F453602

General Info

Members Datasets Scaffolds Average Seq Length
488 297 976 318

Family's Representative Sequence

Representative Sequence 3300009979|Ga0105032_100446|Ga0105032_1004462
Length 358
Sequence MRSDPLLRFRGNDSQSKNSGASSALQSEGSRTDGNSAMNAIPADPNDLAIRARGLSKAFGQLKAVKDVDLSVPKACVYGFLGPNGSGKSTTIRMLCGLLTPTAGEIEVLGLKIPEQAEALRRRIGYMTQKFSLFEDLTVRENLEFLAAVQDIPKKDANERIDELVQQYHFEDRQKQLAGTMSGGQKQRLALAGAVIQKPELLFLDEPTSAVDPESRRDFWEKLFDLADAGTTILVSTHYMDEAERCHRIAILDLGVLVADGTPQELTDALKGRTVLVDAAEPRRAQKALVDVPGVLSVAQIGNSLRVLTDRNGDAAERIRGVLQEAGLRAEVGASEPNLEDVFVSATGGGTDDTREAA

Samples

Sample ID Description Type Environment
1 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
5 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
6 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
7 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
8 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
9 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
10 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
11 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
12 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
13 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
14 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
15 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
16 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
17 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
18 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
19 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
20 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
21 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
22 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
23 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
24 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
25 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
26 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
27 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
28 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
29 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
32 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
33 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
48 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
49 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
52 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
53 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
54 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
57 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
58 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
59 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
60 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
61 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
66 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
67 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
68 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
69 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
70 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
71 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
72 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
73 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
74 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
75 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
79 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
80 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
82 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
83 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
84 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
86 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
87 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
88 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
90 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
91 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
92 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
94 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
95 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
96 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
98 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
133 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
136 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
137 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
138 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
139 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
