F453595

General Info

Members Datasets Scaffolds Average Seq Length
488 222 976 327

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_10165876|Ga0111539_101658762
Length 374
Sequence MYPGKKSGKTVVRLPPKQRKIDMRANIGSVEGKRRQTGSRGAVTTVWLCTLWCIVTLGCSLPATLRAAEAQPRAKVPRIGFLGSSSPSPYEPIIDALRQGMRELGWVEGHNVTIEFRWAEGELERLPALAAALARLEVDVLVTQGTPAAIAAKNATQTLPIIFVQVGDPLGSGLITSLARPGGNLTGLSLLAFELDAKRLEMLKEAVPKASRVAVLWHPDFSPHVEDLRGLKSAAQALGVELQPVAFRHPHDFEAGFAAMRQGGADALLVMGHPMTFNAAPHLAELAVRGRLPAIALYREFAQAGGLMAYGASIAHLYRRAATYVDKILKGTKPGDLPVEQPMKFELVINLKTAKALGITIPPHLLVLADEVIQ

Samples

Sample ID Description Type Environment
1 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
66 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
67 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
84 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
85 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
92 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
93 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
94 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
141 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
144 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
145 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
146 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
147 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
148 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
149 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
150 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
151 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
152 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
153 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
154 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
155 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
156 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
157 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
158 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
159 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
160 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
161 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
162 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
163 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
164 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
165 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
166 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
167 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
168 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
169 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
170 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
171 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
172 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
173 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
174 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
175 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
176 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
177 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
178 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
179 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
180 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
181 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
182 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
183 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
184 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
185 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
186 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
187 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
188 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
189 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
190 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
191 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
192 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
193 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
200 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
201 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
202 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
203 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
204 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
205 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
206 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
207 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
209 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
210 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
211 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
212 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
213 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
214 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
215 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
216 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
217 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
218 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
219 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
220 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
221 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
222 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.41
Rhizosphere 99.59
