F453590

General Info

Members Datasets Scaffolds Average Seq Length
488 205 488 319

Family's Representative Sequence

Representative Sequence 3300006914|Ga0075436_100151060|Ga0075436_1001510602
Length 343
Sequence MPIELVAFVATVAAILTAYAAMTRLPGIIAARRLDRRLRDVTIRDTARVDAPARPVPGSRDDRMTDGDGPASSQTAAETVVKRRAEGPLPSLDRRLAASTLSRLIEQSGVPTTPSAILVICFGGGLAAGLAASVMVRQAFVAPIAALFGACAPIVFLMRRRTIRVKRFEEQFPEALDLLSRAIRAGHAFQTAMGMVADELPAPVGPEFRKTFDQQNYGLPLPDALRELADRNPILDVRFFVTAVLIQRESGGNLAEILDNLAGVVRERFKIRRQVRVHTAHGRFTGYVLLALPASLAVALTIINPELMRLLFQERMGQMLVTAAIVLQTIGFFWIRQVIKIEV

Samples

Sample ID Description Type Environment
1 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
57 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
58 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
59 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
60 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
65 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
66 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
88 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
92 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
135 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
139 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
140 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
141 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
142 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
143 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
144 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
145 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
146 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
147 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
148 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
149 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
150 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
151 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
152 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
153 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
154 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
155 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
156 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
157 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
158 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
159 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
160 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
161 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
162 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
163 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
164 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
165 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
166 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
167 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
168 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
169 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
170 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
171 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
172 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
173 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
174 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
175 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
176 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
177 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
178 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
179 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
180 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
181 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
182 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
183 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
184 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
185 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
186 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
187 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
188 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
189 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
190 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
191 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
192 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
193 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
194 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
195 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
196 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
197 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
198 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
199 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
200 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
201 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
202 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
203 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
204 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
205 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.02
Nodule 0
Rhizoplane 2.87
Rhizosphere 96.11
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065712_10069274 3300005290 Bacteria 7617
2 Ga0065715_10090199 3300005293 Bacteria 7429
3 Ga0065715_10135197 3300005293 Bacteria 1942
4 Ga0065715_10174685 3300005293 Bacteria 1520
5 Ga0065707_10086081 3300005295 Bacteria 5679
6 Ga0065707_10113682 3300005295 Bacteria 2320
7 Ga0070676_10054275 3300005328 Bacteria 2362
8 Ga0070676_10074771 3300005328 Bacteria 2041
9 Ga0070676_10118138 3300005328 Bacteria 1660
10 Ga0070676_10130460 3300005328 Bacteria 1589
11 Ga0070683_100608998 3300005329 Bacteria 1045
12 Ga0070677_10002936 3300005333 Bacteria 5479
13 Ga0070677_10073522 3300005333 Bacteria 1444
14 Ga0068869_100010049 3300005334 Bacteria 6155
15 Ga0070666_10014565 3300005335 Bacteria 5009
16 Ga0070682_100159390 3300005337 Bacteria 1557
17 Ga0068868_100004123 3300005338 Bacteria 10158
18 Ga0068868_100081754 3300005338 Bacteria 2590
19 Ga0068868_100229273 3300005338 Bacteria 1558
20 Ga0068868_100482982 3300005338 Unclassified 1083
21 Ga0070660_100307780 3300005339 Bacteria 1300
22 Ga0070689_100019892 3300005340 Bacteria 4971
23 Ga0070689_100259001 3300005340 Bacteria 1437
24 Ga0070691_10072502 3300005341 Bacteria 1673
25 Ga0070687_100029403 3300005343 Bacteria 2676
26 Ga0070668_100021252 3300005347 Bacteria 4906
27 Ga0070668_100331697 3300005347 Bacteria 1283
28 Ga0070669_100008866 3300005353 Bacteria 7176
29 Ga0070669_100018637 3300005353 Bacteria 4960
30 Ga0070675_100044719 3300005354 Bacteria 3621
31 Ga0070675_100062497 3300005354 Bacteria 3077
32 Ga0070671_100033900 3300005355 Bacteria 4225
33 Ga0070671_100362306 3300005355 Bacteria 1238
34 Ga0070674_100094065 3300005356 Bacteria 2170
35 Ga0070673_100005719 3300005364 Bacteria 7995
36 Ga0070673_100066690 3300005364 Bacteria 2876
37 Ga0070688_100001290 3300005365 Bacteria 12484
38 Ga0070688_100102577 3300005365 Bacteria 1888
39 Ga0070688_100102789 3300005365 Bacteria 1887
40 Ga0070659_100218265 3300005366 Bacteria 1573
41 Ga0070667_100160979 3300005367 Bacteria 1977
42 Ga0070701_10044526 3300005438 Bacteria 2274
43 Ga0070705_100063021 3300005440 Bacteria 2210
44 Ga0070700_100007083 3300005441 Bacteria 6028
45 Ga0070700_100021579 3300005441 Bacteria 3745
46 Ga0070700_100066730 3300005441 Bacteria 2285
47 Ga0070700_100100211 3300005441 Bacteria 1907
48 Ga0070694_100010135 3300005444 Bacteria 5800
49 Ga0070694_100061360 3300005444 Bacteria 2566
50 Ga0070694_100093524 3300005444 Bacteria 2113
51 Ga0070662_100418815 3300005457 Bacteria 1108
52 Ga0070681_10115146 3300005458 Bacteria 2627
53 Ga0068867_100024384 3300005459 Bacteria 4333
54 Ga0070685_10006586 3300005466 Bacteria 5924
55 Ga0070685_10009815 3300005466 Bacteria 4964
56 Ga0070706_100109454 3300005467 Bacteria 2571
57 Ga0070706_100431105 3300005467 Unclassified 1227
58 Ga0070707_100034445 3300005468 Bacteria 4829
59 Ga0070707_100136308 3300005468 Bacteria 2388
60 Ga0070707_100182589 3300005468 Bacteria 2045
61 Ga0070698_100003151 3300005471 Bacteria 18175
62 Ga0070698_100006486 3300005471 Bacteria 12692
63 Ga0070698_100049037 3300005471 Bacteria 4313
64 Ga0070699_100000475 3300005518 Bacteria 38225
65 Ga0070699_100008844 3300005518 Bacteria 8721
66 Ga0070699_100060409 3300005518 Bacteria 3284
67 Ga0070699_100142028 3300005518 Bacteria 2121
68 Ga0070699_100167741 3300005518 Bacteria 1945
69 Ga0070697_100071045 3300005536 Bacteria 2855
70 Ga0070697_100114369 3300005536 Bacteria 2252
71 Ga0070697_100213122 3300005536 Bacteria 1645
72 Ga0070672_100212626 3300005543 Bacteria 1620
73 Ga0070672_100259729 3300005543 Bacteria 1464
74 Ga0070672_100305191 3300005543 Bacteria 1350
75 Ga0070686_100005995 3300005544 Bacteria 6744
76 Ga0070695_100001664 3300005545 Bacteria 12507
77 Ga0070695_100004647 3300005545 Bacteria 8071
78 Ga0070695_100205619 3300005545 Bacteria 1410
79 Ga0070696_100002737 3300005546 Bacteria 11701
80 Ga0070696_100006712 3300005546 Bacteria 7689
81 Ga0070696_100013209 3300005546 Bacteria 5542
82 Ga0070696_100235233 3300005546 Bacteria 1380
83 Ga0070665_100003820 3300005548 Bacteria 15949
84 Ga0070704_100001492 3300005549 Bacteria 12582
85 Ga0070704_100150039 3300005549 Bacteria 1831
86 Ga0070704_100401557 3300005549 Bacteria 1170
87 Ga0068855_100090370 3300005563 Bacteria 3534
88 Ga0070664_100002655 3300005564 Bacteria 14420
89 Ga0070664_100109793 3300005564 Bacteria 2406
90 Ga0070664_100167238 3300005564 Bacteria 1949
91 Ga0068854_100078901 3300005578 Bacteria 2426
92 Ga0070702_100143015 3300005615 Bacteria 1526
93 Ga0068859_100009537 3300005617 Bacteria 9801
94 Ga0068859_100041236 3300005617 Bacteria 4637
