F453585

General Info

Members Datasets Scaffolds Average Seq Length
488 253 976 216

Family's Representative Sequence

Representative Sequence 3300006846|Ga0075430_100565194|Ga0075430_1005651942
Length 241
Sequence MTASRGGPRRVRERPNGRASRGSRDRVGGRGGYELRANVRDRLIESRLTPNAISMTGLVLNVVAAVLITQRLFFLAGVAFVVGSLMDTLDGRYSRMSGKGTLFGAFLDSTLDRIEEGIVLTAVAAYFASRGDELAVAATVVVVLGSLMVSYTRARAEALGVECKVGLATRPVRVVLLSGGLLFAKGAGLGDFELLAPAIYAMAGLTVFTVGQRIWHVRQQLAGEAQPPGGVTSGASEGNAT

Samples

Sample ID Description Type Environment
1 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
5 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
44 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
50 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
51 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
52 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
53 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
54 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
55 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
56 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
57 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
63 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
64 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
76 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
77 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
78 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
79 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
80 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
81 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
88 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
132 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
135 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
136 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
137 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
138 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
139 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
140 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
141 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
142 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
143 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
144 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
145 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
146 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
147 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
148 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
149 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
150 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
151 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
152 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
153 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
154 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
155 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
156 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
157 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
158 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
159 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
160 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
161 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
162 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
163 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
164 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
165 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
166 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
167 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
168 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
169 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
170 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
171 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
172 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
173 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
174 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
175 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
176 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
177 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
178 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
179 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
180 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
181 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
182 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
183 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
184 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
185 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
186 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
187 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
188 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
189 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
190 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
191 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
192 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
193 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
194 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
195 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
196 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
197 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
198 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
199 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
200 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
201 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
202 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
