 2842211663 2842211629 Bacteria 5523832
455 2842226717 2842224351 Bacteria 5524473
456 2842486839 2842482326 Bacteria 7212537
457 2842777113 2842775625 Bacteria 5587290
458 2844167101 2844163670 Bacteria 7266046
459 2854603711 2854601825 Bacteria 4797592
460 2854916447 2854911287 Bacteria 5582813
461 2857533104 2857531043 Bacteria 6754041
462 2876601763 2876601092 Bacteria 5114497
463 2883294861 2883291878 Bacteria 5894118
464 2883356653 2883354860 Bacteria 5865246
465 2884301217 2884298095 Bacteria 3823049
466 2891049054 2891048133 Bacteria 4447501
467 2899275830 2899275550 Bacteria 3958688
468 2904477086 2904474040 Bacteria 5504324
469 2904508688 2904504865 Bacteria 5152820
470 2904579479 2904578770 Bacteria 5302906
471 2915652661 2915650412 Bacteria 4288180
472 2919114274 2919114240 Bacteria 5700270
473 2919120854 2919119836 Bacteria 5208557
474 2919153253 2919150387 Bacteria 5500879
475 2919172771 2919171160 Bacteria 6499771
476 2926755294 2926754445 Bacteria 5964435
477 2927143879 2927143783 Bacteria 5504251
478 2928522280 2928521798 Bacteria 4960112
479 2929144074 2929138655 Bacteria 5810547
480 2933009218 2933006813 Bacteria 4912075
481 2941504251 2941499720 Bacteria 7599444
482 2954014295 2954011201 Bacteria 4762601
483 8005661683 8005658619 Bacteria 4500593
484 8016733960 8016733728 Bacteria 5274317
485 8019504541 8019499862 Bacteria 5169538
486 8049295598 8049293176 Bacteria 6128433
487 8055431960 8055431914 Bacteria 4551896
488 8057134069 8057132660 Bacteria 4061191
489 Ga0097621_100011117
490 SwRhRL2b_contig_478082
491 JGI25162J39368_1000092
492 JGI25162J39368_1000675
493 JGI25163J39215_1000013
494 JGI25164J39214_1000071
495 JGI25159J45721_1000407
496 JGI25151J46595_10017735
497 JGI25165J46597_1000398
498 JGI25165J46597_1002788
499 rootH1_10194219
500 JGI25160J50197_1000172
501 JGI25161J50226_1000007
502 Ga0055538_1000064
503 Ga0055539_1000098
504 Ga0055533_1000108
505 Ga0055525_1000141
506 Ga0055526_1003566
507 Ga0055536_1005157
508 Ga0055536_1009577
509 Ga0055530_10000763
510 Ga0055530_10001299
511 Ga0055540_1000504
512 Ga0055540_1002428
513 Ga0055531_10003215
514 Ga0055531_10004306
515 Ga0055541_1000065
516 Ga0058692_1000171
517 Ga0058692_1000679
518 Ga0058692_1002252
519 Ga0055543_1011070
520 Ga0065165_1018011
521 Ga0065165_1027467
522 Ga0065165_1037185
523 Ga0065704_10000032
524 Ga0070670_100004009
525 Ga0070670_100004917
526 Ga0070670_100024623
527 Ga0070670_100071595
528 Ga0070677_10058845
529 Ga0068869_100000007
530 Ga0070680_100014122
531 Ga0068868_100497731
532 Ga0070689_100131032
533 Ga0070668_100005002
534 Ga0070668_100010303
535 Ga0070668_100070008
536 Ga0070669_100009394
537 Ga0070669_100031327
538 Ga0070669_100081349
539 Ga0070669_100202647
540 Ga0070675_100008830
541 Ga0070675_100008944
542 Ga0070674_100110942
543 Ga0070673_100005812
544 Ga0070673_100044158
545 Ga0070673_100115291
546 Ga0070673_100136030
547 Ga0070667_100001939
548 Ga0070667_100033931
549 Ga0070667_100086660
550 Ga0070709_10147855
551 Ga0070709_10242786
552 Ga0070705_100069014
553 Ga0070700_100291104
554 Ga0070678_100178204
555 Ga0070662_100032281
556 Ga0070662_100066591
557 Ga0070681_10051171
558 Ga0070681_10170879
559 Ga0068867_100035038
560 Ga0068867_100130131
561 Ga0070679_100090856
562 Ga0070672_100024379
563 Ga0070672_100055134
564 Ga0070672_100144065
565 Ga0070686_100109638
566 Ga0070696_100602262
567 Ga0070665_100209853
568 Ga0070665_100307093
569 Ga0070704_100149449
570 Ga0068855_100007441
571 Ga0068855_100089487
572 Ga0068855_100446394
573 Ga0070664_100291025
574 Ga0068857_100000676
575 Ga0068854_100175485
576 Ga0068852_100332330
577 Ga0068852_100563961
578 Ga0068859_100003514
579 Ga0068864_100001466
580 Ga0068864_100018957
581 Ga0068864_100031537
582 Ga0068861_100001688
583 Ga0068861_100075375
584 Ga0068861_100354798
585 Ga0068870_10068447
586 Ga0068863_100001574
587 Ga0068863_100010047
588 Ga0068858_100013010
589 Ga0068858_100332144
590 Ga0068858_100370102
591 Ga0068860_100005878
592 Ga0068860_100073368
593 Ga0068860_100074894