95 Ga0068859_100096386 3300005617 Bacteria 3011
96 Ga0068864_100144259 3300005618 Bacteria 2151
97 Ga0068866_10042044 3300005718 Bacteria 2272
98 Ga0068861_100042313 3300005719 Bacteria 3414
99 Ga0068861_100117218 3300005719 Bacteria 2142
100 Ga0068861_100271495 3300005719 Bacteria 1456
101 Ga0068861_100279642 3300005719 Bacteria 1436
102 Ga0068861_100316004 3300005719 Bacteria 1359
103 Ga0068851_10055687 3300005834 Bacteria 2015
104 Ga0068870_10153995 3300005840 Bacteria 1357
105 Ga0068858_100032602 3300005842 Bacteria 4837
106 Ga0068860_100011122 3300005843 Bacteria 8865
107 Ga0068860_100057663 3300005843 Bacteria 3692
108 Ga0068860_100214245 3300005843 Bacteria 1869
109 Ga0068862_100008460 3300005844 Bacteria 8509
110 Ga0068862_100039571 3300005844 Bacteria 4005
111 Ga0068862_100048114 3300005844 Bacteria 3640
112 Ga0068862_100173826 3300005844 Bacteria 1929
113 Ga0068862_100298998 3300005844 Unclassified 1480
114 Ga0081455_10050373 3300005937 Bacteria 3582
115 Ga0081455_10170061 3300005937 Bacteria 1661
116 Ga0081539_10029438 3300005985 Bacteria 3430
117 Ga0075368_10051843 3300006042 Bacteria 1632
118 Ga0075367_10037472 3300006178 Bacteria 2818
119 Ga0075366_10062684 3300006195 Bacteria 2210
120 Ga0097621_100023387 3300006237 Bacteria 4812
121 Ga0097621_100033450 3300006237 Bacteria 4094
122 Ga0097621_100139524 3300006237 Bacteria 2070
123 Ga0097621_100203536 3300006237 Bacteria 1719
124 Ga0068871_100000886 3300006358 Bacteria 19951
125 Ga0068871_100092473 3300006358 Bacteria 2522
126 Ga0075428_100000017 3300006844 Bacteria 147833
127 Ga0075428_100003466 3300006844 Bacteria 17256
128 Ga0075428_100086142 3300006844 Bacteria 3426
129 Ga0075428_100166794 3300006844 Bacteria 2388
130 Ga0075430_100000262 3300006846 Bacteria 36942
131 Ga0075430_100031640 3300006846 Bacteria 4490
132 Ga0075430_100040846 3300006846 Bacteria 3926
133 Ga0075431_100000517 3300006847 Bacteria 32332
134 Ga0075431_100028475 3300006847 Bacteria 5742
135 Ga0075431_100230089 3300006847 Bacteria 1889
136 Ga0075431_100380888 3300006847 Bacteria 1415
137 Ga0075433_10000668 3300006852 Bacteria 23233
138 Ga0075433_10001213 3300006852 Bacteria 18802
139 Ga0075433_10003764 3300006852 Bacteria 11737
140 Ga0075433_10016511 3300006852 Bacteria 6088
141 Ga0075433_10035474 3300006852 Bacteria 4289
142 Ga0075433_10059821 3300006852 Bacteria 3334
143 Ga0075433_10117336 3300006852 Bacteria 2361
144 Ga0075433_10123394 3300006852 Bacteria 2301
145 Ga0075434_100000776 3300006871 Bacteria 25295
146 Ga0075434_100002394 3300006871 Bacteria 16457
147 Ga0075434_100004299 3300006871 Bacteria 12797
148 Ga0075434_100022059 3300006871 Bacteria 6199
149 Ga0075434_100086489 3300006871 Bacteria 3135
150 Ga0075434_100094349 3300006871 Bacteria 2997
151 Ga0075434_100131844 3300006871 Bacteria 2519
152 Ga0075434_100148793 3300006871 Bacteria 2361
153 Ga0075434_100152430 3300006871 Bacteria 2332
154 Ga0075434_100309012 3300006871 Bacteria 1601
155 Ga0075434_100466054 3300006871 Unclassified 1285
156 Ga0075429_100004563 3300006880 Bacteria 11904
157 Ga0075429_100022264 3300006880 Bacteria 5498
158 Ga0075429_100050280 3300006880 Bacteria 3627
159 Ga0068865_100004376 3300006881 Bacteria 8511
160 Ga0068865_100015023 3300006881 Bacteria 4930
161 Ga0075436_100007465 3300006914 Bacteria 7478
162 Ga0075436_100012376 3300006914 Bacteria 5848
163 Ga0075436_100051077 3300006914 Bacteria 2853
164 Ga0075436_100118068 3300006914 Bacteria 1854
165 Ga0075436_100151060 3300006914 Bacteria 1634
166 Ga0075436_100158466 3300006914 Bacteria 1595
167 Ga0097620_100009538 3300006931 Bacteria 9801
168 Ga0097620_100041236 3300006931 Bacteria 4637
169 Ga0097620_100096382 3300006931 Bacteria 3011
170 Ga0075435_100000189 3300007076 Bacteria 36888
171 Ga0075435_100003794 3300007076 Bacteria 10303
172 Ga0075435_100014303 3300007076 Bacteria 5927
173 Ga0075435_100016466 3300007076 Bacteria 5575
174 Ga0075435_100025993 3300007076 Bacteria 4564
175 Ga0075435_100048549 3300007076 Bacteria 3411
176 Ga0075435_100052786 3300007076 Bacteria 3276
177 Ga0075435_100065306 3300007076 Bacteria 2958
178 Ga0075435_100081092 3300007076 Bacteria 2665
179 Ga0105240_10136105 3300009093 Bacteria 2942
180 Ga0105240_10268199 3300009093 Bacteria 1967
181 Ga0111539_10000002 3300009094 Bacteria 983359
182 Ga0111539_10011717 3300009094 Bacteria 11001
183 Ga0111539_10020905 3300009094 Bacteria 8059
184 Ga0111539_10023599 3300009094 Bacteria 7558
185 Ga0111539_10073900 3300009094 Bacteria 4018
186 Ga0111539_10100110 3300009094 Bacteria 3403
187 Ga0111539_10148958 3300009094 Bacteria 2740
188 Ga0111539_10188878 3300009094 Bacteria 2405
189 Ga0111539_10289108 3300009094 Bacteria 1907
190 Ga0105245_10011522 3300009098 Bacteria 7699
191 Ga0105247_10071409 3300009101 Bacteria 2171
192 Ga0114129_10001304 3300009147 Bacteria 33279
193 Ga0114129_10010673 3300009147 Bacteria 13100
194 Ga0114129_10019000 3300009147 Bacteria 9790
195 Ga0114129_10029839 3300009147 Bacteria 7723
196 Ga0114129_10047764 3300009147 Bacteria 6013
197 Ga0114129_10050070 3300009147 Bacteria 5869
198 Ga0114129_10053753 3300009147 Bacteria 5649
199 Ga0114129_10072830 3300009147 Bacteria 4788
200 Ga0114129_10151568 3300009147 Bacteria 3173
201 Ga0114129_10164967 3300009147 Bacteria 3024
202 Ga0114129_10314538 3300009147 Bacteria 2083
203 Ga0114129_10315510 3300009147 Bacteria 2080
204 Ga0114129_10510164 3300009147 Bacteria 1569
205 Ga0114129_10555570 3300009147 Bacteria 1492
206 Ga0105243_10072653 3300009148 Bacteria 2785
207 Ga0105241_10138962 3300009174 Bacteria 1976
208 Ga0105242_10003085 3300009176 Bacteria 13001
209 Ga0105248_10022495 3300009177 Bacteria 6992
210 Ga0105248_10168579 3300009177 Bacteria 2468
211 Ga0105238_10262399 3300009551 Bacteria 1707
212 Ga0105249_10010840 3300009553 Bacteria 8009
213 Ga0105249_10288661 3300009553 Bacteria 1641
214 Ga0105249_10348586 3300009553 Bacteria 1499
215 Ga0105249_10637329 3300009553 Bacteria 1123
216 Ga0157374_10149082 3300013296 Bacteria 2273
217 Ga0157374_10151065 3300013296 Bacteria 2258
218 Ga0157378_10221691 3300013297 Bacteria 1798
219 Ga0157378_10326278 3300013297 Bacteria 1493
220 Ga0157375_10277000 3300013308 Bacteria 1840
221 Ga0157375_10355005 3300013308 Bacteria 1632
222 Ga0157380_10001788 3300014326 Bacteria 14197
223 Ga0157380_10002539 3300014326 Bacteria 12321
224 Ga0157380_10022266 3300014326 Bacteria 4767
225 Ga0157380_10110489 3300014326 Bacteria 2309
226 Ga0157380_10310343 3300014326 Bacteria 1457
227 Ga0157377_10003051 3300014745 Bacteria 7509
228 Ga0157377_10265537 3300014745 Bacteria 1119
229 Ga0157379_10013418 3300014968 Bacteria 7176
230 Ga0157379_10064058 3300014968 Bacteria 3286
231 Ga0157376_10128111 3300014969 Bacteria 2261
232 Ga0157376_10160360 3300014969 Bacteria 2038
233 Ga0157376_10315677 3300014969 Bacteria 1484
234 Ga0163161_10004534 3300017792 Bacteria 9666
235 Ga0207697_10000862 3300025315 Bacteria 17181
236 Ga0207697_10051488 3300025315 Bacteria 1702
237 Ga0207682_10001500 3300025893 Bacteria 10777
238 Ga0207642_10022849 3300025899 Bacteria 2488
239 Ga0207642_10043311 3300025899 Bacteria 1984
240 Ga0207642_10045331 3300025899 Bacteria 1951
241 Ga0207688_10000543 3300025901 Bacteria 18375
242 Ga0207680_10019011 3300025903 Bacteria 3668
243 Ga0207680_10027116 3300025903 Bacteria 3185
244 Ga0207680_10029276 3300025903 Bacteria 3091
245 Ga0207645_10001978 3300025907 Bacteria 16464
246 Ga0207645_10057965 3300025907 Bacteria 2473
247 Ga0207645_10094811 3300025907 Bacteria 1921
248 Ga0207643_10003962 3300025908 Bacteria 7971
249 Ga0207643_10117312 3300025908 Bacteria 1573
250 Ga0207684_10253094 3300025910 Bacteria 1520
251 Ga0207684_10256589 3300025910 Bacteria 1509
252 Ga0207654_10143707 3300025911 Bacteria 1524
253 Ga0207695_10073986 3300025913 Bacteria 3469
254 Ga0207662_10012484 3300025918 Bacteria 4730
255 Ga0207662_10055148 3300025918 Bacteria 2371
256 Ga0207657_10288283 3300025919 Bacteria 1302
257 Ga0207646_10130504 3300025922 Bacteria 2261
258 Ga0207646_10155840 3300025922 Bacteria 2060
259 Ga0207646_10197068 3300025922 Bacteria 1819
260 Ga0207681_10020423 3300025923 Bacteria 4197
261 Ga0207681_10067404 3300025923 Unclassified 2481
262 Ga0207659_10000469 3300025926 Bacteria 24218
263 Ga0207659_10020682 3300025926 Bacteria 4354
264 Ga0207659_10050871 3300025926 Bacteria 2945
265 Ga0207659_10079294 3300025926 Unclassified 2422
266 Ga0207687_10018987 3300025927 Bacteria 4548
267 Ga0207687_10020499 3300025927 Bacteria 4386
268 Ga0207687_10033310 3300025927 Bacteria 3494
269 Ga0207706_10003430 3300025933 Bacteria 15140
270 Ga0207706_10120305 3300025933 Unclassified 2309
271 Ga0207706_10315887 3300025933 Bacteria 1360
272 Ga0207686_10008188 3300025934 Bacteria 5641
273 Ga0207686_10016272 3300025934 Bacteria 4172
274 Ga0207686_10047118 3300025934 Bacteria 2663
275 Ga0207686_10061342 3300025934 Bacteria 2384
276 Ga0207670_10068217 3300025936 Bacteria 2450
277 Ga0207670_10225456 3300025936 Bacteria 1437
278 Ga0207669_10025467 3300025937 Bacteria 3199
279 Ga0207669_10204138 3300025937 Bacteria 1437
280 Ga0207704_10017309 3300025938 Bacteria 3731
281 Ga0207704_10092370 3300025938 Bacteria 1992
282 Ga0207691_10005955 3300025940 Bacteria 11775
283 Ga0207691_10178227 3300025940 Bacteria 1858
284 Ga0207691_10266857 3300025940 Bacteria 1475
285 Ga0207691_10307698 3300025940 Bacteria 1360
286 Ga0207691_10363141 3300025940 Unclassified 1238
287 Ga0207711_10211600 3300025941 Bacteria 1771
288 Ga0207689_10001150 3300025942 Bacteria 25470
289 Ga0207689_10048944 3300025942 Bacteria 3487
290 Ga0207661_10294735 3300025944 Bacteria 1453
291 Ga0207661_10317079 3300025944 Bacteria 1401
292 Ga0207679_10007928 3300025945 Bacteria 6751