203 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
204 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
205 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
206 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
207 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
208 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
209 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
210 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
211 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
212 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
213 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
214 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
215 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
216 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
217 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
218 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
219 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
220 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
226 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
227 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
228 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
229 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
230 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
231 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
232 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
233 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
234 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
235 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
236 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
237 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
238 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
239 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
240 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
241 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
242 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
243 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
244 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
245 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
246 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
247 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
248 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
249 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
250 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
251 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
252 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
253 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.15
Nodule 0
Rhizoplane 14.14
Rhizosphere 77.66
Stem 0
Stem Tuber 0
Unclassified 0.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075430_100565194 3300006846 Bacteria 938
2 JGI24746J21847_1001719 3300001977 Bacteria 3509
3 JGI24740J21852_10000392 3300001979 Bacteria 18771
4 JGI24748J21848_1000538 3300002074 Bacteria 4116
5 JGI24742J22300_10000434 3300002244 Bacteria 6167
6 Ga0070658_10074207 3300005327 Bacteria 2789
7 Ga0070683_100022585 3300005329 Bacteria 5625
8 Ga0070666_10013549 3300005335 Bacteria 5176
9 Ga0070666_10352669 3300005335 Bacteria 1053
10 Ga0070682_100000057 3300005337 Bacteria 108832
11 Ga0070682_100000100 3300005337 Bacteria 77054
12 Ga0070682_100033235 3300005337 Bacteria 3132
13 Ga0068868_100010651 3300005338 Bacteria 6664
14 Ga0068868_100013863 3300005338 Bacteria 5925
15 Ga0070689_100077260 3300005340 Bacteria 2609
16 Ga0070669_100004860 3300005353 Bacteria 9698
17 Ga0070675_100000073 3300005354 Bacteria 57652
18 Ga0070674_100000003 3300005356 Bacteria 258221
19 Ga0070674_100341218 3300005356 Bacteria 1207
20 Ga0070674_100904014 3300005356 Bacteria 769
21 Ga0070673_100010571 3300005364 Bacteria 6253
22 Ga0070688_100000848 3300005365 Bacteria 15156
23 Ga0070659_100000018 3300005366 Bacteria 156724
24 Ga0070667_100006805 3300005367 Bacteria 9496
25 Ga0070667_100957454 3300005367 Bacteria 798
26 Ga0070709_10195932 3300005434 Bacteria 1428
27 Ga0070714_100000151 3300005435 Bacteria 55747
28 Ga0070714_100014803 3300005435 Bacteria 6268
29 Ga0070710_10000012 3300005437 Bacteria 124056
30 Ga0070711_100023476 3300005439 Bacteria 4012
31 Ga0070705_100043031 3300005440 Bacteria 2586
32 Ga0070705_100162107 3300005440 Bacteria 1496
33 Ga0070678_100007766 3300005456 Bacteria 6379
34 Ga0070662_100000005 3300005457 Bacteria 183056
35 Ga0070681_10003375 3300005458 Bacteria 14931
36 Ga0068867_100000254 3300005459 Bacteria 35276
37 Ga0070685_10000932 3300005466 Bacteria 15756
38 Ga0070685_10469894 3300005466 Bacteria 885
39 Ga0070679_100012299 3300005530 Bacteria 8176
40 Ga0070684_100023911 3300005535 Bacteria 5119
41 Ga0070684_100188454 3300005535 Bacteria 1876
42 Ga0070684_100260095 3300005535 Bacteria 1588
43 Ga0068853_100981230 3300005539 Bacteria 813
44 Ga0070672_100576233 3300005543 Bacteria 979
45 Ga0070686_100012725 3300005544 Bacteria 4803
46 Ga0070695_100243115 3300005545 Bacteria 1306
47 Ga0070696_100397172 3300005546 Bacteria 1078
48 Ga0070693_100000815 3300005547 Bacteria 13820
49 Ga0070665_100003550 3300005548 Bacteria 16555
50 Ga0070665_100289460 3300005548 Bacteria 1640
51 Ga0070704_100043643 3300005549 Bacteria 3110
52 Ga0070704_100306827 3300005549 Bacteria 1324
53 Ga0068855_100148117 3300005563 Bacteria 2671
54 Ga0068854_100000563 3300005578 Bacteria 22259
55 Ga0068854_100023958 3300005578 Bacteria 4174
56 Ga0068856_100200215 3300005614 Bacteria 2011
57 Ga0068852_100000103 3300005616 Bacteria 56542
58 Ga0068866_10000002 3300005718 Bacteria 394090
59 Ga0068866_10000816 3300005718 Bacteria 13847