140 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
141 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
142 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
143 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
144 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
145 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
146 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
147 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
148 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
149 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
150 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
151 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
152 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
153 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
154 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
155 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
156 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
157 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
158 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
159 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
160 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
161 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
162 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
163 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
164 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
165 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
166 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
167 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
168 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
169 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
170 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
171 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
172 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
173 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
174 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
175 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
176 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
177 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
178 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
179 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
180 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
181 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
182 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
183 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
184 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
185 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
186 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
187 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
188 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
189 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
190 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
191 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
192 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
193 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
194 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
195 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
196 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
197 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
198 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
199 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
200 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
201 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
202 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
203 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
204 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
205 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
206 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
207 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
208 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
209 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
210 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
211 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
212 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
213 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
214 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
215 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
216 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
217 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
218 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
219 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
220 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
236 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
237 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
238 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
239 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
240 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
241 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
242 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
243 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
244 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
245 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
246 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
247 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
249 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
250 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
251 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
252 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
253 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
254 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
255 2524614729 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
256 2547132130 Stenotrophomonas maltophilia RR-10 Isolate Unclassified
257 2571042365 Lysobacter oryzae DSM 21044 Isolate Rhizosphere
258 2576861471 Stenotrophomonas rhizophila DSM 14405 Isolate Rhizosphere
259 2627854209 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
260 2643221559 Lysobacter sp. Root559 Isolate Unclassified
261 2643221562 Rhodanobacter sp. Root561 Isolate Unclassified
262 2643221573 Lysobacter sp. Root604 Isolate Unclassified
263 2643221579 Pseudoxanthomonas sp. Root630 Isolate Unclassified
264 2643221581 Pseudoxanthomonas sp. Root65 Isolate Unclassified
265 2643221586 Lysobacter sp. Root667 Isolate Unclassified
266 2643221612 Lysobacter sp. Root76 Isolate Unclassified
267 2643221695 Lysobacter sp. Root494 Isolate Unclassified
268 2643221720 Lysobacter sp. Root916 Isolate Unclassified
269 2643221727 Lysobacter sp. Root96 Isolate Unclassified
270 2643221728 Lysobacter sp. Root983 Isolate Unclassified
271 2739367700 Dyella sp. YR388 Isolate Unclassified
272 2816332141 Stenotrophomonas muris 1190 (v2) (version 2) Isolate Unclassified
273 2842391507 Stenotrophomonas maltophilia SEMIA 4027 Isolate Nodule
274 2857442823 Stenotrophomonas sp. R-74235 Isolate Unclassified
275 2874220319 Stenotrophomonas maltophilia PS5 Isolate Unclassified
276 2895395659 Rhodanobacter sp. T12-5 Isolate Unclassified
277 2895525241 Pseudoxanthomonas sp. SGT-18 Isolate Rhizosphere
278 2919089067 Stenotrophomonas sp. 1337 Isolate Rhizosphere
279 2919134579 Stenotrophomonas geniculata 1733 Isolate Rhizosphere
280 2923516293 Pseudoxanthomonas mexicana SLBN-89 Isolate Rhizosphere
281 2928496128 Stenotrophomonas indicatrix 1163 Isolate Unclassified
282 2928963466 Dyella japonica 1073 Isolate Unclassified
283 2931380184 Stenotrophomonas sp. DR822 Isolate Rhizosphere
284 2937610967 Stenotrophomonas maltophilia EP20 Isolate Unclassified
285 2939589442 Stenotrophomonas rhizophila 716 Isolate Rhizosphere
286 2939611941 Rhodanobacter soli 1757 Isolate Rhizosphere
287 2939622612 Stenotrophomonas sp. 2619 Isolate Rhizosphere
288 2939626828 Stenotrophomonas sp. 2694 Isolate Rhizosphere
289 2941489479 Lysobacter enzymogenes 2943 Isolate Rhizosphere
290 2961047084 Stenotrophomonas maltophilia EP5 Isolate Unclassified
291 2961064222 Stenotrophomonas maltophilia EP13 Isolate Unclassified
292 2974307012 Stenotrophomonas sp. SORGH_AS_0282 Isolate Unclassified
293 2977247770 Stenotrophomonas rhizophila SORGH_AS 457 Isolate Unclassified
294 2984514374 Stenotrophomonas sp. SORGH_AS282 Isolate Aerial Root
295 2987605356 Stenotrophomonas sp. ATCM1_4 Isolate Unclassified
296 8002869464 Pseudoxanthomonas helianthi 110414 Isolate Unclassified
297 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.19
Metatranscriptomes 0
Isolates 8.81

Biome Distribution

Category Percentage (%)
Aerial Root 0.2
Bulb 0
Endosphere 19.26
Nodule 0.2
Rhizoplane 3.48
Rhizosphere 61.68
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105032_100446 3300009979 Bacteria 4129
2 SwRhRL2b_contig_1905644 2162886007 Bacteria 2299
3 JGI24735J21928_10000216 3300002067 Bacteria 20223