594 Ga0068860_100113446
595 Ga0068860_100252183
596 Ga0068862_100002922
597 Ga0068862_100018133
598 Ga0075363_100109893
599 Ga0075364_10000309
600 Ga0075364_10007527
601 Ga0075364_10118036
602 Ga0075364_10139922
603 Ga0097621_100341607
604 Ga0068871_100060006
605 Ga0068871_100237404
606 Ga0068865_100315353
607 Ga0097620_100003514
608 Ga0079104_1000230
609 Ga0099826_10003742
610 Ga0105251_10025854
611 Ga0105244_10000798
612 Ga0105244_10018475
613 Ga0105250_10000002
614 Ga0105250_10004268
615 Ga0105240_10000097
616 Ga0105245_10358753
617 Ga0105248_10001664
618 Ga0105248_10024292
619 Ga0105248_10049509
620 Ga0105248_10304263
621 Ga0105248_10861788
622 Ga0105237_10001364
623 Ga0105238_10045331
624 Ga0105249_10104647
625 Ga0105239_10000258
626 Ga0157373_10000189
627 Ga0157371_10000008
628 Ga0157371_10006536
629 Ga0157370_10178722
630 Ga0157369_10353027
631 Ga0163162_10045639
632 Ga0163162_10107547
633 Ga0163162_10211508
634 Ga0157375_10001469
635 Ga0157375_10165655
636 Ga0157375_10306556
637 Ga0163163_10001547
638 Ga0163163_10036645
639 Ga0163163_10267306
640 Ga0157380_10265672
641 Ga0157379_10000142
642 Ga0157379_10372149
643 Ga0157376_10029249
644 Ga0157376_10746754
645 Ga0209760_100078
646 Ga0209436_107041
647 Ga0209784_100001
648 Ga0209566_100001
649 Ga0209674_100002
650 Ga0209563_100002
651 Ga0207427_100020
652 Ga0209437_100001
653 Ga0209437_100042
654 Ga0209437_105280
655 Ga0207425_1001535
656 Ga0209677_100002
657 Ga0209677_100172
658 Ga0209233_1000054
659 Ga0209233_1000218
660 Ga0209233_1000956
661 Ga0209565_1000333
662 Ga0209130_1000245
663 Ga0209130_1000708
664 Ga0209675_1003873
665 Ga0209676_1000013
666 Ga0209676_1003354
667 Ga0209676_1014480
668 Ga0209025_1004718
669 Ga0209025_1009265
670 Ga0209025_1010428
671 Ga0209564_1002543
672 Ga0209564_1051481
673 Ga0209758_1000341
674 Ga0209050_1000008
675 Ga0209050_1001244
676 Ga0209050_1015111
677 Ga0209050_1020339
678 Ga0207426_1000091
679 Ga0207426_1005778
680 Ga0209051_1000005
681 Ga0209051_1002584
682 Ga0209257_1000048
683 Ga0209257_1003097
684 Ga0207696_1000239
685 Ga0207696_1000390
686 Ga0207696_1001181
687 Ga0207655_1007482
688 Ga0207655_1020750
689 Ga0207682_10033201
690 Ga0207699_10044524
691 Ga0207699_10092477
692 Ga0207645_10009537
693 Ga0207645_10085566
694 Ga0207643_10065858
695 Ga0207707_10316847
696 Ga0207695_10000187
697 Ga0207671_10001438
698 Ga0207681_10095331
699 Ga0207681_10115306
700 Ga0207681_10154774
701 Ga0207694_10146995
702 Ga0207650_10024013
703 Ga0207650_10054175
704 Ga0207650_10095453
705 Ga0207650_10135639
706 Ga0207650_10139975
707 Ga0207659_10016896
708 Ga0207706_10008309
709 Ga0207706_10047586
710 Ga0207686_10192554
711 Ga0207670_10260325
712 Ga0207669_10137330
713 Ga0207691_10000111
714 Ga0207711_10041717
715 Ga0207711_10122206
716 Ga0207689_10000142
717 Ga0207667_10018605
718 Ga0207651_10123230
719 Ga0207651_10518521
720 Ga0207668_10013845
721 Ga0207668_10015772
722 Ga0207658_10067054
723 Ga0207658_10094652
724 Ga0207677_10224328
725 Ga0207703_10000195
726 Ga0207639_10383123
727 Ga0207702_10349260
728 Ga0207641_10018427
729 Ga0207641_10207885
730 Ga0207648_10016833
731 Ga0207648_10581497
732 Ga0207676_10001696
733 Ga0207676_10002462
734 Ga0207676_10108092
735 Ga0207674_10002098
736 Ga0207675_100004037
737 Ga0207675_100050221
738 Ga0207675_100129573
739 Ga0207683_10026873
740 Ga0207683_10354885
741 Ga0207698_10380201
742 Ga0209281_1000179
743 Ga0209371_1000417
744 Ga0209371_1000830
745 Ga0209282_1012967
746 Ga0268265_10002425
747 Ga0268264_10000606
748 Ga0268264_10057162
749 Ga0268264_10196698
750 Ga0268264_10213045
751 Ga0307515_10057315
752 Ga0268256_1000202
753 Ga0268256_1003757
754 Ga0316181_1033551
755 Ga0265339_10050302
756 Ga0265331_10007054
757 Ga0265316_10373113
758 Ga0307513_10000206
759 Ga0265313_10000021
760 Ga0316576_10018776
761 Ga0307413_10141381
762 Ga0307410_10185745
763 Ga0307409_100500388
764 Ga0307416_100086679
765 Ga0307415_100267398
766 Ga0373927_0035055
767 Ga0373933_0287633
768 Ga0316584_0100544
769 Ga0316584_0302134