60 Ga0068866_10121382 3300005718 Bacteria 1473
61 Ga0068851_10047118 3300005834 Bacteria 2182
62 Ga0068863_100000032 3300005841 Bacteria 172402
63 Ga0068863_100273417 3300005841 Bacteria 1636
64 Ga0068858_100000043 3300005842 Bacteria 132444
65 Ga0068858_100096586 3300005842 Bacteria 2754
66 Ga0068858_100150120 3300005842 Bacteria 2191
67 Ga0068860_100076356 3300005843 Bacteria 3187
68 Ga0068860_100271622 3300005843 Bacteria 1655
69 Ga0068862_100128748 3300005844 Bacteria 2237
70 Ga0081455_10005032 3300005937 Bacteria 14610
71 Ga0081455_10015890 3300005937 Bacteria 7287
72 Ga0081455_10033815 3300005937 Bacteria 4588
73 Ga0081455_10214526 3300005937 Bacteria 1432
74 Ga0081538_10003370 3300005981 Bacteria 15127
75 Ga0081540_1000025 3300005983 Bacteria 157742
76 Ga0081540_1070384 3300005983 Bacteria 1620
77 Ga0081540_1095549 3300005983 Bacteria 1295
78 Ga0081539_10106845 3300005985 Bacteria 1416
79 Ga0070717_10000032 3300006028 Bacteria 136233
80 Ga0075365_10000210 3300006038 Bacteria 19586
81 Ga0075365_10035478 3300006038 Bacteria 3227
82 Ga0075365_10160000 3300006038 Bacteria 1569
83 Ga0075365_10271132 3300006038 Bacteria 1194
84 Ga0075365_10310371 3300006038 Bacteria 1110
85 Ga0075365_10329949 3300006038 Bacteria 1075
86 Ga0075363_100034627 3300006048 Bacteria 2637
87 Ga0075363_100052675 3300006048 Bacteria 2173
88 Ga0075363_100083565 3300006048 Bacteria 1749
89 Ga0075363_100223294 3300006048 Bacteria 1080
90 Ga0075364_10020914 3300006051 Bacteria 4120
91 Ga0075364_10062662 3300006051 Bacteria 2440
92 Ga0075364_10154035 3300006051 Bacteria 1549
93 Ga0075364_10243461 3300006051 Bacteria 1222
94 Ga0070715_10000012 3300006163 Bacteria 173731
95 Ga0075428_100072976 3300006844 Bacteria 3747
96 Ga0075430_100001324 3300006846 Bacteria 19981
97 Ga0075431_100016528 3300006847 Bacteria 7490
98 Ga0075431_100035831 3300006847 Bacteria 5108
99 Ga0075433_10005706 3300006852 Bacteria 9790
100 Ga0075433_10048147 3300006852 Bacteria 3707
101 Ga0075434_100020449 3300006871 Bacteria 6422
102 Ga0075434_100257320 3300006871 Bacteria 1764
103 Ga0075434_100452614 3300006871 Bacteria 1305
104 Ga0075429_100026461 3300006880 Bacteria 5037
105 Ga0075436_100084824 3300006914 Bacteria 2198
106 Ga0075435_100207612 3300007076 Bacteria 1661
107 Ga0111539_10003410 3300009094 Bacteria 20938
108 Ga0105245_10000091 3300009098 Bacteria 89925
109 Ga0105245_10001248 3300009098 Bacteria 22969
110 Ga0105245_10521527 3300009098 Bacteria 1207
111 Ga0105247_10000208 3300009101 Bacteria 56889
112 Ga0105247_10100586 3300009101 Bacteria 1848
113 Ga0105247_10376825 3300009101 Bacteria 1005
114 Ga0114129_10087057 3300009147 Bacteria 4333
115 Ga0114129_10093399 3300009147 Bacteria 4167
116 Ga0114129_10536356 3300009147 Bacteria 1524
117 Ga0114129_10646069 3300009147 Bacteria 1366
118 Ga0114129_11502227 3300009147 Bacteria 828
119 Ga0105243_10080664 3300009148 Bacteria 2654
120 Ga0105242_10001420 3300009176 Bacteria 18882
121 Ga0105242_10062051 3300009176 Bacteria 3075
122 Ga0105242_10124952 3300009176 Bacteria 2213
123 Ga0105242_10142166 3300009176 Bacteria 2084
124 Ga0105248_10025218 3300009177 Bacteria 6610
125 Ga0105248_10628225 3300009177 Bacteria 1212
126 Ga0105238_10000028 3300009551 Bacteria 188361
127 Ga0105249_10000192 3300009553 Bacteria 69997
128 Ga0105249_10265240 3300009553 Bacteria 1708
129 Ga0105239_10164698 3300010375 Bacteria 2479
130 Ga0157371_10012496 3300013102 Bacteria 6488
131 Ga0157370_10006452 3300013104 Bacteria 12942
132 Ga0157370_10194592 3300013104 Bacteria 1882
133 Ga0157369_10000128 3300013105 Bacteria 108576
134 Ga0157374_10009691 3300013296 Bacteria 8272
135 Ga0157374_10122228 3300013296 Bacteria 2514
136 Ga0157378_10015777 3300013297 Bacteria 6615
137 Ga0157378_10045890 3300013297 Bacteria 3884
138 Ga0157378_10186776 3300013297 Bacteria 1953
139 Ga0163162_10798205 3300013306 Bacteria 1061
140 Ga0157372_10000121 3300013307 Bacteria 83548
141 Ga0157372_10691489 3300013307 Bacteria 1187
142 Ga0157375_10000322 3300013308 Bacteria 42941
143 Ga0157375_10071829 3300013308 Bacteria 3476
144 Ga0163163_10500940 3300014325 Bacteria 1276
145 Ga0157380_10007477 3300014326 Bacteria 7757
146 Ga0157379_10017712 3300014968 Bacteria 6276
147 Ga0157379_10129624 3300014968 Bacteria 2269
148 Ga0157376_10007555 3300014969 Bacteria 7771
149 Ga0157376_10036952 3300014969 Bacteria 3960
150 Ga0163161_10000073 3300017792 Bacteria 102053
151 Ga0207656_10007456 3300025321 Bacteria 3983
152 Ga0207682_10000003 3300025893 Bacteria 128548
153 Ga0207692_10000012 3300025898 Bacteria 104402
154 Ga0207642_10000001 3300025899 Bacteria 714030
155 Ga0207642_10000003 3300025899 Bacteria 650651
156 Ga0207642_10000004 3300025899 Bacteria 407822
157 Ga0207642_10000399 3300025899 Bacteria 13040
158 Ga0207710_10000112 3300025900 Bacteria 103005
159 Ga0207710_10039837 3300025900 Bacteria 2080
160 Ga0207680_10045139 3300025903 Bacteria 2596
161 Ga0207685_10000001 3300025905 Bacteria 604473
162 Ga0207705_10235383 3300025909 Bacteria 1394
163 Ga0207707_10275492 3300025912 Bacteria 1458
164 Ga0207693_10067789 3300025915 Bacteria 2794
165 Ga0207663_10001084 3300025916 Bacteria 12491
166 Ga0207663_10034049 3300025916 Bacteria 3042
167 Ga0207660_10233550 3300025917 Bacteria 1447
168 Ga0207652_10000351 3300025921 Bacteria 47656
169 Ga0207646_10115118 3300025922 Bacteria 2415
170 Ga0207681_10003096 3300025923 Bacteria 10448
171 Ga0207694_10000008 3300025924 Bacteria 484902
172 Ga0207659_10000082 3300025926 Bacteria 57573
173 Ga0207687_10000012 3300025927 Bacteria 370729
174 Ga0207687_10000042 3300025927 Bacteria 108169
175 Ga0207687_10000613 3300025927 Bacteria 24053
176 Ga0207687_10015756 3300025927 Bacteria 4961