293 Ga0207679_10102621 3300025945 Bacteria 2240
294 Ga0207651_10428406 3300025960 Unclassified 1131
295 Ga0207712_10032026 3300025961 Bacteria 3546
296 Ga0207712_10055468 3300025961 Bacteria 2788
297 Ga0207712_10061706 3300025961 Bacteria 2662
298 Ga0207712_10065445 3300025961 Bacteria 2594
299 Ga0207668_10040853 3300025972 Bacteria 3132
300 Ga0207668_10087410 3300025972 Bacteria 2280
301 Ga0207668_10421385 3300025972 Bacteria 1133
302 Ga0207640_10064900 3300025981 Bacteria 2434
303 Ga0207658_10105855 3300025986 Bacteria 2213
304 Ga0207677_10117100 3300026023 Bacteria 1996
305 Ga0207677_10189557 3300026023 Bacteria 1625
306 Ga0207677_10246578 3300026023 Bacteria 1448
307 Ga0207703_10017299 3300026035 Bacteria 5628
308 Ga0207703_10102863 3300026035 Bacteria 2424
309 Ga0207703_10576028 3300026035 Bacteria 1063
310 Ga0207708_10047142 3300026075 Bacteria 3282
311 Ga0207708_10060383 3300026075 Bacteria 2893
312 Ga0207708_10065373 3300026075 Bacteria 2780
313 Ga0207708_10113184 3300026075 Bacteria 2108
314 Ga0207702_10019341 3300026078 Bacteria 5636
315 Ga0207641_10011933 3300026088 Bacteria 7129
316 Ga0207641_10224630 3300026088 Bacteria 1743
317 Ga0207641_10332083 3300026088 Bacteria 1444
318 Ga0207648_10024886 3300026089 Bacteria 5338
319 Ga0207648_10094647 3300026089 Bacteria 2612
320 Ga0207648_10219631 3300026089 Bacteria 1689
321 Ga0207648_10233516 3300026089 Bacteria 1636
322 Ga0207676_10106844 3300026095 Bacteria 2333
323 Ga0207676_10170868 3300026095 Bacteria 1894
324 Ga0207674_10070657 3300026116 Bacteria 3510
325 Ga0207675_100005749 3300026118 Bacteria 11863
326 Ga0207675_100006207 3300026118 Bacteria 11348
327 Ga0207675_100074064 3300026118 Bacteria 3186
328 Ga0207675_100076455 3300026118 Bacteria 3135
329 Ga0207675_100257153 3300026118 Bacteria 1692
330 Ga0207675_100258124 3300026118 Bacteria 1688
331 Ga0207683_10002309 3300026121 Bacteria 16723
332 Ga0207683_10022865 3300026121 Bacteria 5371
333 Ga0207683_10300287 3300026121 Bacteria 1469
334 Ga0207698_10278884 3300026142 Bacteria 1545
335 Ga0207428_10000004 3300027907 Bacteria 727800
336 Ga0207428_10008285 3300027907 Bacteria 9398
337 Ga0207428_10013831 3300027907 Bacteria 7030
338 Ga0207428_10015504 3300027907 Bacteria 6590
339 Ga0207428_10018190 3300027907 Bacteria 6009
340 Ga0207428_10024144 3300027907 Bacteria 5106
341 Ga0268266_10076012 3300028379 Bacteria 2918
342 Ga0268265_10014309 3300028380 Bacteria 5403
343 Ga0268265_10015569 3300028380 Bacteria 5206
344 Ga0268265_10025365 3300028380 Bacteria 4206
345 Ga0268265_10178786 3300028380 Bacteria 1821
346 Ga0268264_10147461 3300028381 Bacteria 2106
347 Ga0268264_10454422 3300028381 Bacteria 1242
348 Ga0268264_10560911 3300028381 Bacteria 1121
349 Ga0307408_100199210 3300031548 Bacteria 1619
350 Ga0307408_100338338 3300031548 Bacteria 1273
351 Ga0307408_100372750 3300031548 Bacteria 1218
352 Ga0307409_100084611 3300031995 Bacteria 2576
353 Ga0307409_100335642 3300031995 Bacteria 1420
354 Ga0307416_100069909 3300032002 Bacteria 2908
355 Ga0307416_100151880 3300032002 Bacteria 2125
356 Ga0307414_10065314 3300032004 Bacteria 2596
357 Ga0307411_10073838 3300032005 Bacteria 2322
358 Ga0307415_100023002 3300032126 Bacteria 3860
359 Ga0373930_0003255 3300034816 Bacteria 2568
360 Ga0373948_0003137 3300034817 Bacteria 2514
361 Ga0373950_0004750 3300034818 Bacteria 2000
362 Ga0373959_0001235 3300034820 Bacteria 4124
363 Ga0373929_0005265 3300035085 Bacteria 2326
364 Ga0373949_0001113 3300035090 Bacteria 8147
365 Ga0373951_0002359 3300035091 Bacteria 4787
366 Ga0373951_0017410 3300035091 Bacteria 1626
367 Ga0373952_0000406 3300035092 Bacteria 7398
368 Ga0373932_0001419 3300035112 Bacteria 6718
369 Ga0373939_0000596 3300035114 Bacteria 8983
370 Ga0373941_0001790 3300035115 Bacteria 4624
371 Ga0373953_0062282 3300035117 Bacteria 1527
372 Ga0373960_0000967 3300035121 Bacteria 6177
373 Ga0373943_0043080 3300035170 Bacteria 2191
374 Ga0373942_0001095 3300035207 Bacteria 7252
375 Ga0373961_0002928 3300035241 Bacteria 4324
376 Ga0373933_0033710 3300035724 Bacteria 2981
377 Ga0373937_0019618 3300036401 Bacteria 6052
378 Ga0373937_0096815 3300036401 Bacteria 2737
379 Ga0395905_0234635 3300037471 Bacteria 1715
380 Ga0439441_013013 3300042001 Bacteria 1437
381 Ga0439455_0026207 3300042012 Bacteria 1422
382 Ga0450905_010724 3300042142 Bacteria 1273
383 Ga0439464_0010378 3300042439 Bacteria 2458
384 Ga0439440_0018534 3300042993 Unclassified 1543
385 Ga0451576_0010717 3300045051 Bacteria 10496
386 Ga0451576_0368285 3300045051 Bacteria 1505
387 Ga0451576_0695480 3300045051 Bacteria 1068
388 Ga0495603_0074167 3300046455 Bacteria 1998
389 Ga0495629_0008369 3300046459 Bacteria 7608
390 Ga0495584_0013157 3300046491 Bacteria 4221
391 Ga0495643_0007709 3300046522 Bacteria 6898
392 Ga0495642_0122827 3300046528 Bacteria 1115
393 Ga0495586_0007998 3300046535 Bacteria 5640
394 Ga0495598_0038745 3300046537 Bacteria 1382
395 Ga0495645_0007627 3300046543 Bacteria 7528
396 Ga0495635_0050102 3300046663 Bacteria 2879
397 Ga0495659_0000896 3300046664 Bacteria 10607
398 Ga0495659_0055347 3300046664 Bacteria 1453
399 Ga0495647_0087040 3300046681 Bacteria 1275
400 Ga0495669_0025733 3300046684 Bacteria 2568
401 Ga0495677_0008003 3300047445 Bacteria 3929
402 Ga0495684_0038585 3300047471 Bacteria 3662
403 Ga0496102_0096843 3300048905 Bacteria 2736
404 Ga0496102_0277723 3300048905 Bacteria 1579
405 Ga0496102_0292373 3300048905 Bacteria 1536
406 Ga0496102_0324999 3300048905 Bacteria 1449
407 Ga0496104_0138802 3300048907 Bacteria 2336
408 Ga0496106_0025834 3300048909 Bacteria 4370
409 Ga0496109_0311505 3300048912 Bacteria 1485
410 Ga0496112_0051260 3300048915 Bacteria 4048
411 Ga0496112_0069036 3300048915 Bacteria 3491
412 Ga0496112_0184591 3300048915 Bacteria 2049
413 Ga0496114_0089464 3300048917 Bacteria 2613
414 Ga0496114_0113358 3300048917 Bacteria 2324
415 Ga0496114_0190531 3300048917 Bacteria 1794
416 Ga0496115_0096530 3300048918 Bacteria 2420
417 Ga0501079_0061373 3300049741 Bacteria 2900
418 Ga0501079_0314879 3300049741 Bacteria 1225
419 nmdc:mga0k408_15798_c2 3300050493 Bacteria 2517
420 nmdc:mga06z11_37090_c1 3300050494 Bacteria 2412
421 nmdc:mga05p37_123749_c1 3300050507 Bacteria 3177
422 nmdc:mga05p37_22313_c1 3300050507 Bacteria 7677
423 nmdc:mga05p37_2382_c1 3300050507 Bacteria 21864
424 nmdc:mga05p37_272897_c1 3300050507 Bacteria 2020
425 nmdc:mga05p37_29948_c1 3300050507 Bacteria 6643
426 nmdc:mga05p37_37138_c1 3300050507 Bacteria 5975
427 nmdc:mga05p37_43348_c1 3300050507 Bacteria 5535
428 nmdc:mga05p37_47253_c1 3300050507 Unclassified 4219
429 nmdc:mga05p37_5466_c1 3300050507 Bacteria 14916
430 nmdc:mga05p37_56435_c1 3300050507 Bacteria 4836
431 nmdc:mga05p37_80691_c1 3300050507 Bacteria 4007
432 nmdc:mga05p37_90287_c1 3300050507 Bacteria 3776
433 nmdc:mga09592_13865_c1 3300050508 Bacteria 6587
434 nmdc:mga09592_198261_c1 3300050508 Bacteria 1738
435 nmdc:mga09592_7395_c1 3300050508 Bacteria 8929
436 nmdc:mga09592_9128_c1 3300050508 Bacteria 8065
437 nmdc:mga0qj67_138273_c1 3300050509 Bacteria 1974
438 nmdc:mga0qj67_258_c1 3300050509 Bacteria 36243
439 nmdc:mga0qj67_41941_c1 3300050509 Bacteria 3601
440 nmdc:mga0qj67_94105_c1 3300050509 Bacteria 2410
441 nmdc:mga06r32_1786_c1 3300050510 Bacteria 19309
442 nmdc:mga06r32_215236_c1 3300050510 Bacteria 1909
443 nmdc:mga06r32_65143_c1 3300050510 Bacteria 3515
444 nmdc:mga08y16_118011_c1 3300050511 Bacteria 2761
445 nmdc:mga08y16_15581_c1 3300050511 Bacteria 7994
446 nmdc:mga08y16_2_c1 3300050511 Bacteria 983367
447 nmdc:mga08y16_331301_c1 3300050511 Bacteria 1257
448 nmdc:mga08y16_80229_c1 3300050511 Bacteria 3402
449 nmdc:mga08y16_88864_c1 3300050511 Bacteria 3220
450 nmdc:mga0n895_121_c1 3300050512 Bacteria 46448
451 nmdc:mga0n895_176756_c1 3300050512 Bacteria 2166
452 nmdc:mga0n895_179638_c1 3300050512 Bacteria 2148
453 nmdc:mga0n895_21582_c1 3300050512 Bacteria 6026
454 nmdc:mga0n895_282834_c1 3300050512 Bacteria 1682
455 nmdc:mga0n895_411_c1 3300050512 Bacteria 28740
456 nmdc:mga0n895_425937_c1 3300050512 Bacteria 1341
457 nmdc:mga0n895_60891_c1 3300050512 Bacteria 3725
458 nmdc:mga0n895_69250_c1 3300050512 Bacteria 3495
459 nmdc:mga0n895_8256_c1 3300050512 Bacteria 9006
460 nmdc:mga0rr50_107_c1 3300050513 Bacteria 46254
461 nmdc:mga0rr50_133227_c1 3300050513 Bacteria 1992
462 nmdc:mga0rr50_269059_c1 3300050513 Bacteria 1420
463 nmdc:mga0rr50_31768_c1 3300050513 Bacteria 3755
464 nmdc:mga0rr50_41621_c1 3300050513 Bacteria 3349
465 nmdc:mga0rr50_45972_c1 3300050513 Bacteria 3212
466 nmdc:mga0rr50_5261_c1 3300050513 Bacteria 7699
467 nmdc:mga0rr50_698_c1 3300050513 Bacteria 17989
468 nmdc:mga08x19_100136_c1 3300050514 Bacteria 1922
469 nmdc:mga08x19_205009_c1 3300050514 Bacteria 1352
470 nmdc:mga08x19_243383_c1 3300050514 Bacteria 1240
471 nmdc:mga08x19_810_c1 3300050514 Bacteria 19891
472 nmdc:mga08x19_83852_c1 3300050514 Bacteria 2096
473 nmdc:mga08x19_95213_c1 3300050514 Bacteria 1970
474 nmdc:mga0a205_183941_c1 3300050515 Bacteria 1688
475 nmdc:mga0a205_19178_c1 3300050515 Bacteria 6445
476 nmdc:mga0a205_26289_c1 3300050515 Bacteria 5548
477 nmdc:mga0a205_327005_c1 3300050515 Bacteria 1403
478 nmdc:mga0a205_54296_c1 3300050515 Bacteria 3868
479 nmdc:mga0a205_67034_c1 3300050515 Bacteria 3467
480 nmdc:mga0a205_69191_c1 3300050515 Bacteria 3409
481 nmdc:mga0a205_72665_c1 3300050515 Bacteria 3323
482 nmdc:mga0a205_83938_c1 3300050515 Bacteria 3076
483 nmdc:mga0a205_900_c1 3300050515 Bacteria 24469
484 Ga0495619_0139658 3300053085 Bacteria 1668
485 Ga0501084_0247509 3300054114 Bacteria 1505
486 Ga0590075_010617 3300059424 Bacteria 2220
487 Ga0501082_0013253 3300060353 Bacteria 7091
488 Ga0501082_0214629 3300060353 Bacteria 1674