770 Ga0395899_0000589
771 Ga0395900_0000375
772 Ga0395898_0000629
773 Ga0395905_0000361
774 Ga0395901_0000273
775 Ga0436365_0009921
776 Ga0436360_0657748
777 Ga0495617_008308
778 Ga0495591_000111
779 Ga0495591_002389
780 Ga0495650_0000043
781 Ga0495580_0003875
782 Ga0495605_0193258
783 Ga0495607_0146249
784 Ga0495606_0001398
785 Ga0495616_0042943
786 Ga0495631_0141056
787 Ga0495643_0029652
788 Ga0495648_0009512
789 Ga0495654_0000147
790 Ga0495654_0000250
791 Ga0495654_0003284
792 Ga0495668_0005994
793 Ga0495625_0119943
794 Ga0495588_0001469
795 Ga0495671_0002319
796 Ga0495649_0022825
797 Ga0495589_0017398
798 Ga0495660_0000012
799 Ga0495660_0000020
800 Ga0495672_0000011
801 Ga0495680_0267401
802 Ga0495683_0022959
803 Ga0495673_0000020
804 Ga0495681_0027166
805 Ga0495686_0009938
806 Ga0496100_0000286
807 Ga0496100_0087102
808 Ga0496101_0000164
809 Ga0496101_0116726
810 Ga0496102_0001007
811 Ga0496103_0009151
812 Ga0496104_0014452
813 Ga0496106_0069435
814 Ga0496108_0179310
815 Ga0496116_0000066
816 Ga0496116_0023132
817 Ga0496116_0094523
818 Ga0496117_0000997
819 Ga0496117_0002474
820 Ga0496117_0009777
821 Ga0496118_0001178
822 Ga0496118_0005581
823 Ga0496118_0008115
824 Ga0496118_0056669
825 Ga0496118_0193894
826 Ga0496119_0012240
827 Ga0496119_0018206
828 Ga0496119_0023643
829 Ga0496119_0031778
830 Ga0496120_0001859
831 Ga0496120_0010251
832 Ga0496120_0044838
833 Ga0496121_0000033
834 Ga0496121_0000084
835 Ga0496121_0000216
836 Ga0496121_0005558
837 Ga0496122_0000110
838 Ga0496122_0002781
839 Ga0496122_0011709
840 Ga0496123_0000081
841 Ga0496123_0002476
842 Ga0496123_0030641
843 Ga0496123_0052200
844 Ga0496124_0000066
845 Ga0496124_0008929
846 Ga0496124_0018729
847 Ga0496124_0020408
848 Ga0496124_0073191
849 Ga0496124_0161115
850 Ga0496125_0000033
851 Ga0496125_0000218
852 Ga0496125_0002983
853 Ga0496126_0000420
854 Ga0496126_0027736
855 Ga0496126_0065937
856 Ga0495678_000551
857 Ga0495678_041843
858 Ga0495682_0000005
859 Ga0501032_0105053
860 Ga0501033_0048133
861 Ga0501034_0425400
862 Ga0501038_0058174
863 Ga0501039_0054997
864 Ga0501083_0002976
865 Ga0501035_0240839
866 nmdc:mga00v17_104_c1
867 nmdc:mga00v17_109618_c1
868 nmdc:mga00v17_7500_c1
869 nmdc:mga00v17_95488_c1
870 nmdc:mga07m45_252781_c1
871 nmdc:mga0sz30_60112_c1
872 Ga0500650_0114579
873 Ga0500593_000456
874 Ga0500607_106720
875 Ga0500618_000008
876 Ga0500618_000122
877 Ga0500618_001174
878 Ga0500618_028116
879 Ga0500618_057580
880 Ga0500621_000014
881 Ga0500568_0000116
882 Ga0500573_0001480
883 Ga0500573_0007401
884 Ga0500586_060140
885 Ga0500616_0000587
886 Ga0500624_000776
887 Ga0500627_0007993
888 Ga0500634_0002607
889 Ga0500636_0039826
890 Ga0500611_003527
891 Ga0500645_004768
892 Ga0501082_0145772
893 Ga0501082_0377170
894 2509076505
895 2511245294
896 2511380870
897 2511436779
898 2514587037
899 2561467997
900 2585277904
901 2585326850
902 2585332526
903 2585533232
904 2585555653
905 2585828527
906 2585832929
907 2586000578
908 2616309173
909 2617381182
910 2644104353
911 2644147551
912 2644313346
913 2644331649
914 2644541819
915 2644612971
916 2671110079
917 2707101564
918 2715500377
919 2765463880
920 2776269010
921 2776283853
922 2778175261
923 2792581517
924 2819641863
925 2819683635
926 2821126542
927 2838675362
928 2838714243
929 2838721955
930 2838725004
931 2838736983
932 2839993833
933 2841842648
934 2841848934
935 2842125035
936 2842130257
937 2842142428
938 2842154573
939 2842170486
940 2842178193
941 2842187352
942 2842211663
943 2842226717
944 2842486839
945 2842777113
946 2844167101
947 2854603711
948 2854916447
949 2857533104
950 2876601763
951 2883294861
952 2883356653
953 2884301217
954 2891049054
955 2899275830
956 2904477086
957 2904508688
958 2904579479
959 2915652661
960 2919114274
961 2919120854
962 2919153253
963 2919172771
964 2926755294
965 2927143879
966 2928522280
967 2929144074
968 2933009218
969 2941504251
970 2954014295
971 8005661683
972 8016733960
973 8019504541
974 8049295598
975 8055431960
976 8057134069