Stem 0
Stem Tuber 0
Unclassified 12.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0111539_10165876 3300009094 Bacteria 2582
2 Ga0065715_10001135 3300005293 Bacteria 6997
3 Ga0065707_10005106 3300005295 Bacteria 3135
4 Ga0065707_10022148 3300005295 Unclassified 1614
5 Ga0065707_10142773 3300005295 Bacteria 1751
6 Ga0070676_10000476 3300005328 Bacteria 19206
7 Ga0070676_10015896 3300005328 Bacteria 4152
8 Ga0070683_100057262 3300005329 Bacteria 3621
9 Ga0070690_100002974 3300005330 Bacteria 9172
10 Ga0070690_100029956 3300005330 Bacteria 3379
11 Ga0070690_100118986 3300005330 Bacteria 1771
12 Ga0070670_100000766 3300005331 Bacteria 24964
13 Ga0070670_100027105 3300005331 Bacteria 4928
14 Ga0070670_100134497 3300005331 Bacteria 2136
15 Ga0070670_100212714 3300005331 Unclassified 1681
16 Ga0068869_100000321 3300005334 Bacteria 25448
17 Ga0068869_100009092 3300005334 Bacteria 6438
18 Ga0070666_10001388 3300005335 Bacteria 14648
19 Ga0070666_10025934 3300005335 Bacteria 3824
20 Ga0070666_10124633 3300005335 Bacteria 1788
21 Ga0070680_100000065 3300005336 Bacteria 55815
22 Ga0070680_100069081 3300005336 Bacteria 2901
23 Ga0070680_100209790 3300005336 Unclassified 1643
24 Ga0070682_100001260 3300005337 Bacteria 14381
25 Ga0068868_100231129 3300005338 Bacteria 1551
26 Ga0070660_100001579 3300005339 Bacteria 15671
27 Ga0070660_100018902 3300005339 Bacteria 5043
28 Ga0070689_100226820 3300005340 Bacteria 1534
29 Ga0070691_10008482 3300005341 Bacteria 4706
30 Ga0070687_100000403 3300005343 Bacteria 14616
31 Ga0070661_100022031 3300005344 Bacteria 4558
32 Ga0070661_100029269 3300005344 Bacteria 3974
33 Ga0070668_100000682 3300005347 Bacteria 23141
34 Ga0070669_100001716 3300005353 Bacteria 15868
35 Ga0070669_100005653 3300005353 Bacteria 9030
36 Ga0070675_100031834 3300005354 Bacteria 4266
37 Ga0070671_100042211 3300005355 Bacteria 3791
38 Ga0070671_100080794 3300005355 Bacteria 2718
39 Ga0070671_100385774 3300005355 Archaea 1197
40 Ga0070674_100004651 3300005356 Bacteria 7841
41 Ga0070674_100031368 3300005356 Bacteria 3521
42 Ga0070673_100036336 3300005364 Bacteria 3743
43 Ga0070659_100000328 3300005366 Bacteria 36586
44 Ga0070659_100075351 3300005366 Bacteria 2689
45 Ga0070667_100003490 3300005367 Bacteria 13399
46 Ga0070667_100015974 3300005367 Bacteria 6211
47 Ga0070703_10016430 3300005406 Bacteria 2124
48 Ga0070705_100000722 3300005440 Bacteria 18821
49 Ga0070705_100031266 3300005440 Bacteria 2946
50 Ga0070705_100046316 3300005440 Bacteria 2506
51 Ga0070705_100052275 3300005440 Bacteria 2386
52 Ga0070705_100099393 3300005440 Bacteria 1833
53 Ga0070705_100118007 3300005440 Bacteria 1708
54 Ga0070705_100215637 3300005440 Bacteria 1326
55 Ga0070694_100000769 3300005444 Bacteria 17948
56 Ga0070694_100010109 3300005444 Bacteria 5804
57 Ga0070694_100018373 3300005444 Unclassified 4437
58 Ga0070694_100073113 3300005444 Bacteria 2367
59 Ga0070694_100122960 3300005444 Bacteria 1864
60 Ga0070708_100070142 3300005445 Unclassified 3152
61 Ga0070708_100086294 3300005445 Bacteria 2850
62 Ga0070708_100212137 3300005445 Unclassified 1814
63 Ga0070662_100001421 3300005457 Bacteria 14771
64 Ga0070662_100036873 3300005457 Bacteria 3463
65 Ga0070681_10000731 3300005458 Bacteria 27148
66 Ga0070681_10002977 3300005458 Bacteria 15719
67 Ga0068867_100000496 3300005459 Bacteria 26273
68 Ga0068867_100002193 3300005459 Bacteria 13706
69 Ga0068867_100069503 3300005459 Bacteria 2630
70 Ga0070706_100016270 3300005467 Bacteria 6871
71 Ga0070706_100161762 3300005467 Unclassified 2091
72 Ga0070706_100200148 3300005467 Bacteria 1866
73 Ga0070707_100085327 3300005468 Bacteria 3052
74 Ga0070707_100129093 3300005468 Unclassified 2457
75 Ga0070698_100060615 3300005471 Unclassified 3818
76 Ga0070698_100104926 3300005471 Bacteria 2796
77 Ga0070698_100205734 3300005471 Unclassified 1903
78 Ga0070698_100356929 3300005471 Bacteria 1393
79 Ga0070699_100013165 3300005518 Bacteria 7133
80 Ga0070699_100038848 3300005518 Bacteria 4120
81 Ga0070699_100041465 3300005518 Bacteria 3985
82 Ga0070699_100049343 3300005518 Bacteria 3643
83 Ga0070679_100021689 3300005530 Bacteria 6272
84 Ga0070684_100048064 3300005535 Bacteria 3701
85 Ga0070684_100164622 3300005535 Unclassified 2013
86 Ga0068853_100017608 3300005539 Bacteria 5897
87 Ga0070672_100001295 3300005543 Bacteria 15400
88 Ga0070672_100059295 3300005543 Bacteria 3011
89 Ga0070672_100119379 3300005543 Unclassified 2157
90 Ga0070686_100056968 3300005544 Bacteria 2509
91 Ga0070695_100000608 3300005545 Bacteria 18993
92 Ga0070695_100021949 3300005545 Bacteria 3912
93 Ga0070695_100073576 3300005545 Bacteria 2243
94 Ga0070696_100000452 3300005546 Bacteria 25685
95 Ga0070696_100054481 3300005546 Bacteria 2787
96 Ga0070696_100059794 3300005546 Bacteria 2664
97 Ga0070696_100129415 3300005546 Archaea 1835
98 Ga0070696_100178774 3300005546 Bacteria 1573
99 Ga0070696_100286150 3300005546 Unclassified 1258
100 Ga0070693_100000433 3300005547 Bacteria 18870
101 Ga0070665_100315688 3300005548 Bacteria 1567
102 Ga0070704_100001704 3300005549 Bacteria 11975
103 Ga0070704_100003315 3300005549 Bacteria 9212
104 Ga0070704_100007261 3300005549 Bacteria 6591
105 Ga0070704_100026966 3300005549 Unclassified 3803
106 Ga0070704_100031283 3300005549 Bacteria 3578
107 Ga0070704_100141209 3300005549 Bacteria 1881
108 Ga0068855_100000362 3300005563 Bacteria 56297