177 Ga0207687_10042455 3300025927 Bacteria 3129
178 Ga0207687_10135120 3300025927 Bacteria 1864
179 Ga0207700_10000032 3300025928 Bacteria 125088
180 Ga0207700_10246554 3300025928 Bacteria 1524
181 Ga0207664_10000152 3300025929 Bacteria 55754
182 Ga0207664_10018628 3300025929 Bacteria 5116
183 Ga0207690_10000136 3300025932 Bacteria 59789
184 Ga0207690_10001263 3300025932 Bacteria 16002
185 Ga0207690_10058559 3300025932 Bacteria 2606
186 Ga0207706_10000006 3300025933 Bacteria 216994
187 Ga0207706_10546993 3300025933 Bacteria 997
188 Ga0207686_10000418 3300025934 Bacteria 28994
189 Ga0207686_10105787 3300025934 Bacteria 1888
190 Ga0207686_10138687 3300025934 Bacteria 1678
191 Ga0207709_10045498 3300025935 Bacteria 2658
192 Ga0207669_10000016 3300025937 Bacteria 124532
193 Ga0207669_10000023 3300025937 Bacteria 96638
194 Ga0207669_10825492 3300025937 Bacteria 770
195 Ga0207711_10000085 3300025941 Bacteria 99467
196 Ga0207661_10035386 3300025944 Bacteria 3891
197 Ga0207661_10569965 3300025944 Bacteria 1038
198 Ga0207667_10084023 3300025949 Bacteria 3296
199 Ga0207651_10001007 3300025960 Bacteria 12456
200 Ga0207651_10068647 3300025960 Bacteria 2500
201 Ga0207712_10000003 3300025961 Bacteria 615314
202 Ga0207712_10053990 3300025961 Bacteria 2821
203 Ga0207712_10135760 3300025961 Bacteria 1881
204 Ga0207668_10005870 3300025972 Bacteria 7232
205 Ga0207640_10000026 3300025981 Bacteria 142343
206 Ga0207640_10086381 3300025981 Bacteria 2160
207 Ga0207658_10006209 3300025986 Bacteria 8161
208 Ga0207677_10001351 3300026023 Bacteria 13129
209 Ga0207677_10008339 3300026023 Bacteria 5783
210 Ga0207677_10085837 3300026023 Bacteria 2273
211 Ga0207703_10000053 3300026035 Bacteria 143924
212 Ga0207703_10057036 3300026035 Bacteria 3183
213 Ga0207639_10004562 3300026041 Bacteria 9330
214 Ga0207639_10117940 3300026041 Bacteria 2176
215 Ga0207678_10288539 3300026067 Bacteria 1409
216 Ga0207708_10119436 3300026075 Bacteria 2053
217 Ga0207708_10365092 3300026075 Bacteria 1187
218 Ga0207708_10806053 3300026075 Bacteria 809
219 Ga0207702_10014458 3300026078 Bacteria 6553
220 Ga0207641_10000071 3300026088 Bacteria 151812
221 Ga0207641_10151451 3300026088 Bacteria 2101
222 Ga0207648_10001595 3300026089 Bacteria 24839
223 Ga0207683_10015745 3300026121 Bacteria 6435
224 Ga0207683_10224990 3300026121 Bacteria 1710
225 Ga0207698_10000009 3300026142 Bacteria 281300
226 Ga0207428_10095217 3300027907 Bacteria 2307
227 Ga0268266_10001388 3300028379 Bacteria 29082
228 Ga0268264_10153201 3300028381 Bacteria 2069
229 Ga0316576_10002289 3300031727 Bacteria 10851
230 Ga0307413_10538390 3300031824 Bacteria 945
231 Ga0307410_10058171 3300031852 Bacteria 2635
232 Ga0307410_10304548 3300031852 Unclassified 1259
233 Ga0307416_100004826 3300032002 Bacteria 8199
234 Ga0307415_100004509 3300032126 Bacteria 7242
235 Ga0373944_0141765 3300035089 Bacteria 842
236 Ga0373955_0307034 3300035172 Bacteria 957
237 Ga0373962_0075575 3300035242 Bacteria 1014
238 Ga0316574_0016641 3300035398 Bacteria 4288
239 Ga0316574_0347627 3300035398 Bacteria 938
240 Ga0373935_0488667 3300035692 Bacteria 893
241 Ga0373937_0048524 3300036401 Bacteria 3887
242 Ga0316582_0051975 3300036647 Bacteria 2603
243 Ga0316584_0089517 3300036712 Bacteria 2304
244 Ga0395900_0181316 3300037418 Bacteria 2140
245 Ga0395900_0419536 3300037418 Bacteria 1299
246 Ga0395898_0011942 3300037466 Bacteria 8995
247 Ga0395898_0242516 3300037466 Bacteria 1719
248 Ga0395905_0146324 3300037471 Bacteria 2223
249 Ga0436364_0006632 3300037853 Bacteria 988
250 Ga0436364_0838148 3300037853 Bacteria 1496
251 Ga0395901_0006154 3300038443 Bacteria 12161
252 Ga0395901_0043088 3300038443 Bacteria 4682
253 Ga0395901_0217886 3300038443 Bacteria 1996
254 Ga0395901_0552508 3300038443 Bacteria 1167
255 Ga0395901_0735013 3300038443 Bacteria 981
256 Ga0451853_2464716 3300041512 Bacteria 4167
257 Ga0451853_2704406 3300041512 Bacteria 1230
258 Ga0466963_0000406 3300044694 Bacteria 19714
259 Ga0466963_0028153 3300044694 Bacteria 3605
260 Ga0466964_0110796 3300044706 Bacteria 1224
261 Ga0466957_0011588 3300044842 Bacteria 5094
262 Ga0466957_0221486 3300044842 Bacteria 1249
263 Ga0466967_0000007 3300045976 Bacteria 135597
264 Ga0466967_0925125 3300045976 Bacteria 867
265 Ga0495592_0008905 3300046454 Bacteria 7538
266 Ga0495603_0000291 3300046455 Bacteria 26643
267 Ga0495603_0028933 3300046455 Bacteria 3342
268 Ga0495603_0125745 3300046455 Bacteria 1494
269 Ga0495641_0006476 3300046461 Bacteria 7578
270 Ga0495651_0124966 3300046462 Bacteria 1885
271 Ga0495653_0139591 3300046463 Bacteria 1706
272 Ga0495653_0167980 3300046463 Bacteria 1517
273 Ga0495582_0000007 3300046473 Bacteria 139882
274 Ga0495582_0208166 3300046473 Bacteria 1118
275 Ga0495662_0007156 3300046476 Bacteria 5529
276 Ga0495662_0009062 3300046476 Bacteria 4887
277 Ga0495594_0000005 3300046499 Bacteria 175437
278 Ga0495608_0000063 3300046511 Bacteria 83763
279 Ga0495608_0001675 3300046511 Bacteria 15943
280 Ga0495608_0088589 3300046511 Bacteria 2003
281 Ga0495618_0000003 3300046514 Bacteria 256269
282 Ga0495618_0248980 3300046514 Bacteria 1115
283 Ga0495620_0000446 3300046515 Bacteria 27496
284 Ga0495628_0025908 3300046516 Bacteria 4789
285 Ga0495628_0068055 3300046516 Bacteria 2779
286 Ga0495628_0069383 3300046516 Bacteria 2749
287 Ga0495628_0073836 3300046516 Bacteria 2657
288 Ga0495628_0282640 3300046516 Bacteria 1232
289 Ga0495630_0000007 3300046517 Bacteria 376915
290 Ga0495644_0036832 3300046523 Bacteria 1845
291 Ga0495640_0063483 3300046533 Bacteria 2501
292 Ga0495586_0000384 3300046535 Bacteria 27060
293 Ga0495587_0084393 3300046536 Bacteria 1839
294 Ga0495587_0097577 3300046536 Bacteria 1694
295 Ga0495598_0102383 3300046537 Bacteria 949