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050512 nmdc:mga0n895_179638_c1 nmdc:mga0n895_179638_c1_66_896 272
2 3300005467 Ga0070706_100431105 Ga0070706_1004311052 273
3 3300050511 nmdc:mga08y16_331301_c1 nmdc:mga08y16_331301_c1_352_1203 273
4 3300046664 Ga0495659_0055347 Ga0495659_0055347_36_866 276
5 3300050512 nmdc:mga0n895_69250_c1 nmdc:mga0n895_69250_c1_21_851 276
6 3300048905 Ga0496102_0324999 Ga0496102_0324999_44_895 279
7 3300046537 Ga0495598_0038745 Ga0495598_0038745_145_1110 281
8 3300006042 Ga0075368_10051843 Ga0075368_100518432 285
9 3300006178 Ga0075367_10037472 Ga0075367_100374722 285
10 3300006195 Ga0075366_10062684 Ga0075366_100626842 285
11 3300050493 nmdc:mga0k408_15798_c2 nmdc:mga0k408_15798_c2_417_1394 285
12 3300050494 nmdc:mga06z11_37090_c1 nmdc:mga06z11_37090_c1_1146_2123 285
13 3300048909 Ga0496106_0025834 Ga0496106_0025834_3487_4359 286
14 3300025903 Ga0207680_10019011 Ga0207680_100190112 287
15 3300005468 Ga0070707_100034445 Ga0070707_1000344452 288
16 3300025922 Ga0207646_10130504 Ga0207646_101305042 288
17 3300048905 Ga0496102_0292373 Ga0496102_0292373_419_1393 289
18 3300046522 Ga0495643_0007709 Ga0495643_0007709_4226_5182 290
19 3300005457 Ga0070662_100418815 Ga0070662_1004188151 291
20 3300025899 Ga0207642_10022849 Ga0207642_100228492 291
21 3300025933 Ga0207706_10315887 Ga0207706_103158872 291
22 3300026075 Ga0207708_10047142 Ga0207708_100471422 291
23 3300026089 Ga0207648_10219631 Ga0207648_102196312 291
24 3300005546 Ga0070696_100013209 Ga0070696_1000132094 293
25 3300005471 Ga0070698_100003151 Ga0070698_10000315118 294
26 3300005518 Ga0070699_100000475 Ga0070699_10000047510 294
27 3300005536 Ga0070697_100071045 Ga0070697_1000710452 294
28 3300025910 Ga0207684_10253094 Ga0207684_102530942 294
29 3300045051 Ga0451576_0695480 Ga0451576_0695480_150_1055 297
30 3300050507 nmdc:mga05p37_56435_c1 nmdc:mga05p37_56435_c1_2425_3396 297
31 3300050514 nmdc:mga08x19_205009_c1 nmdc:mga08x19_205009_c1_22_924 299
32 3300005444 Ga0070694_100093524 Ga0070694_1000935243 300
33 3300009147 Ga0114129_10314538 Ga0114129_103145382 300
34 3300026118 Ga0207675_100076455 Ga0207675_1000764553 300
35 3300050507 nmdc:mga05p37_123749_c1 nmdc:mga05p37_123749_c1_768_1748 300
36 3300050515 nmdc:mga0a205_72665_c1 nmdc:mga0a205_72665_c1_2216_3196 300
37 3300059424 Ga0590075_010617 Ga0590075_010617_708_1667 301
38 3300005719 Ga0068861_100316004 Ga0068861_1003160042 302
39 3300025940 Ga0207691_10363141 Ga0207691_103631412 304
40 3300025908 Ga0207643_10117312 Ga0207643_101173122 306
41 3300045051 Ga0451576_0368285 Ga0451576_0368285_145_1116 306
42 3300048915 Ga0496112_0069036 Ga0496112_0069036_2262_3239 306
43 3300050515 nmdc:mga0a205_183941_c1 nmdc:mga0a205_183941_c1_11_940 306
44 3300046455 Ga0495603_0074167 Ga0495603_0074167_405_1367 307
45 3300046459 Ga0495629_0008369 Ga0495629_0008369_6505_7467 307
46 3300046681 Ga0495647_0087040 Ga0495647_0087040_44_1006 307
47 3300042142 Ga0450905_010724 Ga0450905_010724_66_1031 308
48 3300050508 nmdc:mga09592_198261_c1 nmdc:mga09592_198261_c1_685_1644 308
49 3300009147 Ga0114129_10019000 Ga0114129_1001900011 309
50 3300009147 Ga0114129_10315510 Ga0114129_103155102 309
51 3300046528 Ga0495642_0122827 Ga0495642_0122827_39_998 309
52 3300046684 Ga0495669_0025733 Ga0495669_0025733_136_1095 309
53 3300050515 nmdc:mga0a205_83938_c1 nmdc:mga0a205_83938_c1_2002_2976 309
54 3300005341 Ga0070691_10072502 Ga0070691_100725022 310
55 3300005545 Ga0070695_100004647 Ga0070695_1000046475 310
56 3300005546 Ga0070696_100006712 Ga0070696_1000067126 310
57 3300005615 Ga0070702_100143015 Ga0070702_1001430152 310
58 3300009094 Ga0111539_10148958 Ga0111539_101489583 310
59 3300050511 nmdc:mga08y16_118011_c1 nmdc:mga08y16_118011_c1_1397_2359 310
60 3300031548 Ga0307408_100338338 Ga0307408_1003383382 311
61 3300005355 Ga0070671_100362306 Ga0070671_1003623062 312
62 3300006871 Ga0075434_100086489 Ga0075434_1000864892 312
63 3300007076 Ga0075435_100025993 Ga0075435_1000259934 312
64 3300005293 Ga0065715_10090199 Ga0065715_100901996 313
65 3300005328 Ga0070676_10074771 Ga0070676_100747712 313
66 3300005333 Ga0070677_10002936 Ga0070677_100029365 313
67 3300005334 Ga0068869_100010049 Ga0068869_1000100495 313
68 3300005338 Ga0068868_100004123 Ga0068868_1000041234 313
69 3300005353 Ga0070669_100008866 Ga0070669_1000088663 313
70 3300005355 Ga0070671_100033900 Ga0070671_1000339004 313
71 3300005364 Ga0070673_100005719 Ga0070673_1000057192 313
72 3300005365 Ga0070688_100001290 Ga0070688_1000012904 313
73 3300005441 Ga0070700_100007083 Ga0070700_1000070833 313
74 3300005459 Ga0068867_100024384 Ga0068867_1000243844 313
75 3300005466 Ga0070685_10006586 Ga0070685_100065862 313
76 3300005564 Ga0070664_100002655 Ga0070664_1000026553 313
77 3300005617 Ga0068859_100041236 Ga0068859_1000412365 313
78 3300005719 Ga0068861_100117218 Ga0068861_1001172182 313
79 3300005842 Ga0068858_100032602 Ga0068858_1000326025 313
80 3300005843 Ga0068860_100011122 Ga0068860_1000111224 313
81 3300005844 Ga0068862_100008460 Ga0068862_1000084606 313
82 3300006237 Ga0097621_100033450 Ga0097621_1000334503 313
83 3300006358 Ga0068871_100092473 Ga0068871_1000924732 313
84 3300006844 Ga0075428_100003466 Ga0075428_10000346614 313
85 3300006846 Ga0075430_100000262 Ga0075430_10000026213 313
86 3300006847 Ga0075431_100000517 Ga0075431_10000051730 313
87 3300006852 Ga0075433_10001213 Ga0075433_1000121310 313
88 3300006871 Ga0075434_100022059 Ga0075434_1000220595 313
89 3300006880 Ga0075429_100004563 Ga0075429_10000456310 313
90 3300006881 Ga0068865_100015023 Ga0068865_1000150234 313
91 3300006931 Ga0097620_100041236 Ga0097620_1000412365 313
92 3300007076 Ga0075435_100065306 Ga0075435_1000653062 313
93 3300009094 Ga0111539_10011717 Ga0111539_100117179 313
94 3300009101 Ga0105247_10071409 Ga0105247_100714092 313
95 3300009147 Ga0114129_10164967 Ga0114129_101649673 313
96 3300009177 Ga0105248_10022495 Ga0105248_100224954 313
97 3300009553 Ga0105249_10010840 Ga0105249_100108405 313
98 3300013308 Ga0157375_10277000 Ga0157375_102770002 313
99 3300014326 Ga0157380_10001788 Ga0157380_100017888 313
100 3300014745 Ga0157377_10003051 Ga0157377_100030518 313
101 3300014968 Ga0157379_10013418 Ga0157379_100134185 313
102 3300017792 Ga0163161_10004534 Ga0163161_100045345 313
103 3300025315 Ga0207697_10000862 Ga0207697_100008624 313
104 3300025893 Ga0207682_10001500 Ga0207682_100015005 313
105 3300025901 Ga0207688_10000543 Ga0207688_1000054315 313
106 3300025903 Ga0207680_10029276 Ga0207680_100292763 313
107 3300025907 Ga0207645_10001978 Ga0207645_1000197812 313
108 3300025908 Ga0207643_10003962 Ga0207643_100039625 313
109 3300025918 Ga0207662_10012484 Ga0207662_100124844 313
110 3300025923 Ga0207681_10067404 Ga0207681_100674042 313
111 3300025926 Ga0207659_10079294 Ga0207659_100792941 313
112 3300025933 Ga0207706_10003430 Ga0207706_1000343012 313
113 3300025938 Ga0207704_10017309 Ga0207704_100173093 313
114 3300025940 Ga0207691_10005955 Ga0207691_100059553 313
115 3300025942 Ga0207689_10001150 Ga0207689_1000115016 313
116 3300025945 Ga0207679_10007928 Ga0207679_100079288 313
117 3300025961 Ga0207712_10061706 Ga0207712_100617063 313
118 3300026023 Ga0207677_10117100 Ga0207677_101171002 313
119 3300026035 Ga0207703_10102863 Ga0207703_101028632 313
120 3300026088 Ga0207641_10332083 Ga0207641_103320832 313
121 3300026089 Ga0207648_10233516 Ga0207648_102335161 313
122 3300026095 Ga0207676_10170868 Ga0207676_101708682 313
123 3300026116 Ga0207674_10070657 Ga0207674_100706573 313
124 3300026118 Ga0207675_100006207 Ga0207675_1000062077 313