109 Ga0070664_100006255 3300005564 Bacteria 9616
110 Ga0068857_100033515 3300005577 Bacteria 4542
111 Ga0068857_100110729 3300005577 Bacteria 2468
112 Ga0068854_100000727 3300005578 Bacteria 19517
113 Ga0068856_100001467 3300005614 Bacteria 24695
114 Ga0068852_100025895 3300005616 Bacteria 4760
115 Ga0068852_100109464 3300005616 Bacteria 2509
116 Ga0068859_100000348 3300005617 Bacteria 46023
117 Ga0068859_100020830 3300005617 Bacteria 6581
118 Ga0068859_100089493 3300005617 Bacteria 3128
119 Ga0068864_100039186 3300005618 Bacteria 4049
120 Ga0068864_100066089 3300005618 Bacteria 3138
121 Ga0068864_100126627 3300005618 Bacteria 2289
122 Ga0068864_100402255 3300005618 Unclassified 1301
123 Ga0068866_10046693 3300005718 Bacteria 2179
124 Ga0068861_100004066 3300005719 Bacteria 9799
125 Ga0068861_100049253 3300005719 Bacteria 3189
126 Ga0068870_10000738 3300005840 Bacteria 12585
127 Ga0068863_100011042 3300005841 Bacteria 8762
128 Ga0068858_100003840 3300005842 Bacteria 14854
129 Ga0068858_100105946 3300005842 Bacteria 2624
130 Ga0068858_100452346 3300005842 Bacteria 1237
131 Ga0068860_100001826 3300005843 Bacteria 22678
132 Ga0068860_100017708 3300005843 Bacteria 6939
133 Ga0068860_100029508 3300005843 Bacteria 5277
134 Ga0068862_100001689 3300005844 Bacteria 20013
135 Ga0068862_100008484 3300005844 Bacteria 8498
136 Ga0068862_100014789 3300005844 Bacteria 6482
137 Ga0068862_100041851 3300005844 Bacteria 3900
138 Ga0097621_100349879 3300006237 Unclassified 1314
139 Ga0068871_100111243 3300006358 Bacteria 2304
140 Ga0075428_100000123 3300006844 Bacteria 66826
141 Ga0075428_100022854 3300006844 Bacteria 6919
142 Ga0075428_100026177 3300006844 Bacteria 6461
143 Ga0075428_100040265 3300006844 Bacteria 5142
144 Ga0075428_100085075 3300006844 Bacteria 3449
145 Ga0075428_100177125 3300006844 Bacteria 2309
146 Ga0075428_100228006 3300006844 Bacteria 2010
147 Ga0075428_100260320 3300006844 Unclassified 1868
148 Ga0075428_100316134 3300006844 Unclassified 1678
149 Ga0075428_100344678 3300006844 Bacteria 1599
150 Ga0075428_100492666 3300006844 Bacteria 1311
151 Ga0075430_100056653 3300006846 Bacteria 3296
152 Ga0075430_100156537 3300006846 Bacteria 1897
153 Ga0075430_100165493 3300006846 Bacteria 1840
154 Ga0075430_100217903 3300006846 Unclassified 1584
155 Ga0075430_100242332 3300006846 Unclassified 1494
156 Ga0075430_100260443 3300006846 Bacteria 1436
157 Ga0075430_100272625 3300006846 Bacteria 1400
158 Ga0075430_100303590 3300006846 Bacteria 1320
159 Ga0075431_100000773 3300006847 Bacteria 27751
160 Ga0075431_100004664 3300006847 Bacteria 13466
161 Ga0075431_100009686 3300006847 Bacteria 9676
162 Ga0075431_100039875 3300006847 Bacteria 4838
163 Ga0075431_100070746 3300006847 Bacteria 3600
164 Ga0075431_100108033 3300006847 Bacteria 2871
165 Ga0075431_100156649 3300006847 Bacteria 2343
166 Ga0075431_100252908 3300006847 Bacteria 1790
167 Ga0075431_100310116 3300006847 Bacteria 1593
168 Ga0075431_100311751 3300006847 Unclassified 1588
169 Ga0075431_100356535 3300006847 Bacteria 1470
170 Ga0075433_10007677 3300006852 Bacteria 8566
171 Ga0075433_10014415 3300006852 Bacteria 6457
172 Ga0075433_10022985 3300006852 Bacteria 5243
173 Ga0075433_10224535 3300006852 Bacteria 1668
174 Ga0075434_100248426 3300006871 Bacteria 1798
175 Ga0075434_100317161 3300006871 Bacteria 1579
176 Ga0075434_100644662 3300006871 Bacteria 1077
177 Ga0075429_100007421 3300006880 Bacteria 9515
178 Ga0075429_100017070 3300006880 Bacteria 6276
179 Ga0075429_100023570 3300006880 Bacteria 5341
180 Ga0075429_100115871 3300006880 Bacteria 2342
181 Ga0075429_100195307 3300006880 Bacteria 1773
182 Ga0075429_100239192 3300006880 Bacteria 1590
183 Ga0075429_100319006 3300006880 Unclassified 1360
184 Ga0068865_100000599 3300006881 Bacteria 20236
185 Ga0068865_100049950 3300006881 Unclassified 2887
186 Ga0097620_100000348 3300006931 Bacteria 46023
187 Ga0097620_100020830 3300006931 Bacteria 6581
188 Ga0097620_100089494 3300006931 Bacteria 3128
189 Ga0075435_100032310 3300007076 Bacteria 4132
190 Ga0075435_100120091 3300007076 Bacteria 2193
191 Ga0075435_100182868 3300007076 Unclassified 1772
192 Ga0111539_10000370 3300009094 Bacteria 55548
193 Ga0111539_10033321 3300009094 Bacteria 6254
194 Ga0111539_10092899 3300009094 Unclassified 3544
195 Ga0111539_10179803 3300009094 Bacteria 2471
196 Ga0111539_10190486 3300009094 Bacteria 2393
197 Ga0111539_10261499 3300009094 Bacteria 2014
198 Ga0111539_10460155 3300009094 Unclassified 1481
199 Ga0105245_10114952 3300009098 Bacteria 2507
200 Ga0114129_10006726 3300009147 Bacteria 16322
201 Ga0114129_10080517 3300009147 Bacteria 4527
202 Ga0114129_10099669 3300009147 Bacteria 4021
203 Ga0114129_10117668 3300009147 Bacteria 3661
204 Ga0114129_10206245 3300009147 Unclassified 2659
205 Ga0114129_10218656 3300009147 Bacteria 2572
206 Ga0114129_10422252 3300009147 Bacteria 1753
207 Ga0114129_10589793 3300009147 Bacteria 1441
208 Ga0114129_10762799 3300009147 Bacteria 1237
209 Ga0105243_10002376 3300009148 Bacteria 15759
210 Ga0105243_10068706 3300009148 Bacteria 2856
211 Ga0105243_10249797 3300009148 Bacteria 1583
212 Ga0105241_10001012 3300009174 Bacteria 21376
213 Ga0105241_10016373 3300009174 Bacteria 5437
214 Ga0105241_10064764 3300009174 Bacteria 2823
215 Ga0105242_10003692 3300009176 Bacteria 11916