296 Ga0495621_0002454 3300046539 Bacteria 4998
297 Ga0495622_0000026 3300046557 Bacteria 137934
298 Ga0495633_0061641 3300046558 Bacteria 1756
299 Ga0495667_0093086 3300046559 Bacteria 1951
300 Ga0495656_0001151 3300046615 Bacteria 8575
301 Ga0495634_0000125 3300046642 Bacteria 65586
302 Ga0495634_0181222 3300046642 Bacteria 1318
303 Ga0495625_0000319 3300046660 Bacteria 73241
304 Ga0495635_0000009 3300046663 Bacteria 259024
305 Ga0495635_0005067 3300046663 Bacteria 9160
306 Ga0495588_0000241 3300046674 Bacteria 46762
307 Ga0495657_0000084 3300046675 Bacteria 83088
308 Ga0495657_0010871 3300046675 Bacteria 6833
309 Ga0495599_0180047 3300046678 Bacteria 1303
310 Ga0495647_0000014 3300046681 Bacteria 87792
311 Ga0495647_0018797 3300046681 Bacteria 2465
312 Ga0495647_0072893 3300046681 Bacteria 1378
313 Ga0495658_0000007 3300046683 Bacteria 139822
314 Ga0495658_0035444 3300046683 Bacteria 2745
315 Ga0495669_0000074 3300046684 Bacteria 66373
316 Ga0495669_0140237 3300046684 Bacteria 1141
317 Ga0495613_0000003 3300046689 Bacteria 248826
318 Ga0495613_0000522 3300046689 Bacteria 32082
319 Ga0495613_0077335 3300046689 Bacteria 2421
320 Ga0495613_0101200 3300046689 Bacteria 2081
321 Ga0495624_0000002 3300046690 Bacteria 189957
322 Ga0495624_0000256 3300046690 Bacteria 42059
323 Ga0495624_0080088 3300046690 Bacteria 2024
324 Ga0495670_0012536 3300046691 Bacteria 4171
325 Ga0495600_0056852 3300046809 Bacteria 2556
326 Ga0495604_0000344 3300047317 Bacteria 41631
327 Ga0495672_0162348 3300047320 Bacteria 1147
328 Ga0495676_0001046 3300047321 Bacteria 23385
329 Ga0495676_0002096 3300047321 Bacteria 17584
330 Ga0495676_0056079 3300047321 Bacteria 3118
331 Ga0495676_0223929 3300047321 Bacteria 1295
332 Ga0495680_0015114 3300047322 Bacteria 6666
333 Ga0495680_0026325 3300047322 Bacteria 4798
334 Ga0495680_0132401 3300047322 Bacteria 1831
335 Ga0495675_0002313 3300047444 Bacteria 11383
336 Ga0495679_004836 3300047446 Bacteria 6089
337 Ga0495679_034042 3300047446 Bacteria 1624
338 Ga0495673_0087938 3300047469 Bacteria 1274
339 Ga0495602_0000008 3300048088 Bacteria 260157
340 Ga0495602_0274249 3300048088 Bacteria 1245
341 Ga0495602_0302337 3300048088 Bacteria 1170
342 Ga0496100_0000008 3300048903 Bacteria 231974
343 Ga0496100_0000016 3300048903 Bacteria 166058
344 Ga0496100_0010247 3300048903 Bacteria 5301
345 Ga0496101_0000016 3300048904 Bacteria 240753
346 Ga0496101_0000038 3300048904 Bacteria 166058
347 Ga0496101_0006747 3300048904 Bacteria 7404
348 Ga0496101_0010480 3300048904 Bacteria 6121
349 Ga0496101_0408257 3300048904 Bacteria 1070
350 Ga0496102_0032211 3300048905 Bacteria 4709
351 Ga0496102_0225610 3300048905 Bacteria 1766
352 Ga0496102_0257176 3300048905 Bacteria 1646
353 Ga0496102_0570907 3300048905 Bacteria 1054
354 Ga0496103_0005433 3300048906 Bacteria 7627
355 Ga0496103_0015379 3300048906 Bacteria 4551
356 Ga0496104_0000003 3300048907 Bacteria 669219
357 Ga0496104_0000007 3300048907 Bacteria 524804
358 Ga0496104_0046511 3300048907 Bacteria 4087
359 Ga0496104_0047597 3300048907 Bacteria 4041
360 Ga0496105_0000002 3300048908 Bacteria 753215
361 Ga0496105_0000008 3300048908 Bacteria 335652
362 Ga0496105_0048908 3300048908 Bacteria 3490
363 Ga0496105_0204200 3300048908 Bacteria 1612
364 Ga0496106_0000013 3300048909 Bacteria 202263
365 Ga0496106_0000027 3300048909 Bacteria 149560
366 Ga0496106_0000117 3300048909 Bacteria 60781
367 Ga0496106_0025279 3300048909 Bacteria 4418
368 Ga0496106_0064237 3300048909 Bacteria 2792
369 Ga0496106_0151767 3300048909 Bacteria 1828
370 Ga0496106_0552666 3300048909 Bacteria 924
371 Ga0496106_0584497 3300048909 Bacteria 895
372 Ga0496107_0000003 3300048910 Bacteria 304038
373 Ga0496107_0000009 3300048910 Bacteria 231682
374 Ga0496107_0021890 3300048910 Bacteria 4516
375 Ga0496107_0187260 3300048910 Bacteria 1537
376 Ga0496107_0311735 3300048910 Bacteria 1171
377 Ga0496108_0000002 3300048911 Bacteria 700890
378 Ga0496108_0000221 3300048911 Bacteria 51191
379 Ga0496108_0012619 3300048911 Bacteria 6884
380 Ga0496109_0000001 3300048912 Bacteria 700852
381 Ga0496109_0000195 3300048912 Bacteria 60380
382 Ga0496109_0021685 3300048912 Bacteria 5684
383 Ga0496109_0022549 3300048912 Bacteria 5578
384 Ga0496109_0025389 3300048912 Bacteria 5280
385 Ga0496109_0156158 3300048912 Bacteria 2137
386 Ga0496110_0000004 3300048913 Bacteria 122867
387 Ga0496110_0008159 3300048913 Bacteria 8414
388 Ga0496110_0021145 3300048913 Bacteria 5501
389 Ga0496110_0023808 3300048913 Bacteria 5212
390 Ga0496110_0041184 3300048913 Bacteria 4030
391 Ga0496110_0369685 3300048913 Bacteria 1306
392 Ga0496111_0000002 3300048914 Bacteria 135794
393 Ga0496111_0020437 3300048914 Bacteria 4609
394 Ga0496111_0034184 3300048914 Bacteria 3629
395 Ga0496111_0043781 3300048914 Bacteria 3218
396 Ga0496111_0078141 3300048914 Bacteria 2413
397 Ga0496112_0000002 3300048915 Bacteria 782039
398 Ga0496112_0057803 3300048915 Bacteria 3819
399 Ga0496112_0072463 3300048915 Bacteria 3405
400 Ga0496112_0368092 3300048915 Bacteria 1379
401 Ga0496112_0394041 3300048915 Bacteria 1325
402 Ga0496113_0000012 3300048916 Bacteria 81903
403 Ga0496113_0017111 3300048916 Bacteria 5026
404 Ga0496113_0102310 3300048916 Bacteria 2221
405 Ga0496113_0159901 3300048916 Bacteria 1780
406 Ga0496114_0000010 3300048917 Bacteria 363396
407 Ga0496114_0160307 3300048917 Bacteria 1955
408 Ga0496114_0245948 3300048917 Bacteria 1573
409 Ga0496115_0006755 3300048918 Bacteria 8414
410 Ga0496115_0011379 3300048918 Bacteria 6667
411 Ga0496119_0013117 3300048922 Bacteria 6637
412 Ga0496119_0030465 3300048922 Bacteria 3636
413 Ga0496119_0266025 3300048922 Bacteria 858
414 Ga0496120_0058866 3300048923 Bacteria 2156