4 JGI25156J39149_1007651 3300002705 Bacteria 2809
5 JGI25162J39368_1000068 3300002737 Bacteria 129594
6 JGI25157J39369_1000333 3300002741 Bacteria 33433
7 JGI25157J39369_1001030 3300002741 Bacteria 12827
8 JGI25163J39215_1000714 3300002771 Bacteria 8627
9 JGI25164J39214_1000216 3300002772 Bacteria 47222
10 JGI25165J46597_1000058 3300003214 Bacteria 212833
11 Ga0055538_1000501 3300003751 Bacteria 14083
12 Ga0055535_1000034 3300003761 Bacteria 181954
13 Ga0055542_1000081 3300003762 Bacteria 129595
14 Ga0055542_1000112 3300003762 Bacteria 107429
15 Ga0055529_1000083 3300003763 Bacteria 146729
16 Ga0055526_1000008 3300003771 Bacteria 300059
17 Ga0055526_1001472 3300003771 Bacteria 16701
18 Ga0055526_1004394 3300003771 Bacteria 8488
19 Ga0055537_1000343 3300003773 Bacteria 31889
20 Ga0055537_1000713 3300003773 Bacteria 17195
21 Ga0055524_1001290 3300003775 Bacteria 14699
22 Ga0055536_1003090 3300003781 Bacteria 9068
23 Ga0055536_1006496 3300003781 Bacteria 5437
24 Ga0055536_1010079 3300003781 Bacteria 3804
25 Ga0055534_1000003 3300003784 Bacteria 300063
26 Ga0055534_1000717 3300003784 Bacteria 16215
27 Ga0055528_1000019 3300003790 Bacteria 149715
28 Ga0055528_1003920 3300003790 Bacteria 7308
29 Ga0055530_10002049 3300003791 Bacteria 13576
30 Ga0055530_10002802 3300003791 Bacteria 10726
31 Ga0055531_10001707 3300003794 Bacteria 15749
32 Ga0055531_10003092 3300003794 Bacteria 10751
33 Ga0055531_10004113 3300003794 Bacteria 8993
34 Ga0055531_10006002 3300003794 Bacteria 6972
35 Ga0055531_10006102 3300003794 Bacteria 6900
36 Ga0055531_10024100 3300003794 Bacteria 2257
37 Ga0065714_10073604 3300005288 Bacteria 3150
38 Ga0065704_10003114 3300005289 Bacteria 8009
39 Ga0065704_10149466 3300005289 Bacteria 1442
40 Ga0065715_10024549 3300005293 Bacteria 2145
41 Ga0070670_100121929 3300005331 Bacteria 2249
42 Ga0070666_10177339 3300005335 Bacteria 1494
43 Ga0070660_100087997 3300005339 Bacteria 2445
44 Ga0070660_100152225 3300005339 Bacteria 1860
45 Ga0070661_100068660 3300005344 Bacteria 2605
46 Ga0070692_10047688 3300005345 Bacteria 2217
47 Ga0070668_100018345 3300005347 Bacteria 5253
48 Ga0070669_100008706 3300005353 Bacteria 7240
49 Ga0070675_100093951 3300005354 Bacteria 2516
50 Ga0070688_100427113 3300005365 Bacteria 986
51 Ga0070714_100000146 3300005435 Bacteria 56392
52 Ga0070714_100000542 3300005435 Bacteria 27222
53 Ga0070663_100024745 3300005455 Bacteria 4045
54 Ga0070663_100159611 3300005455 Bacteria 1735
55 Ga0070681_10000098 3300005458 Bacteria 64926
56 Ga0070681_10013088 3300005458 Bacteria 8239
57 Ga0070681_10026203 3300005458 Bacteria 5861
58 Ga0070679_100019818 3300005530 Bacteria 6548
59 Ga0070679_100495250 3300005530 Bacteria 1166
60 Ga0068853_100002988 3300005539 Bacteria 12894
61 Ga0070672_100019667 3300005543 Bacteria 4906
62 Ga0070693_100000408 3300005547 Bacteria 19475
63 Ga0070665_100050079 3300005548 Bacteria 4191
64 Ga0070665_100100637 3300005548 Bacteria 2894
65 Ga0070665_100156765 3300005548 Bacteria 2278
66 Ga0070665_100242631 3300005548 Bacteria 1802
67 Ga0070665_100319788 3300005548 Bacteria 1556
68 Ga0068855_100009797 3300005563 Bacteria 11560
69 Ga0068855_100054835 3300005563 Bacteria 4684
70 Ga0068857_100017944 3300005577 Bacteria 6207
71 Ga0068857_100552834 3300005577 Bacteria 1084
72 Ga0068863_100070264 3300005841 Bacteria 3311
73 Ga0068860_100407691 3300005843 Bacteria 1345
74 Ga0068862_100261633 3300005844 Bacteria 1579
75 Ga0075369_10026735 3300006186 Bacteria 2407
76 Ga0105244_10120871 3300009036 Bacteria 1268
77 Ga0111539_10016650 3300009094 Bacteria 9112
78 Ga0114129_10027566 3300009147 Bacteria 8043
79 Ga0105243_10036979 3300009148 Bacteria 3792
80 Ga0105248_10004818 3300009177 Bacteria 14935
81 Ga0105238_10475331 3300009551 Bacteria 1249
82 Ga0105028_101279 3300009993 Bacteria 2647
83 Ga0105239_10005689 3300010375 Bacteria 14562
84 Ga0105239_10018168 3300010375 Bacteria 7772
85 Ga0157327_1000205 3300012512 Bacteria 2960
86 Ga0157373_10039249 3300013100 Bacteria 3390
87 Ga0157373_10046951 3300013100 Bacteria 3081
88 Ga0157373_10104466 3300013100 Bacteria 1992
89 Ga0157373_10205264 3300013100 Bacteria 1389
90 Ga0157371_10014829 3300013102 Bacteria 5868
91 Ga0157371_10066583 3300013102 Bacteria 2551
92 Ga0157371_10290164 3300013102 Bacteria 1183
93 Ga0157370_10009145 3300013104 Bacteria 10621
94 Ga0157370_10038628 3300013104 Bacteria 4618
95 Ga0157370_10218998 3300013104 Bacteria 1763
96 Ga0157369_10039748 3300013105 Bacteria 5140
97 Ga0157369_10051627 3300013105 Bacteria 4449