216 Ga0105242_10137919 3300009176 Bacteria 2113
217 Ga0105248_10009844 3300009177 Bacteria 10530
218 Ga0105248_10083636 3300009177 Bacteria 3590
219 Ga0105237_10181724 3300009545 Bacteria 2104
220 Ga0105249_10008572 3300009553 Bacteria 8916
221 Ga0105249_10060781 3300009553 Bacteria 3466
222 Ga0105249_10125648 3300009553 Bacteria 2442
223 Ga0105239_10055074 3300010375 Bacteria 4362
224 Ga0105246_10015557 3300011119 Bacteria 4807
225 Ga0157373_10000347 3300013100 Bacteria 37452
226 Ga0157371_10110270 3300013102 Bacteria 1953
227 Ga0157369_10004346 3300013105 Bacteria 16724
228 Ga0157374_10012109 3300013296 Bacteria 7491
229 Ga0157378_10212800 3300013297 Bacteria 1834
230 Ga0163162_10064610 3300013306 Bacteria 3704
231 Ga0163162_10424887 3300013306 Unclassified 1461
232 Ga0163162_10516288 3300013306 Unclassified 1324
233 Ga0157372_10000280 3300013307 Bacteria 56597
234 Ga0157372_10330321 3300013307 Bacteria 1775
235 Ga0157372_10369177 3300013307 Bacteria 1672
236 Ga0157375_10155228 3300013308 Bacteria 2427
237 Ga0157375_10302197 3300013308 Bacteria 1764
238 Ga0157380_10601508 3300014326 Bacteria 1088
239 Ga0157379_10002864 3300014968 Bacteria 14545
240 Ga0157379_10503456 3300014968 Unclassified 1123
241 Ga0163161_10000551 3300017792 Bacteria 30373
242 Ga0207688_10058911 3300025901 Bacteria 2162
243 Ga0207680_10294229 3300025903 Unclassified 1130
244 Ga0207645_10002393 3300025907 Bacteria 14764
245 Ga0207645_10004272 3300025907 Bacteria 10604
246 Ga0207645_10015073 3300025907 Bacteria 5149
247 Ga0207643_10000784 3300025908 Bacteria 19371
248 Ga0207684_10030202 3300025910 Unclassified 4614
249 Ga0207684_10032974 3300025910 Bacteria 4405
250 Ga0207684_10034050 3300025910 Bacteria 4330
251 Ga0207684_10092857 3300025910 Bacteria 2573
252 Ga0207654_10174859 3300025911 Bacteria 1397
253 Ga0207707_10000034 3300025912 Bacteria 152677
254 Ga0207707_10004013 3300025912 Bacteria 13065
255 Ga0207695_10380297 3300025913 Bacteria 1298
256 Ga0207660_10000344 3300025917 Bacteria 30093
257 Ga0207660_10074183 3300025917 Bacteria 2482
258 Ga0207660_10148612 3300025917 Unclassified 1798
259 Ga0207660_10184650 3300025917 Bacteria 1621
260 Ga0207657_10000066 3300025919 Bacteria 98663
261 Ga0207657_10065137 3300025919 Bacteria 3108
262 Ga0207657_10107206 3300025919 Bacteria 2311
263 Ga0207649_10177613 3300025920 Bacteria 1488
264 Ga0207652_10000245 3300025921 Bacteria 56703
265 Ga0207646_10003347 3300025922 Bacteria 18188
266 Ga0207646_10018546 3300025922 Bacteria 6488
267 Ga0207646_10145594 3300025922 Bacteria 2135
268 Ga0207646_10185117 3300025922 Unclassified 1881
269 Ga0207681_10001431 3300025923 Bacteria 15381
270 Ga0207681_10091477 3300025923 Unclassified 2173
271 Ga0207650_10003347 3300025925 Bacteria 11029
272 Ga0207650_10016383 3300025925 Bacteria 5181
273 Ga0207659_10068039 3300025926 Bacteria 2589
274 Ga0207687_10111292 3300025927 Bacteria 2032
275 Ga0207644_10097837 3300025931 Bacteria 2198
276 Ga0207690_10000899 3300025932 Bacteria 18978
277 Ga0207706_10005833 3300025933 Bacteria 11454
278 Ga0207706_10010703 3300025933 Bacteria 8378
279 Ga0207706_10053123 3300025933 Bacteria 3577
280 Ga0207706_10191524 3300025933 Bacteria 1795
281 Ga0207709_10023780 3300025935 Unclassified 3490
282 Ga0207709_10032638 3300025935 Bacteria 3051
283 Ga0207670_10047105 3300025936 Unclassified 2869
284 Ga0207704_10299358 3300025938 Bacteria 1231
285 Ga0207691_10020535 3300025940 Bacteria 6245
286 Ga0207691_10090105 3300025940 Bacteria 2750
287 Ga0207711_10013357 3300025941 Bacteria 6821
288 Ga0207711_10121773 3300025941 Unclassified 2329
289 Ga0207689_10000153 3300025942 Bacteria 59635
290 Ga0207689_10006552 3300025942 Bacteria 10272
291 Ga0207689_10007972 3300025942 Bacteria 9252
292 Ga0207661_10041471 3300025944 Bacteria 3624
293 Ga0207679_10003353 3300025945 Bacteria 9885
294 Ga0207679_10022789 3300025945 Bacteria 4270
295 Ga0207667_10001171 3300025949 Bacteria 32929
296 Ga0207712_10169270 3300025961 Bacteria 1706
297 Ga0207668_10002352 3300025972 Bacteria 11046
298 Ga0207668_10015309 3300025972 Bacteria 4762
299 Ga0207640_10055173 3300025981 Bacteria 2601
300 Ga0207658_10061182 3300025986 Bacteria 2813
301 Ga0207658_10162605 3300025986 Bacteria 1831
302 Ga0207677_10239559 3300026023 Bacteria 1467
303 Ga0207703_10000937 3300026035 Bacteria 28276
304 Ga0207703_10065889 3300026035 Bacteria 2978
305 Ga0207703_10139378 3300026035 Bacteria 2103
306 Ga0207639_10013033 3300026041 Bacteria 5804
307 Ga0207678_10065459 3300026067 Bacteria 3121
308 Ga0207702_10000483 3300026078 Bacteria 44845
309 Ga0207702_10202879 3300026078 Bacteria 1839
310 Ga0207641_10004844 3300026088 Bacteria 11591
311 Ga0207648_10000169 3300026089 Bacteria 67635
312 Ga0207648_10001948 3300026089 Bacteria 22560
313 Ga0207648_10077350 3300026089 Bacteria 2900
314 Ga0207676_10066085 3300026095 Bacteria 2882
315 Ga0207676_10268095 3300026095 Unclassified 1545
316 Ga0207674_10000050 3300026116 Bacteria 116782
317 Ga0207674_10006815 3300026116 Bacteria 13399
318 Ga0207674_10149876 3300026116 Unclassified 2290
319 Ga0207675_100005532 3300026118 Bacteria 12081
320 Ga0207675_100021758 3300026118 Bacteria 5969
321 Ga0207698_10057686 3300026142 Bacteria 3005
322 Ga0210000_1014185 3300027462 Bacteria 1193
323 Ga0209999_1006413 3300027543 Bacteria 2113
324 Ga0207428_10000409 3300027907 Bacteria 53318