415 Ga0496121_0165630 3300048924 Bacteria 1611
416 Ga0496121_0346727 3300048924 Bacteria 990
417 Ga0501034_0061317 3300049571 Bacteria 3777
418 Ga0501034_0273475 3300049571 Bacteria 1630
419 Ga0501034_0706775 3300049571 Bacteria 906
420 Ga0501036_0338011 3300049572 Bacteria 1258
421 Ga0501040_0124115 3300049576 Bacteria 1813
422 Ga0501042_0048403 3300049578 Bacteria 3031
423 Ga0501042_0140228 3300049578 Bacteria 1743
424 Ga0501042_0212404 3300049578 Bacteria 1396
425 Ga0501046_0199308 3300049580 Bacteria 1490
426 Ga0501068_0149282 3300049584 Bacteria 1468
427 Ga0501068_0230148 3300049584 Bacteria 1179
428 Ga0501069_0034626 3300049585 Bacteria 2781
429 Ga0501070_0049672 3300049586 Bacteria 3483
430 Ga0501071_0151842 3300049587 Bacteria 1728
431 Ga0501071_0201718 3300049587 Bacteria 1494
432 Ga0501071_0761511 3300049587 Bacteria 746
433 Ga0501072_0614533 3300049588 Bacteria 856
434 Ga0501073_0039098 3300049589 Bacteria 3362
435 Ga0501075_0004569 3300049591 Bacteria 9381
436 Ga0501077_0275229 3300049593 Bacteria 1071
437 Ga0501077_0382408 3300049593 Bacteria 899
438 Ga0501079_0151927 3300049741 Bacteria 1805
439 Ga0501079_0196406 3300049741 Bacteria 1575
440 Ga0501079_0304427 3300049741 Bacteria 1247
441 Ga0501080_0065264 3300049742 Bacteria 3386
442 Ga0501081_0166745 3300049743 Bacteria 1589
443 nmdc:mga03n38_26941_c1 3300050490 Bacteria 2379
444 nmdc:mga03n38_49767_c1 3300050490 Bacteria 1865
445 nmdc:mga00v17_23914_c1 3300050491 Bacteria 3539
446 nmdc:mga00v17_51679_c1 3300050491 Bacteria 2499
447 nmdc:mga00v17_61717_c1 3300050491 Bacteria 2304
448 nmdc:mga00v17_69550_c1 3300050491 Bacteria 2179
449 nmdc:mga0yw44_2101_c1 3300050492 Bacteria 8335
450 nmdc:mga0yw44_47442_c1 3300050492 Bacteria 2586
451 nmdc:mga0yw44_601382_c1 3300050492 Bacteria 747
452 nmdc:mga0yw44_6253_c1 3300050492 Bacteria 5735
453 nmdc:mga0yw44_643193_c1 3300050492 Bacteria 721
454 nmdc:mga0yw44_8125_c1 3300050492 Bacteria 3894
455 nmdc:mga0yw44_84108_c1 3300050492 Bacteria 2000
456 nmdc:mga0yw44_9862_c2 3300050492 Bacteria 3026
457 nmdc:mga06z11_92190_c1 3300050494 Bacteria 1647
458 nmdc:mga06z11_96933_c2 3300050494 Bacteria 1199
459 nmdc:mga05p37_284766_c1 3300050507 Bacteria 1969
460 nmdc:mga05p37_70250_c1 3300050507 Bacteria 4307
461 nmdc:mga05p37_75060_c1 3300050507 Bacteria 4162
462 nmdc:mga09592_19872_c1 3300050508 Bacteria 5517
463 nmdc:mga0qj67_40200_c1 3300050509 Bacteria 3676
464 nmdc:mga06r32_117551_c1 3300050510 Bacteria 2621
465 nmdc:mga08y16_150556_c1 3300050511 Bacteria 2419
466 nmdc:mga0n895_256774_c1 3300050512 Bacteria 1774
467 nmdc:mga0n895_2713_c1 3300050512 Bacteria 13966
468 nmdc:mga0rr50_393985_c1 3300050513 Bacteria 1169
469 nmdc:mga0a205_104938_c1 3300050515 Bacteria 2725
470 nmdc:mga0a205_124_c2 3300050515 Bacteria 20732
471 nmdc:mga0a205_64461_c1 3300050515 Bacteria 3539
472 Ga0495601_0000080 3300053077 Bacteria 51518
473 Ga0495601_0000098 3300053077 Bacteria 48076
474 Ga0495601_0109523 3300053077 Bacteria 1788
475 Ga0495601_0205747 3300053077 Bacteria 1286
476 Ga0495612_0000358 3300053078 Bacteria 18497
477 Ga0495612_0007035 3300053078 Bacteria 4601
478 Ga0495595_0000001 3300053084 Bacteria 495226
479 Ga0495595_0000069 3300053084 Bacteria 50835
480 Ga0495595_0020242 3300053084 Bacteria 2895
481 Ga0495619_0000024 3300053085 Bacteria 180821
482 Ga0495619_0000038 3300053085 Bacteria 121365
483 Ga0495619_0000065 3300053085 Bacteria 83763
484 Ga0495619_0000269 3300053085 Bacteria 37723
485 Ga0495619_0022766 3300053085 Bacteria 4012
486 Ga0495619_0035122 3300053085 Bacteria 3260
487 Ga0501084_0266126 3300054114 Bacteria 1447
488 Ga0501082_0267788 3300060353 Bacteria 1487
489 Ga0075430_100565194
490 JGI24746J21847_1001719
491 JGI24740J21852_10000392
492 JGI24748J21848_1000538
493 JGI24742J22300_10000434
494 Ga0070658_10074207
495 Ga0070683_100022585
496 Ga0070666_10013549
497 Ga0070666_10352669
498 Ga0070682_100000057
499 Ga0070682_100000100
500 Ga0070682_100033235
501 Ga0068868_100010651
502 Ga0068868_100013863
503 Ga0070689_100077260
504 Ga0070669_100004860
505 Ga0070675_100000073
506 Ga0070674_100000003
507 Ga0070674_100341218
508 Ga0070674_100904014
509 Ga0070673_100010571
510 Ga0070688_100000848
511 Ga0070659_100000018
512 Ga0070667_100006805
513 Ga0070667_100957454
514 Ga0070709_10195932
515 Ga0070714_100000151
516 Ga0070714_100014803
517 Ga0070710_10000012
518 Ga0070711_100023476
519 Ga0070705_100043031
520 Ga0070705_100162107
521 Ga0070678_100007766
522 Ga0070662_100000005
523 Ga0070681_10003375
524 Ga0068867_100000254
525 Ga0070685_10000932
526 Ga0070685_10469894
527 Ga0070679_100012299
528 Ga0070684_100023911
529 Ga0070684_100188454
530 Ga0070684_100260095
531 Ga0068853_100981230
532 Ga0070672_100576233
533 Ga0070686_100012725
534 Ga0070695_100243115
535 Ga0070696_100397172
536 Ga0070693_100000815
537 Ga0070665_100003550
538 Ga0070665_100289460
539 Ga0070704_100043643
540 Ga0070704_100306827
541 Ga0068855_100148117
542 Ga0068854_100000563
543 Ga0068854_100023958
544 Ga0068856_100200215
545 Ga0068852_100000103
546 Ga0068866_10000002
547 Ga0068866_10000816
548 Ga0068866_10121382
549 Ga0068851_10047118
550 Ga0068863_100000032
551 Ga0068863_100273417
552 Ga0068858_100000043
553 Ga0068858_100096586
554 Ga0068858_100150120
555 Ga0068860_100076356
556 Ga0068860_100271622
557 Ga0068862_100128748
558 Ga0081455_10005032
559 Ga0081455_10015890
560 Ga0081455_10033815
561 Ga0081455_10214526
562 Ga0081538_10003370
563 Ga0081540_1000025
564 Ga0081540_1070384
565 Ga0081540_1095549
566 Ga0081539_10106845
567 Ga0070717_10000032
568 Ga0075365_10000210
569 Ga0075365_10035478
570 Ga0075365_10160000
571 Ga0075365_10271132
572 Ga0075365_10310371