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

55

213

0.89

PF13304

AAA_21

AAA domain, putative AbiEii toxin, Type IV TA system

144

249

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
7z19-assembly1.cif.gz_I e. coli c-p lyase bound to a single phnk abc domain 0.9346 17 253
7z17-assembly1.cif.gz_J e. coli c-p lyase bound to a phnk abc dimer in an open conformation 0.9311 17 254
4jbw-assembly1.cif.gz_A crystal structure of e. coli maltose transporter malfgk2 in complex with its regulatory protein eiiaglc 0.9301 15 237
7ahe-assembly1.cif.gz_C opua inhibited inward facing 0.9237 16 252
4tqu-assembly1.cif.gz_T crystal structure of a bacterial abc transporter involved in the import of the acidic polysaccharide alginate 0.922 15 237
ID Description Score Start End Superfamily
af_Q2G1F8_275_530_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9592 17 252 3.40.50.300
af_O69724_1_242_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9449 17 251 3.40.50.300
af_P75796_311_605_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.938 17 252 3.40.50.300
af_I6Y482_6_279_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9377 17 257 3.40.50.300
af_Q9XW49_1237_1482_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9366 12 239 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A7W2BRZ0-F1-model_v4 deleted 0.9647 15 260
AF-A0A174VRL1-F1-model_v4 ABC transporter ATP-binding protein (Methionine import ATP-binding protein MetN (EC 3.6.3.-)) 0.9591 17 234 GO:0005524
GO:0016887
GO:0055085
AF-A0A366IF50-F1-model_v4 Peptide/nickel transport system ATP-binding protein/oligopeptide transport system ATP-binding protein 0.9581 17 252 GO:0005524
GO:0015833
GO:0016887
GO:0055085
AF-A0A5D4LZT8-F1-model_v4 ABC transporter ATP-binding protein 0.9555 14 252 GO:0005524
GO:0015833
GO:0016887
GO:0055085
AF-A0A1Q7CRB0-F1-model_v4 Peptide ABC transporter substrate-binding protein 0.9536 17 252 GO:0005524
GO:0015833
GO:0016887
GO:0055085

Map