125 3300026121 Ga0207683_10002309 Ga0207683_100023096 313
126 3300027907 Ga0207428_10018190 Ga0207428_100181903 313
127 3300028379 Ga0268266_10076012 Ga0268266_100760123 313
128 3300028380 Ga0268265_10025365 Ga0268265_100253652 313
129 3300028381 Ga0268264_10147461 Ga0268264_101474612 313
130 3300035091 Ga0373951_0017410 Ga0373951_0017410_279_1235 313
131 3300042012 Ga0439455_0026207 Ga0439455_0026207_106_1062 313
132 3300042993 Ga0439440_0018534 Ga0439440_0018534_437_1393 313
133 3300046664 Ga0495659_0000896 Ga0495659_0000896_393_1337 313
134 3300048912 Ga0496109_0311505 Ga0496109_0311505_305_1261 313
135 3300050507 nmdc:mga05p37_80691_c1 nmdc:mga05p37_80691_c1_2559_3515 313
136 3300050508 nmdc:mga09592_7395_c1 nmdc:mga09592_7395_c1_7256_8212 313
137 3300050509 nmdc:mga0qj67_258_c1 nmdc:mga0qj67_258_c1_23014_23970 313
138 3300050510 nmdc:mga06r32_1786_c1 nmdc:mga06r32_1786_c1_16730_17686 313
139 3300050512 nmdc:mga0n895_8256_c1 nmdc:mga0n895_8256_c1_6754_7710 313
140 3300050513 nmdc:mga0rr50_45972_c1 nmdc:mga0rr50_45972_c1_1979_2935 313
141 3300005353 Ga0070669_100018637 Ga0070669_1000186372 314
142 3300005441 Ga0070700_100021579 Ga0070700_1000215793 314
143 3300005518 Ga0070699_100167741 Ga0070699_1001677412 314
144 3300005844 Ga0068862_100039571 Ga0068862_1000395712 314
145 3300006871 Ga0075434_100131844 Ga0075434_1001318442 314
146 3300006871 Ga0075434_100466054 Ga0075434_1004660541 314
147 3300007076 Ga0075435_100048549 Ga0075435_1000485492 314
148 3300009094 Ga0111539_10020905 Ga0111539_100209053 314
149 3300014326 Ga0157380_10310343 Ga0157380_103103432 314
150 3300025923 Ga0207681_10020423 Ga0207681_100204234 314
151 3300027907 Ga0207428_10015504 Ga0207428_100155045 314
152 3300028380 Ga0268265_10015569 Ga0268265_100155693 314
153 3300048905 Ga0496102_0277723 Ga0496102_0277723_444_1415 314
154 3300048915 Ga0496112_0051260 Ga0496112_0051260_1342_2313 314
155 3300050512 nmdc:mga0n895_282834_c1 nmdc:mga0n895_282834_c1_271_1242 314
156 3300050513 nmdc:mga0rr50_5261_c1 nmdc:mga0rr50_5261_c1_2277_3248 314
157 3300006847 Ga0075431_100230089 Ga0075431_1002300892 315
158 3300006880 Ga0075429_100022264 Ga0075429_1000222642 315
159 3300009094 Ga0111539_10289108 Ga0111539_102891082 315
160 3300014326 Ga0157380_10110489 Ga0157380_101104892 315
161 3300032005 Ga0307411_10073838 Ga0307411_100738382 315
162 3300050507 nmdc:mga05p37_43348_c1 nmdc:mga05p37_43348_c1_2035_2994 315
163 3300050508 nmdc:mga09592_13865_c1 nmdc:mga09592_13865_c1_5549_6508 315
164 3300050509 nmdc:mga0qj67_138273_c1 nmdc:mga0qj67_138273_c1_505_1464 315
165 3300050510 nmdc:mga06r32_215236_c1 nmdc:mga06r32_215236_c1_512_1471 315
166 3300005471 Ga0070698_100049037 Ga0070698_1000490372 316
167 3300006852 Ga0075433_10059821 Ga0075433_100598213 316
168 3300006914 Ga0075436_100151060 Ga0075436_1001510602 316
169 3300009147 Ga0114129_10072830 Ga0114129_100728304 316
170 3300009147 Ga0114129_10510164 Ga0114129_105101641 316
171 3300032004 Ga0307414_10065314 Ga0307414_100653142 316
172 3300050507 nmdc:mga05p37_272897_c1 nmdc:mga05p37_272897_c1_730_1692 316
173 3300050515 nmdc:mga0a205_67034_c1 nmdc:mga0a205_67034_c1_681_1643 316
174 3300006852 Ga0075433_10000668 Ga0075433_1000066825 317
175 3300006852 Ga0075433_10035474 Ga0075433_100354743 317
176 3300006852 Ga0075433_10123394 Ga0075433_101233942 317
177 3300006871 Ga0075434_100004299 Ga0075434_10000429914 317
178 3300007076 Ga0075435_100003794 Ga0075435_1000037942 317
179 3300009093 Ga0105240_10268199 Ga0105240_102681992 317
180 3300009147 Ga0114129_10047764 Ga0114129_100477643 317
181 3300009147 Ga0114129_10555570 Ga0114129_105555702 317
182 3300032002 Ga0307416_100151880 Ga0307416_1001518802 317
183 3300050507 nmdc:mga05p37_5466_c1 nmdc:mga05p37_5466_c1_6612_7577 317
184 3300050507 nmdc:mga05p37_90287_c1 nmdc:mga05p37_90287_c1_2560_3516 317
185 3300050512 nmdc:mga0n895_411_c1 nmdc:mga0n895_411_c1_11108_12064 317
186 3300050513 nmdc:mga0rr50_31768_c1 nmdc:mga0rr50_31768_c1_1639_2604 317
187 3300050515 nmdc:mga0a205_69191_c1 nmdc:mga0a205_69191_c1_52_1017 317
188 3300050515 nmdc:mga0a205_900_c1 nmdc:mga0a205_900_c1_4194_5150 317
189 3300005293 Ga0065715_10135197 Ga0065715_101351972 318
190 3300005338 Ga0068868_100081754 Ga0068868_1000817542 318
191 3300005354 Ga0070675_100062497 Ga0070675_1000624973 318
192 3300005356 Ga0070674_100094065 Ga0070674_1000940652 318
193 3300005365 Ga0070688_100102789 Ga0070688_1001027892 318
194 3300005458 Ga0070681_10115146 Ga0070681_101151463 318
195 3300005518 Ga0070699_100008844 Ga0070699_1000088445 318
196 3300005518 Ga0070699_100142028 Ga0070699_1001420282 318
197 3300005536 Ga0070697_100114369 Ga0070697_1001143692 318
198 3300005536 Ga0070697_100213122 Ga0070697_1002131222 318
199 3300005563 Ga0068855_100090370 Ga0068855_1000903703 318
200 3300005564 Ga0070664_100167238 Ga0070664_1001672382 318
201 3300005617 Ga0068859_100096386 Ga0068859_1000963862 318
202 3300005718 Ga0068866_10042044 Ga0068866_100420442 318
203 3300005840 Ga0068870_10153995 Ga0068870_101539952 318
204 3300005843 Ga0068860_100214245 Ga0068860_1002142451 318
205 3300006844 Ga0075428_100000017 Ga0075428_100000017141 318
206 3300006871 Ga0075434_100309012 Ga0075434_1003090121 318
207 3300006914 Ga0075436_100007465 Ga0075436_1000074658 318
208 3300006914 Ga0075436_100051077 Ga0075436_1000510772 318
209 3300006931 Ga0097620_100096382 Ga0097620_1000963822 318
210 3300007076 Ga0075435_100014303 Ga0075435_1000143036 318
211 3300007076 Ga0075435_100052786 Ga0075435_1000527863 318
212 3300009094 Ga0111539_10000002 Ga0111539_10000002297 318
213 3300009094 Ga0111539_10100110 Ga0111539_101001102 318
214 3300009098 Ga0105245_10011522 Ga0105245_1001152210 318
215 3300009147 Ga0114129_10010673 Ga0114129_100106736 318
216 3300009147 Ga0114129_10151568 Ga0114129_101515683 318
217 3300009148 Ga0105243_10072653 Ga0105243_100726533 318
218 3300009551 Ga0105238_10262399 Ga0105238_102623992 318
219 3300013296 Ga0157374_10149082 Ga0157374_101490822 318
220 3300013297 Ga0157378_10221691 Ga0157378_102216912 318
221 3300013308 Ga0157375_10355005 Ga0157375_103550052 318
222 3300014745 Ga0157377_10265537 Ga0157377_102655371 318
223 3300014969 Ga0157376_10128111 Ga0157376_101281112 318
224 3300025899 Ga0207642_10045331 Ga0207642_100453312 318
225 3300025926 Ga0207659_10050871 Ga0207659_100508713 318
226 3300025927 Ga0207687_10033310 Ga0207687_100333102 318
227 3300025934 Ga0207686_10047118 Ga0207686_100471182 318
228 3300025936 Ga0207670_10225456 Ga0207670_102254561 318
229 3300025937 Ga0207669_10025467 Ga0207669_100254673 318
230 3300025942 Ga0207689_10048944 Ga0207689_100489443 318
231 3300025945 Ga0207679_10102621 Ga0207679_101026212 318
232 3300026023 Ga0207677_10246578 Ga0207677_102465782 318
233 3300026035 Ga0207703_10017299 Ga0207703_100172993 318
234 3300026088 Ga0207641_10224630 Ga0207641_102246302 318
235 3300026089 Ga0207648_10024886 Ga0207648_100248864 318
236 3300026121 Ga0207683_10022865 Ga0207683_100228656 318
237 3300027907 Ga0207428_10000004 Ga0207428_10000004359 318
238 3300027907 Ga0207428_10024144 Ga0207428_100241443 318
239 3300028381 Ga0268264_10454422 Ga0268264_104544221 318
240 3300031995 Ga0307409_100335642 Ga0307409_1003356422 318
241 3300042001 Ga0439441_013013 Ga0439441_013013_217_1176 318
242 3300048907 Ga0496104_0138802 Ga0496104_0138802_718_1686 318
243 3300048917 Ga0496114_0190531 Ga0496114_0190531_563_1531 318
244 3300050507 nmdc:mga05p37_37138_c1 nmdc:mga05p37_37138_c1_4476_5444 318
245 3300050507 nmdc:mga05p37_47253_c1 nmdc:mga05p37_47253_c1_3200_4168 318