573 Ga0075365_10329949
574 Ga0075363_100034627
575 Ga0075363_100052675
576 Ga0075363_100083565
577 Ga0075363_100223294
578 Ga0075364_10020914
579 Ga0075364_10062662
580 Ga0075364_10154035
581 Ga0075364_10243461
582 Ga0070715_10000012
583 Ga0075428_100072976
584 Ga0075430_100001324
585 Ga0075431_100016528
586 Ga0075431_100035831
587 Ga0075433_10005706
588 Ga0075433_10048147
589 Ga0075434_100020449
590 Ga0075434_100257320
591 Ga0075434_100452614
592 Ga0075429_100026461
593 Ga0075436_100084824
594 Ga0075435_100207612
595 Ga0111539_10003410
596 Ga0105245_10000091
597 Ga0105245_10001248
598 Ga0105245_10521527
599 Ga0105247_10000208
600 Ga0105247_10100586
601 Ga0105247_10376825
602 Ga0114129_10087057
603 Ga0114129_10093399
604 Ga0114129_10536356
605 Ga0114129_10646069
606 Ga0114129_11502227
607 Ga0105243_10080664
608 Ga0105242_10001420
609 Ga0105242_10062051
610 Ga0105242_10124952
611 Ga0105242_10142166
612 Ga0105248_10025218
613 Ga0105248_10628225
614 Ga0105238_10000028
615 Ga0105249_10000192
616 Ga0105249_10265240
617 Ga0105239_10164698
618 Ga0157371_10012496
619 Ga0157370_10006452
620 Ga0157370_10194592
621 Ga0157369_10000128
622 Ga0157374_10009691
623 Ga0157374_10122228
624 Ga0157378_10015777
625 Ga0157378_10045890
626 Ga0157378_10186776
627 Ga0163162_10798205
628 Ga0157372_10000121
629 Ga0157372_10691489
630 Ga0157375_10000322
631 Ga0157375_10071829
632 Ga0163163_10500940
633 Ga0157380_10007477
634 Ga0157379_10017712
635 Ga0157379_10129624
636 Ga0157376_10007555
637 Ga0157376_10036952
638 Ga0163161_10000073
639 Ga0207656_10007456
640 Ga0207682_10000003
641 Ga0207692_10000012
642 Ga0207642_10000001
643 Ga0207642_10000003
644 Ga0207642_10000004
645 Ga0207642_10000399
646 Ga0207710_10000112
647 Ga0207710_10039837
648 Ga0207680_10045139
649 Ga0207685_10000001
650 Ga0207705_10235383
651 Ga0207707_10275492
652 Ga0207693_10067789
653 Ga0207663_10001084
654 Ga0207663_10034049
655 Ga0207660_10233550
656 Ga0207652_10000351
657 Ga0207646_10115118
658 Ga0207681_10003096
659 Ga0207694_10000008
660 Ga0207659_10000082
661 Ga0207687_10000012
662 Ga0207687_10000042
663 Ga0207687_10000613
664 Ga0207687_10015756
665 Ga0207687_10042455
666 Ga0207687_10135120
667 Ga0207700_10000032
668 Ga0207700_10246554
669 Ga0207664_10000152
670 Ga0207664_10018628
671 Ga0207690_10000136
672 Ga0207690_10001263
673 Ga0207690_10058559
674 Ga0207706_10000006
675 Ga0207706_10546993
676 Ga0207686_10000418
677 Ga0207686_10105787
678 Ga0207686_10138687
679 Ga0207709_10045498
680 Ga0207669_10000016
681 Ga0207669_10000023
682 Ga0207669_10825492
683 Ga0207711_10000085
684 Ga0207661_10035386
685 Ga0207661_10569965
686 Ga0207667_10084023
687 Ga0207651_10001007
688 Ga0207651_10068647
689 Ga0207712_10000003
690 Ga0207712_10053990
691 Ga0207712_10135760
692 Ga0207668_10005870
693 Ga0207640_10000026
694 Ga0207640_10086381
695 Ga0207658_10006209
696 Ga0207677_10001351
697 Ga0207677_10008339
698 Ga0207677_10085837
699 Ga0207703_10000053
700 Ga0207703_10057036
701 Ga0207639_10004562
702 Ga0207639_10117940
703 Ga0207678_10288539
704 Ga0207708_10119436
705 Ga0207708_10365092
706 Ga0207708_10806053
707 Ga0207702_10014458
708 Ga0207641_10000071
709 Ga0207641_10151451
710 Ga0207648_10001595
711 Ga0207683_10015745
712 Ga0207683_10224990
713 Ga0207698_10000009
714 Ga0207428_10095217
715 Ga0268266_10001388
716 Ga0268264_10153201
717 Ga0316576_10002289
718 Ga0307413_10538390
719 Ga0307410_10058171
720 Ga0307410_10304548
721 Ga0307416_100004826
722 Ga0307415_100004509
723 Ga0373944_0141765
724 Ga0373955_0307034
725 Ga0373962_0075575
726 Ga0316574_0016641
727 Ga0316574_0347627
728 Ga0373935_0488667
729 Ga0373937_0048524
730 Ga0316582_0051975
731 Ga0316584_0089517
732 Ga0395900_0181316
733 Ga0395900_0419536
734 Ga0395898_0011942
735 Ga0395898_0242516
736 Ga0395905_0146324
737 Ga0436364_0006632
738 Ga0436364_0838148
739 Ga0395901_0006154
740 Ga0395901_0043088
741 Ga0395901_0217886
742 Ga0395901_0552508
743 Ga0395901_0735013
744 Ga0451853_2464716
745 Ga0451853_2704406
746 Ga0466963_0000406
747 Ga0466963_0028153
748 Ga0466964_0110796
749 Ga0466957_0011588
750 Ga0466957_0221486
751 Ga0466967_0000007
752 Ga0466967_0925125
753 Ga0495592_0008905
754 Ga0495603_0000291
755 Ga0495603_0028933
756 Ga0495603_0125745
757 Ga0495641_0006476
758 Ga0495651_0124966
759 Ga0495653_0139591
760 Ga0495653_0167980
761 Ga0495582_0000007
762 Ga0495582_0208166
763 Ga0495662_0007156
764 Ga0495662_0009062
765 Ga0495594_0000005
766 Ga0495608_0000063
767 Ga0495608_0001675
768 Ga0495608_0088589
769 Ga0495618_0000003
770 Ga0495618_0248980
771 Ga0495620_0000446
772 Ga0495628_0025908
773 Ga0495628_0068055
774 Ga0495628_0069383
775 Ga0495628_0073836
776 Ga0495628_0282640
777 Ga0495630_0000007
778 Ga0495644_0036832
779 Ga0495640_0063483
780 Ga0495586_0000384
781 Ga0495587_0084393
782 Ga0495587_0097577
783 Ga0495598_0102383
784 Ga0495621_0002454
785 Ga0495622_0000026
786 Ga0495633_0061641
787 Ga0495667_0093086
788 Ga0495656_0001151
789 Ga0495634_0000125
790 Ga0495634_0181222
791 Ga0495625_0000319
792 Ga0495635_0000009
793 Ga0495635_0005067
794 Ga0495588_0000241
795 Ga0495657_0000084
796 Ga0495657_0010871
797 Ga0495599_0180047
798 Ga0495647_0000014
799 Ga0495647_0018797
800 Ga0495647_0072893
801 Ga0495658_0000007
802 Ga0495658_0035444
803 Ga0495669_0000074
804 Ga0495669_0140237
805 Ga0495613_0000003
806 Ga0495613_0000522
807 Ga0495613_0077335
808 Ga0495613_0101200
809 Ga0495624_0000002
810 Ga0495624_0000256
811 Ga0495624_0080088
812 Ga0495670_0012536
813 Ga0495600_0056852
814 Ga0495604_0000344
815 Ga0495672_0162348
816 Ga0495676_0001046
817 Ga0495676_0002096
818 Ga0495676_0056079
819 Ga0495676_0223929
820 Ga0495680_0015114
821 Ga0495680_0026325
822 Ga0495680_0132401