325 Ga0207428_10006400 3300027907 Bacteria 10881
326 Ga0207428_10047859 3300027907 Bacteria 3433
327 Ga0207428_10056320 3300027907 Bacteria 3124
328 Ga0268265_10009181 3300028380 Bacteria 6682
329 Ga0268265_10018045 3300028380 Bacteria 4885
330 Ga0268265_10193058 3300028380 Bacteria 1760
331 Ga0268264_10004346 3300028381 Bacteria 12099
332 Ga0268264_10018232 3300028381 Bacteria 5741
333 Ga0268264_10041788 3300028381 Bacteria 3793
334 Ga0265327_10008448 3300031251 Bacteria 7662
335 Ga0307408_100168452 3300031548 Bacteria 1747
336 Ga0307408_100185308 3300031548 Unclassified 1673
337 Ga0307416_100064645 3300032002 Bacteria 3002
338 Ga0373926_0005085 3300035083 Bacteria 4317
339 Ga0373936_0045155 3300035113 Bacteria 1774
340 Ga0373945_0005305 3300035116 Unclassified 4125
341 Ga0373956_0024817 3300035119 Bacteria 2587
342 Ga0373943_0038475 3300035170 Bacteria 2300
343 Ga0373943_0061983 3300035170 Bacteria 1871
344 Ga0373955_0069406 3300035172 Bacteria 1966
345 Ga0373927_0047238 3300035695 Bacteria 2785
346 Ga0373947_0018079 3300035725 Bacteria 4056
347 Ga0373937_0085153 3300036401 Bacteria 2925
348 Ga0395899_0105734 3300037312 Bacteria 2027
349 Ga0395900_0007363 3300037418 Bacteria 11377
350 Ga0395900_0012292 3300037418 Bacteria 8757
351 Ga0395900_0063785 3300037418 Bacteria 3787
352 Ga0395898_0171900 3300037466 Bacteria 2071
353 Ga0395905_0091806 3300037471 Bacteria 2847
354 Ga0395901_0020048 3300038443 Bacteria 6842
355 Ga0395901_0059567 3300038443 Bacteria 3972
356 Ga0439441_001096 3300042001 Bacteria 3381
357 Ga0439448_0001521 3300042005 Bacteria 6047
358 Ga0439450_005665 3300042008 Unclassified 2209
359 Ga0439458_0003630 3300042157 Bacteria 3590
360 Ga0439435_0011814 3300042436 Bacteria 2101
361 Ga0439444_0000463 3300042437 Bacteria 4527
362 Ga0439464_0016747 3300042439 Unclassified 1984
363 Ga0439460_0003415 3300042461 Bacteria 3837
364 Ga0439460_0041315 3300042461 Bacteria 1354
365 Ga0451577_0010913 3300042876 Bacteria 8632
366 Ga0451577_0062175 3300042876 Bacteria 3330
367 Ga0451577_0097915 3300042876 Unclassified 2620
368 Ga0451577_0147819 3300042876 Bacteria 2113
369 Ga0451577_0156454 3300042876 Unclassified 2052
370 Ga0439440_0021954 3300042993 Unclassified 1443
371 Ga0453683_0015542 3300044673 Bacteria 4927
372 Ga0453683_0056655 3300044673 Bacteria 2453
373 Ga0453683_0067428 3300044673 Unclassified 2237
374 Ga0453683_0070160 3300044673 Bacteria 2191
375 Ga0453684_0124492 3300044712 Bacteria 3105
376 Ga0453684_0221342 3300044712 Bacteria 2192
377 Ga0453684_0402421 3300044712 Bacteria 1533
378 Ga0451576_0004001 3300045051 Bacteria 19619
379 Ga0451576_0026135 3300045051 Bacteria 6280
380 Ga0451576_0029934 3300045051 Bacteria 5824
381 Ga0451576_0080688 3300045051 Bacteria 3384
382 Ga0451576_0282849 3300045051 Bacteria 1734
383 Ga0451576_0384203 3300045051 Unclassified 1472
384 Ga0495603_0134501 3300046455 Unclassified 1439
385 Ga0495629_0009422 3300046459 Bacteria 7141
386 Ga0495580_0176988 3300046472 Unclassified 1474
387 Ga0495664_0023539 3300046477 Bacteria 3575
388 Ga0495664_0180825 3300046477 Bacteria 1279
389 Ga0495618_0071671 3300046514 Bacteria 2204
390 Ga0495628_0071938 3300046516 Bacteria 2695
391 Ga0495666_0052611 3300046526 Bacteria 1955
392 Ga0495640_0018869 3300046533 Bacteria 5103
393 Ga0495621_0020141 3300046539 Bacteria 2186
394 Ga0495645_0068826 3300046543 Bacteria 2555
395 Ga0495634_0175453 3300046642 Bacteria 1345
396 Ga0495635_0058343 3300046663 Bacteria 2655
397 Ga0495613_0032281 3300046689 Bacteria 3889
398 Ga0495636_0043432 3300047318 Unclassified 1870
399 Ga0495674_0007691 3300047319 Bacteria 10295
400 Ga0495684_0012806 3300047471 Bacteria 6472
401 Ga0495593_0087594 3300047673 Bacteria 1605
402 Ga0495614_0104468 3300048089 Bacteria 1241
403 Ga0496105_0148178 3300048908 Unclassified 1930
404 Ga0496106_0180081 3300048909 Bacteria 1678
405 Ga0501033_0029526 3300049570 Unclassified 4120
406 Ga0501038_0009381 3300049574 Bacteria 8977
407 Ga0501038_0220308 3300049574 Bacteria 1514
408 Ga0501039_0155835 3300049575 Bacteria 1794
409 Ga0501040_0009367 3300049576 Bacteria 6381
410 Ga0501040_0042683 3300049576 Bacteria 3090
411 Ga0501042_0117337 3300049578 Bacteria 1916
412 Ga0501042_0122992 3300049578 Bacteria 1868
413 Ga0501048_0016923 3300049582 Bacteria 5375
414 Ga0501068_0115263 3300049584 Bacteria 1673
415 Ga0501071_0016504 3300049587 Bacteria 5079
416 Ga0501071_0084638 3300049587 Bacteria 2325
417 Ga0501071_0160404 3300049587 Bacteria 1680
418 Ga0501072_0011624 3300049588 Bacteria 6726
419 Ga0501072_0068016 3300049588 Bacteria 2811
420 Ga0501072_0158038 3300049588 Bacteria 1808
421 Ga0501074_0292559 3300049590 Bacteria 1157
422 Ga0501075_0004205 3300049591 Bacteria 9723
423 Ga0501075_0040453 3300049591 Bacteria 3491
424 Ga0501076_0005262 3300049592 Bacteria 9279
425 Ga0501076_0167953 3300049592 Bacteria 1788
426 Ga0501076_0384510 3300049592 Unclassified 1153
427 Ga0501079_0024521 3300049741 Bacteria 4629
428 Ga0501079_0175459 3300049741 Bacteria 1671
429 Ga0501079_0416636 3300049741 Unclassified 1054
430 Ga0501081_0063707 3300049743 Bacteria 2559
431 Ga0501081_0113348 3300049743 Unclassified 1925
432 Ga0501035_0216742 3300049822 Bacteria 1636
433 Ga0501045_0150322 3300049824 Bacteria 1732
434 nmdc:mga05p37_153742_c1 3300050507 Bacteria 2813
435 nmdc:mga05p37_175626_c1 3300050507 Bacteria 2610