98 Ga0157369_10440538 3300013105 Bacteria 1350
99 Ga0157374_10012095 3300013296 Bacteria 7495
100 Ga0163162_10224821 3300013306 Bacteria 2007
101 Ga0157372_10047785 3300013307 Bacteria 4756
102 Ga0157375_10297073 3300013308 Bacteria 1778
103 Ga0157380_10000739 3300014326 Bacteria 20396
104 Ga0157380_10016968 3300014326 Bacteria 5379
105 Ga0182008_10000269 3300014497 Bacteria 40734
106 Ga0182008_10007697 3300014497 Bacteria 5931
107 Ga0182008_10014010 3300014497 Bacteria 4205
108 Ga0182008_10018108 3300014497 Bacteria 3648
109 Ga0182008_10038435 3300014497 Bacteria 2393
110 Ga0157376_10064687 3300014969 Bacteria 3085
111 Ga0182006_1015159 3300015261 Bacteria 3308
112 Ga0182006_1022739 3300015261 Bacteria 2603
113 Ga0182007_10010309 3300015262 Bacteria 3704
114 Ga0183369_1013 3300015685 Bacteria 222738
115 Ga0183368_1003 3300015687 Bacteria 1276390
116 Ga0183360_10001 3300015689 Bacteria 3943671
117 Ga0209435_103316 3300025206 Bacteria 1842
118 Ga0209760_100241 3300025207 Bacteria 22788
119 Ga0209784_100016 3300025224 Bacteria 481036
120 Ga0209674_100012 3300025226 Bacteria 950162
121 Ga0209674_100795 3300025226 Bacteria 10602
122 Ga0209672_102473 3300025228 Bacteria 4510
123 Ga0207427_100019 3300025231 Bacteria 513977
124 Ga0207427_102079 3300025231 Bacteria 5889
125 Ga0209437_100012 3300025233 Bacteria 792625
126 Ga0209437_100289 3300025233 Bacteria 73049
127 Ga0209258_100039 3300025242 Bacteria 386366
128 Ga0209258_100308 3300025242 Bacteria 77195
129 Ga0207425_1002572 3300025245 Bacteria 6304
130 Ga0209646_1001527 3300025246 Bacteria 6120
131 Ga0209646_1011250 3300025246 Bacteria 1388
132 Ga0209026_1000012 3300025250 Bacteria 480426
133 Ga0209026_1000139 3300025250 Bacteria 115298
134 Ga0209026_1002408 3300025250 Bacteria 7043
135 Ga0209148_1000001 3300025254 Bacteria 2545271
136 Ga0209148_1000005 3300025254 Bacteria 1806504
137 Ga0209759_1000450 3300025256 Bacteria 47646
138 Ga0209233_1000002 3300025261 Bacteria 2501366
139 Ga0209565_1000001 3300025263 Bacteria 2950419
140 Ga0209565_1000014 3300025263 Bacteria 530302
141 Ga0209565_1001868 3300025263 Bacteria 8397
142 Ga0209455_1000039 3300025272 Bacteria 437734
143 Ga0209455_1006151 3300025272 Bacteria 3594
144 Ga0209673_1000001 3300025273 Bacteria 3176258
145 Ga0209673_1000570 3300025273 Bacteria 58750
146 Ga0209673_1003433 3300025273 Bacteria 9354
147 Ga0209130_1004717 3300025284 Bacteria 5042
148 Ga0209675_1000001 3300025291 Bacteria 2950293
149 Ga0209675_1000021 3300025291 Bacteria 334833
150 Ga0209675_1014381 3300025291 Bacteria 2413
151 Ga0209675_1021462 3300025291 Bacteria 1722
152 Ga0209676_1000027 3300025292 Bacteria 560222
153 Ga0209676_1000079 3300025292 Bacteria 290447
154 Ga0209676_1002120 3300025292 Bacteria 15178
155 Ga0209676_1003018 3300025292 Bacteria 10938
156 Ga0209676_1004237 3300025292 Bacteria 8105
157 Ga0209676_1006659 3300025292 Bacteria 5635
158 Ga0209676_1015826 3300025292 Bacteria 2756
159 Ga0209025_1000102 3300025294 Bacteria 228393
160 Ga0209025_1003190 3300025294 Bacteria 15903
161 Ga0209025_1008168 3300025294 Bacteria 7581
162 Ga0209564_1000001 3300025295 Bacteria 3176258
163 Ga0209564_1000263 3300025295 Bacteria 112148
164 Ga0209564_1017327 3300025295 Bacteria 2814
165 Ga0209758_1016028 3300025297 Bacteria 3832
166 Ga0209050_1000153 3300025298 Bacteria 160851
167 Ga0209050_1002909 3300025298 Bacteria 13453
168 Ga0209050_1011351 3300025298 Bacteria 4239
169 Ga0209256_1000002 3300025299 Bacteria 1906740
170 Ga0209256_1002605 3300025299 Bacteria 14307
171 Ga0209256_1002692 3300025299 Bacteria 13883
172 Ga0209256_1012976 3300025299 Bacteria 3131
173 Ga0209256_1019957 3300025299 Bacteria 2112
174 Ga0209051_1003925 3300025303 Bacteria 9475
175 Ga0209051_1006455 3300025303 Bacteria 6603
176 Ga0209051_1014207 3300025303 Bacteria 3728
177 Ga0209257_1000081 3300025304 Bacteria 306577
178 Ga0209257_1000274 3300025304 Bacteria 117076
179 Ga0209257_1000664 3300025304 Bacteria 54069
180 Ga0209257_1001912 3300025304 Bacteria 22505
181 Ga0209257_1003022 3300025304 Bacteria 15220
182 Ga0209257_1009435 3300025304 Bacteria 5224
183 Ga0209257_1018201 3300025304 Bacteria 2718
184 Ga0207692_10081075 3300025898 Bacteria 1736
185 Ga0207680_10086896 3300025903 Bacteria 1979
186 Ga0207647_10021705 3300025904 Bacteria 4281
187 Ga0207647_10031863 3300025904 Bacteria 3391
188 Ga0207705_10051501 3300025909 Bacteria 2963
189 Ga0207695_10006886 3300025913 Bacteria 14628
190 Ga0207657_10022548 3300025919 Bacteria 5887