823 Ga0495675_0002313
824 Ga0495679_004836
825 Ga0495679_034042
826 Ga0495673_0087938
827 Ga0495602_0000008
828 Ga0495602_0274249
829 Ga0495602_0302337
830 Ga0496100_0000008
831 Ga0496100_0000016
832 Ga0496100_0010247
833 Ga0496101_0000016
834 Ga0496101_0000038
835 Ga0496101_0006747
836 Ga0496101_0010480
837 Ga0496101_0408257
838 Ga0496102_0032211
839 Ga0496102_0225610
840 Ga0496102_0257176
841 Ga0496102_0570907
842 Ga0496103_0005433
843 Ga0496103_0015379
844 Ga0496104_0000003
845 Ga0496104_0000007
846 Ga0496104_0046511
847 Ga0496104_0047597
848 Ga0496105_0000002
849 Ga0496105_0000008
850 Ga0496105_0048908
851 Ga0496105_0204200
852 Ga0496106_0000013
853 Ga0496106_0000027
854 Ga0496106_0000117
855 Ga0496106_0025279
856 Ga0496106_0064237
857 Ga0496106_0151767
858 Ga0496106_0552666
859 Ga0496106_0584497
860 Ga0496107_0000003
861 Ga0496107_0000009
862 Ga0496107_0021890
863 Ga0496107_0187260
864 Ga0496107_0311735
865 Ga0496108_0000002
866 Ga0496108_0000221
867 Ga0496108_0012619
868 Ga0496109_0000001
869 Ga0496109_0000195
870 Ga0496109_0021685
871 Ga0496109_0022549
872 Ga0496109_0025389
873 Ga0496109_0156158
874 Ga0496110_0000004
875 Ga0496110_0008159
876 Ga0496110_0021145
877 Ga0496110_0023808
878 Ga0496110_0041184
879 Ga0496110_0369685
880 Ga0496111_0000002
881 Ga0496111_0020437
882 Ga0496111_0034184
883 Ga0496111_0043781
884 Ga0496111_0078141
885 Ga0496112_0000002
886 Ga0496112_0057803
887 Ga0496112_0072463
888 Ga0496112_0368092
889 Ga0496112_0394041
890 Ga0496113_0000012
891 Ga0496113_0017111
892 Ga0496113_0102310
893 Ga0496113_0159901
894 Ga0496114_0000010
895 Ga0496114_0160307
896 Ga0496114_0245948
897 Ga0496115_0006755
898 Ga0496115_0011379
899 Ga0496119_0013117
900 Ga0496119_0030465
901 Ga0496119_0266025
902 Ga0496120_0058866
903 Ga0496121_0165630
904 Ga0496121_0346727
905 Ga0501034_0061317
906 Ga0501034_0273475
907 Ga0501034_0706775
908 Ga0501036_0338011
909 Ga0501040_0124115
910 Ga0501042_0048403
911 Ga0501042_0140228
912 Ga0501042_0212404
913 Ga0501046_0199308
914 Ga0501068_0149282
915 Ga0501068_0230148
916 Ga0501069_0034626
917 Ga0501070_0049672
918 Ga0501071_0151842
919 Ga0501071_0201718
920 Ga0501071_0761511
921 Ga0501072_0614533
922 Ga0501073_0039098
923 Ga0501075_0004569
924 Ga0501077_0275229
925 Ga0501077_0382408
926 Ga0501079_0151927
927 Ga0501079_0196406
928 Ga0501079_0304427
929 Ga0501080_0065264
930 Ga0501081_0166745
931 nmdc:mga03n38_26941_c1
932 nmdc:mga03n38_49767_c1
933 nmdc:mga00v17_23914_c1
934 nmdc:mga00v17_51679_c1
935 nmdc:mga00v17_61717_c1
936 nmdc:mga00v17_69550_c1
937 nmdc:mga0yw44_2101_c1
938 nmdc:mga0yw44_47442_c1
939 nmdc:mga0yw44_601382_c1
940 nmdc:mga0yw44_6253_c1
941 nmdc:mga0yw44_643193_c1
942 nmdc:mga0yw44_8125_c1
943 nmdc:mga0yw44_84108_c1
944 nmdc:mga0yw44_9862_c2
945 nmdc:mga06z11_92190_c1
946 nmdc:mga06z11_96933_c2
947 nmdc:mga05p37_284766_c1
948 nmdc:mga05p37_70250_c1
949 nmdc:mga05p37_75060_c1
950 nmdc:mga09592_19872_c1
951 nmdc:mga0qj67_40200_c1
952 nmdc:mga06r32_117551_c1
953 nmdc:mga08y16_150556_c1
954 nmdc:mga0n895_256774_c1
955 nmdc:mga0n895_2713_c1
956 nmdc:mga0rr50_393985_c1
957 nmdc:mga0a205_104938_c1
958 nmdc:mga0a205_124_c2
959 nmdc:mga0a205_64461_c1
960 Ga0495601_0000080
961 Ga0495601_0000098
962 Ga0495601_0109523
963 Ga0495601_0205747
964 Ga0495612_0000358
965 Ga0495612_0007035
966 Ga0495595_0000001
967 Ga0495595_0000069
968 Ga0495595_0020242
969 Ga0495619_0000024
970 Ga0495619_0000038
971 Ga0495619_0000065
972 Ga0495619_0000269
973 Ga0495619_0022766
974 Ga0495619_0035122
975 Ga0501084_0266126
976 Ga0501082_0267788

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01066

CDP-OH_P_transf

CDP-alcohol phosphatidyltransferase

47

211

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
5d92-assembly2.cif.gz_C structure of a phosphatidylinositolphosphate (pip) synthase from renibacterium salmoninarum 0.8113 22 202
6h53-assembly1.cif.gz_A crystal structure of mycobacterium tuberculosis phosphatidylinositol phosphate synthase (pgsa1) in apo form 0.7943 16 196
6h5a-assembly1.cif.gz_B crystal structure of mycobacterium tuberculosis phosphatidylinositol phosphate synthase (pgsa1) in complex with manganese and citrate 0.7889 16 197
6wm5-assembly1.cif.gz_A structure of a phosphatidylinositol-phosphate synthase (pips) from mycobacterium kansasii 0.781 11 194
6wmv-assembly1.cif.gz_A structure of a phosphatidylinositol-phosphate synthase (pips) from mycobacterium kansasii with evidence of substrate binding 0.7715 10 197
ID Description Score Start End Superfamily
af_P9WPG7_9_203_1.20.120.1760 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.819 16 197 1.20.120.1760
5d92A02 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.7714 11 202 1.20.120.1760
af_P9WPG7_9_203_1.20.120.1760 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.765 16 197 1.20.120.1760
af_P76226_9_202_1.20.120.1760 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.748 26 201 1.20.120.1760
4mndA02 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.7446 10 197 1.20.120.1760
ID Description Score Start End GO Terms
AF-A0A7W1ASY7-F1-model_v4 CDP-alcohol phosphatidyltransferase family protein 0.9386 35 202 GO:0008654
GO:0016020
GO:0016780
AF-A0A7V9BE61-F1-model_v4 CDP-alcohol phosphatidyltransferase family protein 0.9317 35 202 GO:0008654
GO:0016020
GO:0016780
AF-A0A7W1ASY7-F1-model_v4 CDP-alcohol phosphatidyltransferase family protein 0.9075 35 202 GO:0008654
GO:0016020
GO:0016780
AF-X0VL54-F1-model_v4 CDP-alcohol phosphatidyltransferase family protein 0.9035 32 203 GO:0008654
GO:0016020
GO:0016780
AF-A0A538D557-F1-model_v4 CDP-alcohol phosphatidyltransferase family protein 0.9 50 202 GO:0008654
GO:0016020
GO:0016780

Map