436 nmdc:mga05p37_198034_c1 3300050507 Bacteria 2435
437 nmdc:mga05p37_21121_c1 3300050507 Bacteria 7881
438 nmdc:mga05p37_241974_c1 3300050507 Bacteria 2169
439 nmdc:mga05p37_32940_c1 3300050507 Bacteria 6344
440 nmdc:mga05p37_4626_c1 3300050507 Bacteria 16088
441 nmdc:mga05p37_489919_c1 3300050507 Bacteria 1414
442 nmdc:mga05p37_74223_c2 3300050507 Bacteria 2586
443 nmdc:mga05p37_78600_c1 3300050507 Bacteria 4063
444 nmdc:mga09592_134611_c1 3300050508 Bacteria 2128
445 nmdc:mga09592_13670_c1 3300050508 Bacteria 6634
446 nmdc:mga09592_233182_c1 3300050508 Bacteria 1595
447 nmdc:mga09592_284886_c1 3300050508 Bacteria 1433
448 nmdc:mga09592_387553_c1 3300050508 Bacteria 1208
449 nmdc:mga09592_47502_c1 3300050508 Bacteria 3618
450 nmdc:mga09592_48533_c1 3300050508 Bacteria 3579
451 nmdc:mga09592_78288_c1 3300050508 Bacteria 2814
452 nmdc:mga0qj67_116516_c1 3300050509 Bacteria 2159
453 nmdc:mga0qj67_118_c1 3300050509 Bacteria 52561
454 nmdc:mga0qj67_46405_c1 3300050509 Bacteria 3430
455 nmdc:mga06r32_15316_c1 3300050510 Bacteria 6966
456 nmdc:mga06r32_273309_c1 3300050510 Bacteria 1677
457 nmdc:mga06r32_331075_c1 3300050510 Unclassified 1508
458 nmdc:mga06r32_382206_c1 3300050510 Bacteria 1391
459 nmdc:mga06r32_485_c1 3300050510 Bacteria 34276
460 nmdc:mga06r32_61552_c1 3300050510 Bacteria 3614
461 nmdc:mga06r32_62181_c1 3300050510 Bacteria 3597
462 nmdc:mga06r32_63651_c1 3300050510 Bacteria 3556
463 nmdc:mga06r32_784_c1 3300050510 Bacteria 28098
464 nmdc:mga06r32_92763_c1 3300050510 Bacteria 2953
465 nmdc:mga06r32_9659_c1 3300050510 Bacteria 8714
466 nmdc:mga08y16_110845_c1 3300050511 Unclassified 2857
467 nmdc:mga08y16_194561_c1 3300050511 Bacteria 2102
468 nmdc:mga08y16_206561_c1 3300050511 Bacteria 2035
469 nmdc:mga08y16_437575_c1 3300050511 Bacteria 1335
470 nmdc:mga08y16_56376_c1 3300050511 Bacteria 4107
471 nmdc:mga08y16_681557_c1 3300050511 Bacteria 1029
472 nmdc:mga0n895_155877_c1 3300050512 Bacteria 2314
473 nmdc:mga0n895_458572_c1 3300050512 Bacteria 1286
474 nmdc:mga0n895_61452_c1 3300050512 Bacteria 3709
475 nmdc:mga0rr50_208310_c1 3300050513 Bacteria 1610
476 nmdc:mga0a205_25095_c1 3300050515 Bacteria 5676
477 nmdc:mga0a205_35245_c1 3300050515 Bacteria 4805
478 nmdc:mga0a205_4047_c1 3300050515 Bacteria 8059
479 nmdc:mga0a205_7218_c1 3300050515 Bacteria 10045
480 Ga0495601_0001723 3300053077 Bacteria 12089
481 Ga0495612_0000743 3300053078 Bacteria 13256
482 Ga0495619_0001642 3300053085 Bacteria 14741
483 Ga0501084_0052274 3300054114 Bacteria 3419
484 Ga0501084_0393230 3300054114 Bacteria 1171
485 Ga0501082_0071296 3300060353 Bacteria 2992
486 Ga0501082_0087275 3300060353 Bacteria 2691
487 Ga0530510_0009816 3300061734 Bacteria 6718
488 Ga0530510_0073278 3300061734 Bacteria 2485
489 Ga0111539_10165876
490 Ga0065715_10001135
491 Ga0065707_10005106
492 Ga0065707_10022148
493 Ga0065707_10142773
494 Ga0070676_10000476
495 Ga0070676_10015896
496 Ga0070683_100057262
497 Ga0070690_100002974
498 Ga0070690_100029956
499 Ga0070690_100118986
500 Ga0070670_100000766
501 Ga0070670_100027105
502 Ga0070670_100134497
503 Ga0070670_100212714
504 Ga0068869_100000321
505 Ga0068869_100009092
506 Ga0070666_10001388
507 Ga0070666_10025934
508 Ga0070666_10124633
509 Ga0070680_100000065
510 Ga0070680_100069081
511 Ga0070680_100209790
512 Ga0070682_100001260
513 Ga0068868_100231129
514 Ga0070660_100001579
515 Ga0070660_100018902
516 Ga0070689_100226820
517 Ga0070691_10008482
518 Ga0070687_100000403
519 Ga0070661_100022031
520 Ga0070661_100029269
521 Ga0070668_100000682
522 Ga0070669_100001716
523 Ga0070669_100005653
524 Ga0070675_100031834
525 Ga0070671_100042211
526 Ga0070671_100080794
527 Ga0070671_100385774
528 Ga0070674_100004651
529 Ga0070674_100031368
530 Ga0070673_100036336
531 Ga0070659_100000328
532 Ga0070659_100075351
533 Ga0070667_100003490
534 Ga0070667_100015974
535 Ga0070703_10016430
536 Ga0070705_100000722
537 Ga0070705_100031266
538 Ga0070705_100046316
539 Ga0070705_100052275
540 Ga0070705_100099393
541 Ga0070705_100118007
542 Ga0070705_100215637
543 Ga0070694_100000769
544 Ga0070694_100010109
545 Ga0070694_100018373
546 Ga0070694_100073113
547 Ga0070694_100122960
548 Ga0070708_100070142
549 Ga0070708_100086294
550 Ga0070708_100212137
551 Ga0070662_100001421
552 Ga0070662_100036873
553 Ga0070681_10000731
554 Ga0070681_10002977
555 Ga0068867_100000496
556 Ga0068867_100002193
557 Ga0068867_100069503
558 Ga0070706_100016270
559 Ga0070706_100161762
560 Ga0070706_100200148
561 Ga0070707_100085327
562 Ga0070707_100129093
563 Ga0070698_100060615
564 Ga0070698_100104926
565 Ga0070698_100205734
566 Ga0070698_100356929
567 Ga0070699_100013165
568 Ga0070699_100038848
569 Ga0070699_100041465
570 Ga0070699_100049343
571 Ga0070679_100021689
572 Ga0070684_100048064
573 Ga0070684_100164622
574 Ga0068853_100017608
575 Ga0070672_100001295
576 Ga0070672_100059295
577 Ga0070672_100119379
578 Ga0070686_100056968
579 Ga0070695_100000608
580 Ga0070695_100021949
581 Ga0070695_100073576
582 Ga0070696_100000452
583 Ga0070696_100054481
584 Ga0070696_100059794
585 Ga0070696_100129415
586 Ga0070696_100178774
587 Ga0070696_100286150
588 Ga0070693_100000433
589 Ga0070665_100315688
590 Ga0070704_100001704
591 Ga0070704_100003315
592 Ga0070704_100007261
593 Ga0070704_100026966
594 Ga0070704_100031283
595 Ga0070704_100141209
596 Ga0068855_100000362
597 Ga0070664_100006255