246 3300050511 nmdc:mga08y16_2_c1 nmdc:mga08y16_2_c1_623300_624289 318
247 3300050511 nmdc:mga08y16_80229_c1 nmdc:mga08y16_80229_c1_416_1378 318
248 3300050513 nmdc:mga0rr50_41621_c1 nmdc:mga0rr50_41621_c1_2029_2997 318
249 3300050514 nmdc:mga08x19_100136_c1 nmdc:mga08x19_100136_c1_799_1764 318
250 3300050514 nmdc:mga08x19_95213_c1 nmdc:mga08x19_95213_c1_675_1643 318
251 3300005295 Ga0065707_10086081 Ga0065707_100860815 319
252 3300005328 Ga0070676_10118138 Ga0070676_101181382 319
253 3300005328 Ga0070676_10130460 Ga0070676_101304602 319
254 3300005335 Ga0070666_10014565 Ga0070666_100145654 319
255 3300005343 Ga0070687_100029403 Ga0070687_1000294032 319
256 3300005347 Ga0070668_100021252 Ga0070668_1000212524 319
257 3300005354 Ga0070675_100044719 Ga0070675_1000447192 319
258 3300005441 Ga0070700_100066730 Ga0070700_1000667302 319
259 3300005444 Ga0070694_100010135 Ga0070694_1000101353 319
260 3300005543 Ga0070672_100212626 Ga0070672_1002126262 319
261 3300005544 Ga0070686_100005995 Ga0070686_1000059955 319
262 3300005545 Ga0070695_100001664 Ga0070695_1000016649 319
263 3300005546 Ga0070696_100235233 Ga0070696_1002352332 319
264 3300005549 Ga0070704_100001492 Ga0070704_1000014924 319
265 3300005549 Ga0070704_100401557 Ga0070704_1004015571 319
266 3300005578 Ga0068854_100078901 Ga0068854_1000789012 319
267 3300005719 Ga0068861_100042313 Ga0068861_1000423133 319
268 3300005719 Ga0068861_100271495 Ga0068861_1002714952 319
269 3300005719 Ga0068861_100279642 Ga0068861_1002796422 319
270 3300005844 Ga0068862_100048114 Ga0068862_1000481143 319
271 3300005844 Ga0068862_100298998 Ga0068862_1002989981 319
272 3300006237 Ga0097621_100023387 Ga0097621_1000233874 319
273 3300006844 Ga0075428_100086142 Ga0075428_1000861422 319
274 3300006852 Ga0075433_10003764 Ga0075433_1000376411 319
275 3300006871 Ga0075434_100000776 Ga0075434_10000077616 319
276 3300006871 Ga0075434_100002394 Ga0075434_10000239414 319
277 3300006871 Ga0075434_100152430 Ga0075434_1001524303 319
278 3300006914 Ga0075436_100012376 Ga0075436_1000123762 319
279 3300006914 Ga0075436_100118068 Ga0075436_1001180682 319
280 3300006914 Ga0075436_100158466 Ga0075436_1001584662 319
281 3300007076 Ga0075435_100000189 Ga0075435_10000018931 319
282 3300007076 Ga0075435_100016466 Ga0075435_1000164663 319
283 3300007076 Ga0075435_100081092 Ga0075435_1000810922 319
284 3300009094 Ga0111539_10023599 Ga0111539_100235999 319
285 3300009094 Ga0111539_10073900 Ga0111539_100739003 319
286 3300009147 Ga0114129_10053753 Ga0114129_100537532 319
287 3300009174 Ga0105241_10138962 Ga0105241_101389622 319
288 3300009553 Ga0105249_10288661 Ga0105249_102886612 319
289 3300009553 Ga0105249_10637329 Ga0105249_106373291 319
290 3300013296 Ga0157374_10151065 Ga0157374_101510652 319
291 3300013297 Ga0157378_10326278 Ga0157378_103262782 319
292 3300014326 Ga0157380_10002539 Ga0157380_1000253910 319
293 3300014969 Ga0157376_10160360 Ga0157376_101603602 319
294 3300014969 Ga0157376_10315677 Ga0157376_103156772 319
295 3300025315 Ga0207697_10051488 Ga0207697_100514882 319
296 3300025899 Ga0207642_10043311 Ga0207642_100433112 319
297 3300025903 Ga0207680_10027116 Ga0207680_100271162 319
298 3300025907 Ga0207645_10057965 Ga0207645_100579652 319
299 3300025907 Ga0207645_10094811 Ga0207645_100948112 319
300 3300025911 Ga0207654_10143707 Ga0207654_101437072 319
301 3300025918 Ga0207662_10055148 Ga0207662_100551482 319
302 3300025926 Ga0207659_10000469 Ga0207659_1000046919 319
303 3300025926 Ga0207659_10020682 Ga0207659_100206822 319
304 3300025933 Ga0207706_10120305 Ga0207706_101203053 319
305 3300025934 Ga0207686_10061342 Ga0207686_100613422 319
306 3300025937 Ga0207669_10204138 Ga0207669_102041382 319
307 3300025940 Ga0207691_10178227 Ga0207691_101782271 319
308 3300025940 Ga0207691_10266857 Ga0207691_102668572 319
309 3300025944 Ga0207661_10294735 Ga0207661_102947352 319
310 3300025960 Ga0207651_10428406 Ga0207651_104284061 319
311 3300025961 Ga0207712_10055468 Ga0207712_100554682 319
312 3300025972 Ga0207668_10040853 Ga0207668_100408533 319
313 3300025981 Ga0207640_10064900 Ga0207640_100649002 319
314 3300025986 Ga0207658_10105855 Ga0207658_101058552 319
315 3300026023 Ga0207677_10189557 Ga0207677_101895572 319
316 3300026075 Ga0207708_10060383 Ga0207708_100603832 319
317 3300026075 Ga0207708_10113184 Ga0207708_101131842 319
318 3300026089 Ga0207648_10094647 Ga0207648_100946472 319
319 3300026118 Ga0207675_100005749 Ga0207675_1000057493 319
320 3300026118 Ga0207675_100257153 Ga0207675_1002571532 319
321 3300026118 Ga0207675_100258124 Ga0207675_1002581242 319
322 3300027907 Ga0207428_10008285 Ga0207428_100082853 319
323 3300027907 Ga0207428_10013831 Ga0207428_100138312 319
324 3300028380 Ga0268265_10014309 Ga0268265_100143094 319
325 3300028380 Ga0268265_10178786 Ga0268265_101787862 319
326 3300028381 Ga0268264_10560911 Ga0268264_105609111 319
327 3300034816 Ga0373930_0003255 Ga0373930_0003255_309_1280 319
328 3300034817 Ga0373948_0003137 Ga0373948_0003137_455_1426 319
329 3300034818 Ga0373950_0004750 Ga0373950_0004750_142_1113 319
330 3300034820 Ga0373959_0001235 Ga0373959_0001235_2687_3658 319
331 3300035085 Ga0373929_0005265 Ga0373929_0005265_425_1396 319
332 3300035090 Ga0373949_0001113 Ga0373949_0001113_6109_7080 319
333 3300035091 Ga0373951_0002359 Ga0373951_0002359_932_1903 319
334 3300035092 Ga0373952_0000406 Ga0373952_0000406_3052_4023 319
335 3300035112 Ga0373932_0001419 Ga0373932_0001419_2880_3851 319
336 3300035114 Ga0373939_0000596 Ga0373939_0000596_3416_4387 319
337 3300035115 Ga0373941_0001790 Ga0373941_0001790_3396_4367 319
338 3300035121 Ga0373960_0000967 Ga0373960_0000967_2645_3616 319
339 3300035207 Ga0373942_0001095 Ga0373942_0001095_3753_4724 319
340 3300035241 Ga0373961_0002928 Ga0373961_0002928_1045_2016 319
341 3300035724 Ga0373933_0033710 Ga0373933_0033710_158_1120 319
342 3300036401 Ga0373937_0019618 Ga0373937_0019618_4015_4977 319
343 3300045051 Ga0451576_0010717 Ga0451576_0010717_7091_8062 319
344 3300046491 Ga0495584_0013157 Ga0495584_0013157_1397_2356 319
345 3300047445 Ga0495677_0008003 Ga0495677_0008003_945_1904 319
346 3300048905 Ga0496102_0096843 Ga0496102_0096843_918_1889 319
347 3300050507 nmdc:mga05p37_2382_c1 nmdc:mga05p37_2382_c1_1939_2910 319
348 3300050511 nmdc:mga08y16_15581_c1 nmdc:mga08y16_15581_c1_6209_7174 319
349 3300050511 nmdc:mga08y16_88864_c1 nmdc:mga08y16_88864_c1_2101_3072 319
350 3300050512 nmdc:mga0n895_121_c1 nmdc:mga0n895_121_c1_8043_9014 319
351 3300050512 nmdc:mga0n895_176756_c1 nmdc:mga0n895_176756_c1_813_1784 319
352 3300050512 nmdc:mga0n895_21582_c1 nmdc:mga0n895_21582_c1_1027_1998 319
353 3300050512 nmdc:mga0n895_60891_c1 nmdc:mga0n895_60891_c1_2512_3483 319
354 3300050513 nmdc:mga0rr50_107_c1 nmdc:mga0rr50_107_c1_8043_9014 319
355 3300050513 nmdc:mga0rr50_133227_c1 nmdc:mga0rr50_133227_c1_93_1058 319
356 3300050513 nmdc:mga0rr50_269059_c1 nmdc:mga0rr50_269059_c1_65_1036 319
357 3300050513 nmdc:mga0rr50_698_c1 nmdc:mga0rr50_698_c1_10466_11437 319
358 3300050514 nmdc:mga08x19_810_c1 nmdc:mga08x19_810_c1_4765_5736 319
359 3300050514 nmdc:mga08x19_83852_c1 nmdc:mga08x19_83852_c1_199_1170 319
360 3300050515 nmdc:mga0a205_19178_c1 nmdc:mga0a205_19178_c1_3248_4219 319
361 3300050515 nmdc:mga0a205_26289_c1 nmdc:mga0a205_26289_c1_1838_2809 319
362 3300050515 nmdc:mga0a205_327005_c1 nmdc:mga0a205_327005_c1_246_1217 319
363 3300005328 Ga0070676_10054275 Ga0070676_100542752 320
364 3300005329 Ga0070683_100608998 Ga0070683_1006089981 320
365 3300005338 Ga0068868_100229273 Ga0068868_1002292732 320