598 Ga0068857_100033515
599 Ga0068857_100110729
600 Ga0068854_100000727
601 Ga0068856_100001467
602 Ga0068852_100025895
603 Ga0068852_100109464
604 Ga0068859_100000348
605 Ga0068859_100020830
606 Ga0068859_100089493
607 Ga0068864_100039186
608 Ga0068864_100066089
609 Ga0068864_100126627
610 Ga0068864_100402255
611 Ga0068866_10046693
612 Ga0068861_100004066
613 Ga0068861_100049253
614 Ga0068870_10000738
615 Ga0068863_100011042
616 Ga0068858_100003840
617 Ga0068858_100105946
618 Ga0068858_100452346
619 Ga0068860_100001826
620 Ga0068860_100017708
621 Ga0068860_100029508
622 Ga0068862_100001689
623 Ga0068862_100008484
624 Ga0068862_100014789
625 Ga0068862_100041851
626 Ga0097621_100349879
627 Ga0068871_100111243
628 Ga0075428_100000123
629 Ga0075428_100022854
630 Ga0075428_100026177
631 Ga0075428_100040265
632 Ga0075428_100085075
633 Ga0075428_100177125
634 Ga0075428_100228006
635 Ga0075428_100260320
636 Ga0075428_100316134
637 Ga0075428_100344678
638 Ga0075428_100492666
639 Ga0075430_100056653
640 Ga0075430_100156537
641 Ga0075430_100165493
642 Ga0075430_100217903
643 Ga0075430_100242332
644 Ga0075430_100260443
645 Ga0075430_100272625
646 Ga0075430_100303590
647 Ga0075431_100000773
648 Ga0075431_100004664
649 Ga0075431_100009686
650 Ga0075431_100039875
651 Ga0075431_100070746
652 Ga0075431_100108033
653 Ga0075431_100156649
654 Ga0075431_100252908
655 Ga0075431_100310116
656 Ga0075431_100311751
657 Ga0075431_100356535
658 Ga0075433_10007677
659 Ga0075433_10014415
660 Ga0075433_10022985
661 Ga0075433_10224535
662 Ga0075434_100248426
663 Ga0075434_100317161
664 Ga0075434_100644662
665 Ga0075429_100007421
666 Ga0075429_100017070
667 Ga0075429_100023570
668 Ga0075429_100115871
669 Ga0075429_100195307
670 Ga0075429_100239192
671 Ga0075429_100319006
672 Ga0068865_100000599
673 Ga0068865_100049950
674 Ga0097620_100000348
675 Ga0097620_100020830
676 Ga0097620_100089494
677 Ga0075435_100032310
678 Ga0075435_100120091
679 Ga0075435_100182868
680 Ga0111539_10000370
681 Ga0111539_10033321
682 Ga0111539_10092899
683 Ga0111539_10179803
684 Ga0111539_10190486
685 Ga0111539_10261499
686 Ga0111539_10460155
687 Ga0105245_10114952
688 Ga0114129_10006726
689 Ga0114129_10080517
690 Ga0114129_10099669
691 Ga0114129_10117668
692 Ga0114129_10206245
693 Ga0114129_10218656
694 Ga0114129_10422252
695 Ga0114129_10589793
696 Ga0114129_10762799
697 Ga0105243_10002376
698 Ga0105243_10068706
699 Ga0105243_10249797
700 Ga0105241_10001012
701 Ga0105241_10016373
702 Ga0105241_10064764
703 Ga0105242_10003692
704 Ga0105242_10137919
705 Ga0105248_10009844
706 Ga0105248_10083636
707 Ga0105237_10181724
708 Ga0105249_10008572
709 Ga0105249_10060781
710 Ga0105249_10125648
711 Ga0105239_10055074
712 Ga0105246_10015557
713 Ga0157373_10000347
714 Ga0157371_10110270
715 Ga0157369_10004346
716 Ga0157374_10012109
717 Ga0157378_10212800
718 Ga0163162_10064610
719 Ga0163162_10424887
720 Ga0163162_10516288
721 Ga0157372_10000280
722 Ga0157372_10330321
723 Ga0157372_10369177
724 Ga0157375_10155228
725 Ga0157375_10302197
726 Ga0157380_10601508
727 Ga0157379_10002864
728 Ga0157379_10503456
729 Ga0163161_10000551
730 Ga0207688_10058911
731 Ga0207680_10294229
732 Ga0207645_10002393
733 Ga0207645_10004272
734 Ga0207645_10015073
735 Ga0207643_10000784
736 Ga0207684_10030202
737 Ga0207684_10032974
738 Ga0207684_10034050
739 Ga0207684_10092857
740 Ga0207654_10174859
741 Ga0207707_10000034
742 Ga0207707_10004013
743 Ga0207695_10380297
744 Ga0207660_10000344
745 Ga0207660_10074183
746 Ga0207660_10148612
747 Ga0207660_10184650
748 Ga0207657_10000066
749 Ga0207657_10065137
750 Ga0207657_10107206
751 Ga0207649_10177613
752 Ga0207652_10000245
753 Ga0207646_10003347
754 Ga0207646_10018546
755 Ga0207646_10145594
756 Ga0207646_10185117
757 Ga0207681_10001431
758 Ga0207681_10091477
759 Ga0207650_10003347
760 Ga0207650_10016383
761 Ga0207659_10068039
762 Ga0207687_10111292
763 Ga0207644_10097837
764 Ga0207690_10000899
765 Ga0207706_10005833
766 Ga0207706_10010703
767 Ga0207706_10053123
768 Ga0207706_10191524
769 Ga0207709_10023780
770 Ga0207709_10032638
771 Ga0207670_10047105
772 Ga0207704_10299358
773 Ga0207691_10020535
774 Ga0207691_10090105
775 Ga0207711_10013357
776 Ga0207711_10121773
777 Ga0207689_10000153
778 Ga0207689_10006552
779 Ga0207689_10007972
780 Ga0207661_10041471
781 Ga0207679_10003353
782 Ga0207679_10022789
783 Ga0207667_10001171
784 Ga0207712_10169270
785 Ga0207668_10002352
786 Ga0207668_10015309
787 Ga0207640_10055173
788 Ga0207658_10061182
789 Ga0207658_10162605
790 Ga0207677_10239559
791 Ga0207703_10000937
792 Ga0207703_10065889
793 Ga0207703_10139378
794 Ga0207639_10013033
795 Ga0207678_10065459
796 Ga0207702_10000483
797 Ga0207702_10202879
798 Ga0207641_10004844
799 Ga0207648_10000169
800 Ga0207648_10001948
801 Ga0207648_10077350
802 Ga0207676_10066085
803 Ga0207676_10268095
804 Ga0207674_10000050
805 Ga0207674_10006815
806 Ga0207674_10149876
807 Ga0207675_100005532
808 Ga0207675_100021758
809 Ga0207698_10057686
810 Ga0210000_1014185
811 Ga0209999_1006413
812 Ga0207428_10000409
813 Ga0207428_10006400
814 Ga0207428_10047859
815 Ga0207428_10056320
816 Ga0268265_10009181
817 Ga0268265_10018045
818 Ga0268265_10193058
819 Ga0268264_10004346
820 Ga0268264_10018232
821 Ga0268264_10041788
822 Ga0265327_10008448
823 Ga0307408_100168452
824 Ga0307408_100185308
825 Ga0307416_100064645
826 Ga0373926_0005085
827 Ga0373936_0045155
828 Ga0373945_0005305
829 Ga0373956_0024817
830 Ga0373943_0038475
831 Ga0373943_0061983
832 Ga0373955_0069406
833 Ga0373927_0047238
834 Ga0373947_0018079
835 Ga0373937_0085153
836 Ga0395899_0105734
837 Ga0395900_0007363
838 Ga0395900_0012292
839 Ga0395900_0063785
840 Ga0395898_0171900
841 Ga0395905_0091806
842 Ga0395901_0020048
843 Ga0395901_0059567
844 Ga0439441_001096
845 Ga0439448_0001521
846 Ga0439450_005665
847 Ga0439458_0003630
848 Ga0439435_0011814
849 Ga0439444_0000463
850 Ga0439464_0016747
851 Ga0439460_0003415
852 Ga0439460_0041315
853 Ga0451577_0010913
854 Ga0451577_0062175
855 Ga0451577_0097915
856 Ga0451577_0147819
857 Ga0451577_0156454
858 Ga0439440_0021954
859 Ga0453683_0015542
860 Ga0453683_0056655
861 Ga0453683_0067428
862 Ga0453683_0070160
863 Ga0453684_0124492
864 Ga0453684_0221342
865 Ga0453684_0402421
866 Ga0451576_0004001
867 Ga0451576_0026135
868 Ga0451576_0029934
869 Ga0451576_0080688
870 Ga0451576_0282849
871 Ga0451576_0384203
872 Ga0495603_0134501
873 Ga0495629_0009422
874 Ga0495580_0176988
875 Ga0495664_0023539
876 Ga0495664_0180825
877 Ga0495618_0071671
878 Ga0495628_0071938
879 Ga0495666_0052611
880 Ga0495640_0018869
881 Ga0495621_0020141
882 Ga0495645_0068826
883 Ga0495634_0175453
884 Ga0495635_0058343
885 Ga0495613_0032281
886 Ga0495636_0043432
887 Ga0495674_0007691
888 Ga0495684_0012806
889 Ga0495593_0087594
890 Ga0495614_0104468
891 Ga0496105_0148178
892 Ga0496106_0180081
893 Ga0501033_0029526
894 Ga0501038_0009381
895 Ga0501038_0220308
896 Ga0501039_0155835
897 Ga0501040_0009367
898 Ga0501040_0042683
899 Ga0501042_0117337
900 Ga0501042_0122992
901 Ga0501048_0016923
902 Ga0501068_0115263
903 Ga0501071_0016504
904 Ga0501071_0084638
905 Ga0501071_0160404
906 Ga0501072_0011624
907 Ga0501072_0068016
908 Ga0501072_0158038
909 Ga0501074_0292559
910 Ga0501075_0004205
911 Ga0501075_0040453
912 Ga0501076_0005262
913 Ga0501076_0167953
914 Ga0501076_0384510
915 Ga0501079_0024521
916 Ga0501079_0175459
917 Ga0501079_0416636
918 Ga0501081_0063707
919 Ga0501081_0113348
920 Ga0501035_0216742
921 Ga0501045_0150322
922 nmdc:mga05p37_153742_c1
923 nmdc:mga05p37_175626_c1
924 nmdc:mga05p37_198034_c1
925 nmdc:mga05p37_21121_c1
926 nmdc:mga05p37_241974_c1
927 nmdc:mga05p37_32940_c1
928 nmdc:mga05p37_4626_c1
929 nmdc:mga05p37_489919_c1
930 nmdc:mga05p37_74223_c2
931 nmdc:mga05p37_78600_c1
932 nmdc:mga09592_134611_c1
933 nmdc:mga09592_13670_c1
934 nmdc:mga09592_233182_c1
935 nmdc:mga09592_284886_c1
936 nmdc:mga09592_387553_c1
937 nmdc:mga09592_47502_c1
938 nmdc:mga09592_48533_c1
939 nmdc:mga09592_78288_c1
940 nmdc:mga0qj67_116516_c1
941 nmdc:mga0qj67_118_c1
942 nmdc:mga0qj67_46405_c1
943 nmdc:mga06r32_15316_c1
944 nmdc:mga06r32_273309_c1
945 nmdc:mga06r32_331075_c1
946 nmdc:mga06r32_382206_c1
947 nmdc:mga06r32_485_c1
948 nmdc:mga06r32_61552_c1
949 nmdc:mga06r32_62181_c1
950 nmdc:mga06r32_63651_c1
951 nmdc:mga06r32_784_c1
952 nmdc:mga06r32_92763_c1
953 nmdc:mga06r32_9659_c1
954 nmdc:mga08y16_110845_c1
955 nmdc:mga08y16_194561_c1
956 nmdc:mga08y16_206561_c1
957 nmdc:mga08y16_437575_c1
958 nmdc:mga08y16_56376_c1
959 nmdc:mga08y16_681557_c1
960 nmdc:mga0n895_155877_c1
961 nmdc:mga0n895_458572_c1
962 nmdc:mga0n895_61452_c1
963 nmdc:mga0rr50_208310_c1
964 nmdc:mga0a205_25095_c1
965 nmdc:mga0a205_35245_c1
966 nmdc:mga0a205_4047_c1
967 nmdc:mga0a205_7218_c1
968 Ga0495601_0001723
969 Ga0495612_0000743
970 Ga0495619_0001642
971 Ga0501084_0052274
972 Ga0501084_0393230
973 Ga0501082_0071296
974 Ga0501082_0087275
975 Ga0530510_0009816
976 Ga0530510_0073278

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04392

ABC_sub_bind

ABC transporter substrate binding protein

85

373

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
6k1x-assembly1.cif.gz_A crystal structure of rhodothermus marinus substrate-binding protein at ph 6.0 0.8343 186 363
3lft-assembly1.cif.gz_A the crystal structure of the abc domain in complex with l-trp from streptococcus pneumonia to 1.35a 0.8295 68 362
6k1w-assembly1.cif.gz_A crystal structure of rhodothermus marinus substrate-binding protein at ph 5.5 0.8266 186 354
3lft-assembly1.cif.gz_A the crystal structure of the abc domain in complex with l-trp from streptococcus pneumonia to 1.35a 0.822 68 362
3lkv-assembly1.cif.gz_A-2 crystal structure of conserved domain protein from vibrio cholerae o1 biovar eltor str. n16961 0.8136 66 361
ID Description Score Start End Superfamily
3lkvA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8847 185 361 3.40.50.2300
3lkvA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8767 66 333 3.40.50.2300
3lftA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8749 185 362 3.40.50.2300
3lkvA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8711 66 333 3.40.50.2300
3lkvA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8621 185 361 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A7Y0XAS6-F1-model_v4 ABC transporter substrate-binding protein 0.9282 104 191
AF-A0A2V7CXZ3-F1-model_v4 ABC transporter substrate-binding protein 0.9253 183 363
AF-A0A4V1KUC4-F1-model_v4 ABC transporter substrate-binding protein 0.9233 255 363
AF-A0A2V7CM33-F1-model_v4 ABC transporter substrate-binding protein 0.9207 66 363
AF-A0A537H7S6-F1-model_v4 ABC transporter substrate-binding protein 0.9201 249 363

Map