366 3300005338 Ga0068868_100482982 Ga0068868_1004829821 320
367 3300005339 Ga0070660_100307780 Ga0070660_1003077802 320
368 3300005340 Ga0070689_100259001 Ga0070689_1002590011 320
369 3300005438 Ga0070701_10044526 Ga0070701_100445261 320
370 3300005440 Ga0070705_100063021 Ga0070705_1000630212 320
371 3300005444 Ga0070694_100061360 Ga0070694_1000613602 320
372 3300005467 Ga0070706_100109454 Ga0070706_1001094542 320
373 3300005468 Ga0070707_100136308 Ga0070707_1001363082 320
374 3300005468 Ga0070707_100182589 Ga0070707_1001825892 320
375 3300005471 Ga0070698_100006486 Ga0070698_10000648612 320
376 3300005518 Ga0070699_100060409 Ga0070699_1000604092 320
377 3300005543 Ga0070672_100305191 Ga0070672_1003051912 320
378 3300005545 Ga0070695_100205619 Ga0070695_1002056192 320
379 3300005546 Ga0070696_100002737 Ga0070696_10000273713 320
380 3300005548 Ga0070665_100003820 Ga0070665_10000382016 320
381 3300005549 Ga0070704_100150039 Ga0070704_1001500392 320
382 3300005564 Ga0070664_100109793 Ga0070664_1001097932 320
383 3300005617 Ga0068859_100009537 Ga0068859_1000095372 320
384 3300005618 Ga0068864_100144259 Ga0068864_1001442592 320
385 3300005834 Ga0068851_10055687 Ga0068851_100556872 320
386 3300005843 Ga0068860_100057663 Ga0068860_1000576632 320
387 3300005937 Ga0081455_10170061 Ga0081455_101700612 320
388 3300005985 Ga0081539_10029438 Ga0081539_100294382 320
389 3300006237 Ga0097621_100139524 Ga0097621_1001395242 320
390 3300006237 Ga0097621_100203536 Ga0097621_1002035362 320
391 3300006358 Ga0068871_100000886 Ga0068871_10000088618 320
392 3300006852 Ga0075433_10117336 Ga0075433_101173362 320
393 3300006871 Ga0075434_100148793 Ga0075434_1001487932 320
394 3300006881 Ga0068865_100004376 Ga0068865_1000043763 320
395 3300006931 Ga0097620_100009538 Ga0097620_1000095382 320
396 3300009093 Ga0105240_10136105 Ga0105240_101361052 320
397 3300009147 Ga0114129_10001304 Ga0114129_1000130438 320
398 3300009147 Ga0114129_10029839 Ga0114129_1002983910 320
399 3300009176 Ga0105242_10003085 Ga0105242_100030852 320
400 3300009177 Ga0105248_10168579 Ga0105248_101685792 320
401 3300009553 Ga0105249_10348586 Ga0105249_103485862 320
402 3300014968 Ga0157379_10064058 Ga0157379_100640582 320
403 3300025910 Ga0207684_10256589 Ga0207684_102565892 320
404 3300025913 Ga0207695_10073986 Ga0207695_100739862 320
405 3300025919 Ga0207657_10288283 Ga0207657_102882832 320
406 3300025922 Ga0207646_10155840 Ga0207646_101558403 320
407 3300025922 Ga0207646_10197068 Ga0207646_101970682 320
408 3300025927 Ga0207687_10018987 Ga0207687_100189874 320
409 3300025927 Ga0207687_10020499 Ga0207687_100204995 320
410 3300025934 Ga0207686_10008188 Ga0207686_100081882 320
411 3300025934 Ga0207686_10016272 Ga0207686_100162722 320
412 3300025938 Ga0207704_10092370 Ga0207704_100923702 320
413 3300025940 Ga0207691_10307698 Ga0207691_103076982 320
414 3300025944 Ga0207661_10317079 Ga0207661_103170792 320
415 3300025961 Ga0207712_10065445 Ga0207712_100654452 320
416 3300026035 Ga0207703_10576028 Ga0207703_105760281 320
417 3300026078 Ga0207702_10019341 Ga0207702_100193416 320
418 3300026088 Ga0207641_10011933 Ga0207641_100119332 320
419 3300026095 Ga0207676_10106844 Ga0207676_101068442 320
420 3300026142 Ga0207698_10278884 Ga0207698_102788842 320
421 3300035170 Ga0373943_0043080 Ga0373943_0043080_498_1475 320
422 3300046663 Ga0495635_0050102 Ga0495635_0050102_807_1781 320
423 3300048915 Ga0496112_0184591 Ga0496112_0184591_162_1136 320
424 3300048917 Ga0496114_0113358 Ga0496114_0113358_727_1704 320
425 3300048918 Ga0496115_0096530 Ga0496115_0096530_1188_2165 320
426 3300050507 nmdc:mga05p37_22313_c1 nmdc:mga05p37_22313_c1_6035_7006 320
427 3300050507 nmdc:mga05p37_29948_c1 nmdc:mga05p37_29948_c1_4914_5879 320
428 3300050512 nmdc:mga0n895_425937_c1 nmdc:mga0n895_425937_c1_257_1234 320
429 3300050514 nmdc:mga08x19_243383_c1 nmdc:mga08x19_243383_c1_128_1099 320
430 3300050515 nmdc:mga0a205_54296_c1 nmdc:mga0a205_54296_c1_158_1129 320
431 3300006871 Ga0075434_100094349 Ga0075434_1000943493 321
432 3300025941 Ga0207711_10211600 Ga0207711_102116002 321
433 3300035117 Ga0373953_0062282 Ga0373953_0062282_514_1491 321
434 3300036401 Ga0373937_0096815 Ga0373937_0096815_488_1465 321
435 3300046535 Ga0495586_0007998 Ga0495586_0007998_3213_4190 321
436 3300046543 Ga0495645_0007627 Ga0495645_0007627_1385_2362 321
437 3300047471 Ga0495684_0038585 Ga0495684_0038585_73_1050 321
438 3300048917 Ga0496114_0089464 Ga0496114_0089464_99_1076 321
439 3300053085 Ga0495619_0139658 Ga0495619_0139658_552_1529 321
440 3300005340 Ga0070689_100019892 Ga0070689_1000198925 322
441 3300005347 Ga0070668_100331697 Ga0070668_1003316972 322
442 3300005364 Ga0070673_100066690 Ga0070673_1000666903 322
443 3300005365 Ga0070688_100102577 Ga0070688_1001025771 322
444 3300005366 Ga0070659_100218265 Ga0070659_1002182652 322
445 3300005367 Ga0070667_100160979 Ga0070667_1001609791 322
446 3300005466 Ga0070685_10009815 Ga0070685_100098152 322
447 3300005543 Ga0070672_100259729 Ga0070672_1002597292 322
448 3300005937 Ga0081455_10050373 Ga0081455_100503734 322
449 3300025936 Ga0207670_10068217 Ga0207670_100682173 322
450 3300025972 Ga0207668_10421385 Ga0207668_104213851 322
451 3300026121 Ga0207683_10300287 Ga0207683_103002872 322
452 3300049741 Ga0501079_0314879 Ga0501079_0314879_164_1138 322
453 3300054114 Ga0501084_0247509 Ga0501084_0247509_132_1106 322
454 3300060353 Ga0501082_0214629 Ga0501082_0214629_587_1561 322
455 3300049741 Ga0501079_0061373 Ga0501079_0061373_1297_2274 323
456 3300060353 Ga0501082_0013253 Ga0501082_0013253_287_1264 323
457 3300005293 Ga0065715_10174685 Ga0065715_101746852 324
458 3300005333 Ga0070677_10073522 Ga0070677_100735222 324
459 3300006844 Ga0075428_100166794 Ga0075428_1001667942 324
460 3300006846 Ga0075430_100031640 Ga0075430_1000316402 324
461 3300006846 Ga0075430_100040846 Ga0075430_1000408462 324
462 3300006847 Ga0075431_100028475 Ga0075431_1000284757 324
463 3300006847 Ga0075431_100380888 Ga0075431_1003808882 324
464 3300006880 Ga0075429_100050280 Ga0075429_1000502802 324
465 3300009094 Ga0111539_10188878 Ga0111539_101888782 324
466 3300009147 Ga0114129_10050070 Ga0114129_100500705 324
467 3300031548 Ga0307408_100372750 Ga0307408_1003727502 324
468 3300031995 Ga0307409_100084611 Ga0307409_1000846112 324
469 3300037471 Ga0395905_0234635 Ga0395905_0234635_391_1368 324
470 3300050508 nmdc:mga09592_9128_c1 nmdc:mga09592_9128_c1_1436_2413 324
471 3300050509 nmdc:mga0qj67_41941_c1 nmdc:mga0qj67_41941_c1_2213_3190 324
472 3300050509 nmdc:mga0qj67_94105_c1 nmdc:mga0qj67_94105_c1_469_1446 324
473 3300050510 nmdc:mga06r32_65143_c1 nmdc:mga06r32_65143_c1_2242_3219 324
474 3300005290 Ga0065712_10069274 Ga0065712_100692743 325
475 3300005295 Ga0065707_10113682 Ga0065707_101136822 325
476 3300005337 Ga0070682_100159390 Ga0070682_1001593902 325
477 3300005441 Ga0070700_100100211 Ga0070700_1001002112 325
478 3300005844 Ga0068862_100173826 Ga0068862_1001738261 325
479 3300006852 Ga0075433_10016511 Ga0075433_100165115 325
480 3300014326 Ga0157380_10022266 Ga0157380_100222665 325
481 3300025961 Ga0207712_10032026 Ga0207712_100320262 325
482 3300025972 Ga0207668_10087410 Ga0207668_100874102 325
483 3300026075 Ga0207708_10065373 Ga0207708_100653734 325
484 3300026118 Ga0207675_100074064 Ga0207675_1000740642 325
485 3300031548 Ga0307408_100199210 Ga0307408_1001992101 325
486 3300032002 Ga0307416_100069909 Ga0307416_1000699092 325
487 3300032126 Ga0307415_100023002 Ga0307415_1000230023 325
488 3300042439 Ga0439464_0010378 Ga0439464_0010378_792_1769 325

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00482

T2SSF

Type II secretion system (T2SS), protein F

175

302

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
2whn-assembly1.cif.gz_A n-terminal domain from the pilc type iv pilus biogenesis protein 0.84 151 253
5nbg-assembly1.cif.gz_B structure of the cytoplasmic domain i of outf in the d. dadantii type ii secretion system 0.8326 151 258
2whn-assembly2.cif.gz_B n-terminal domain from the pilc type iv pilus biogenesis protein 0.8088 151 253
5nbg-assembly1.cif.gz_B structure of the cytoplasmic domain i of outf in the d. dadantii type ii secretion system 0.8054 151 258
3c1q-assembly1.cif.gz_A the three-dimensional structure of the cytoplasmic domains of epsf from the type 2 secretion system of vibrio cholerae 0.8001 151 258
ID Description Score Start End Superfamily
af_I6Y479_96_222_1.20.81.30 Mainly Alpha;Up-down Bundle;Receptor-associated Protein;Type II secretion system (T2SS), domain F 0.8653 158 281 1.20.81.30
af_I6Y479_96_222_1.20.81.30 Mainly Alpha;Up-down Bundle;Receptor-associated Protein;Type II secretion system (T2SS), domain F 0.8411 158 281 1.20.81.30
2whnB00 Mainly Alpha;Up-down Bundle;Receptor-associated Protein;Type II secretion system (T2SS), domain F 0.8088 151 253 1.20.81.30
af_P36646_249_359_1.20.81.30 Mainly Alpha;Up-down Bundle;Receptor-associated Protein;Type II secretion system (T2SS), domain F 0.7777 144 254 1.20.81.30
2whnB00 Mainly Alpha;Up-down Bundle;Receptor-associated Protein;Type II secretion system (T2SS), domain F 0.7683 151 253 1.20.81.30
ID Description Score Start End GO Terms
AF-A0A535R8U2-F1-model_v4 Type II secretion system protein GspF domain-containing protein 0.8841 97 320 GO:0005886
AF-A0A1Q7FJ45-F1-model_v4 Type II secretion system protein GspF domain-containing protein 0.8767 87 325 GO:0005886
AF-A0A1Q7FJ45-F1-model_v4 Type II secretion system protein GspF domain-containing protein 0.8635 87 325 GO:0005886
AF-A0A1Q8QSQ9-F1-model_v4 Flp pilus assembly protein TadB 0.8541 108 321 GO:0005886
AF-A0A5C9CMH2-F1-model_v4 Tight adherence protein B 0.8458 88 324 GO:0005886

Feature Viewer

pLDDT pTM Quality
82.02 0.7 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map