191 Ga0207657_10057451 3300025919 Bacteria 3353
192 Ga0207649_10080260 3300025920 Bacteria 2109
193 Ga0207649_10260078 3300025920 Bacteria 1254
194 Ga0207652_10085138 3300025921 Bacteria 2770
195 Ga0207652_10158138 3300025921 Bacteria 2031
196 Ga0207681_10004382 3300025923 Bacteria 8700
197 Ga0207694_10067506 3300025924 Bacteria 2791
198 Ga0207650_10079095 3300025925 Bacteria 2489
199 Ga0207700_10008552 3300025928 Bacteria 6350
200 Ga0207664_10000055 3300025929 Bacteria 126338
201 Ga0207664_10001653 3300025929 Bacteria 14683
202 Ga0207644_10003679 3300025931 Bacteria 9942
203 Ga0207690_10000313 3300025932 Bacteria 32880
204 Ga0207690_10004851 3300025932 Bacteria 7937
205 Ga0207706_10011536 3300025933 Bacteria 8047
206 Ga0207709_10000930 3300025935 Bacteria 22057
207 Ga0207670_10009743 3300025936 Bacteria 5497
208 Ga0207691_10003043 3300025940 Bacteria 16350
209 Ga0207711_10015800 3300025941 Bacteria 6262
210 Ga0207689_10067461 3300025942 Bacteria 2940
211 Ga0207679_10064741 3300025945 Bacteria 2733
212 Ga0207667_10072729 3300025949 Bacteria 3573
213 Ga0207668_10021664 3300025972 Bacteria 4102
214 Ga0207639_10001337 3300026041 Bacteria 16645
215 Ga0207639_10038897 3300026041 Bacteria 3541
216 Ga0207639_10060717 3300026041 Bacteria 2917
217 Ga0207678_10037637 3300026067 Bacteria 4207
218 Ga0207674_10102659 3300026116 Bacteria 2839
219 Ga0207674_10323079 3300026116 Bacteria 1493
220 Ga0209999_1000781 3300027543 Bacteria 5240
221 Ga0209970_1010503 3300027614 Bacteria 1514
222 Ga0209983_1001529 3300027665 Bacteria 5144
223 Ga0209971_1000260 3300027682 Bacteria 14934
224 Ga0209974_10010916 3300027876 Bacteria 3057
225 Ga0207428_10000848 3300027907 Bacteria 34448
226 Ga0268266_10111497 3300028379 Bacteria 2424
227 Ga0268266_10212633 3300028379 Bacteria 1774
228 Ga0268264_10209736 3300028381 Bacteria 1787
229 Ga0307515_10101456 3300028794 Bacteria 3472
230 Ga0307408_100003974 3300031548 Bacteria 10074
231 Ga0307408_100118063 3300031548 Bacteria 2050
232 Ga0307405_10006565 3300031731 Bacteria 5732
233 Ga0307405_10333177 3300031731 Bacteria 1164
234 Ga0307413_10118086 3300031824 Bacteria 1790
235 Ga0307413_10190694 3300031824 Bacteria 1471
236 Ga0307410_10032560 3300031852 Bacteria 3356
237 Ga0307410_10287116 3300031852 Bacteria 1293
238 Ga0307406_10000786 3300031901 Bacteria 17777
239 Ga0307407_10030213 3300031903 Bacteria 2921
240 Ga0307407_10232307 3300031903 Bacteria 1253
241 Ga0307412_10001071 3300031911 Bacteria 15654
242 Ga0307412_10001303 3300031911 Bacteria 13992
243 Ga0307412_10243896 3300031911 Bacteria 1391
244 Ga0307409_100006911 3300031995 Bacteria 6729
245 Ga0307409_100022734 3300031995 Bacteria 4327
246 Ga0307409_100214887 3300031995 Bacteria 1731
247 Ga0307416_100000996 3300032002 Bacteria 14989
248 Ga0307416_100023676 3300032002 Bacteria 4462
249 Ga0307414_10008457 3300032004 Bacteria 5835
250 Ga0307414_10010491 3300032004 Bacteria 5380
251 Ga0307414_10019664 3300032004 Bacteria 4191
252 Ga0307414_10055785 3300032004 Bacteria 2768
253 Ga0307414_10098772 3300032004 Bacteria 2191
254 Ga0307414_10111243 3300032004 Bacteria 2085
255 Ga0307414_10384018 3300032004 Bacteria 1215
256 Ga0307411_10010753 3300032005 Bacteria 4897
257 Ga0307411_10016111 3300032005 Bacteria 4224
258 Ga0307411_10327160 3300032005 Bacteria 1240
259 Ga0307411_10376331 3300032005 Bacteria 1166
260 Ga0307415_100013211 3300032126 Bacteria 4812
261 Ga0316574_0021604 3300035398 Bacteria 3823
262 Ga0316582_0159789 3300036647 Bacteria 1526
263 Ga0395899_0033704 3300037312 Bacteria 3846
264 Ga0395900_0007406 3300037418 Bacteria 11342
265 Ga0395900_0014741 3300037418 Bacteria 7968
266 Ga0395898_0179911 3300037466 Bacteria 2021
267 Ga0395898_0394681 3300037466 Bacteria 1319
268 Ga0395905_0003749 3300037471 Bacteria 16101
269 Ga0395905_0054798 3300037471 Bacteria 3731
270 Ga0395901_0012006 3300038443 Bacteria 8787
271 Ga0237816_00114 3300039145 Bacteria 6024
272 Ga0439436_0001743 3300041404 Bacteria 6375
273 Ga0439439_0000383 3300041406 Bacteria 7291
274 Ga0439447_002530 3300041407 Bacteria 6647
275 Ga0439465_0000443 3300041413 Bacteria 12132
276 Ga0439465_0003713 3300041413 Bacteria 4975
277 Ga0439465_0012195 3300041413 Bacteria 2690
278 Ga0439465_0014765 3300041413 Bacteria 2436
279 Ga0451804_0532257 3300041463 Bacteria 1422
280 Ga0451853_0443933 3300041512 Bacteria 7742
281 Ga0451853_3465305 3300041512 Bacteria 2555
282 Ga0439443_000504 3300042003 Bacteria 3516
283 Ga0439445_0011536 3300042004 Bacteria 2109
284 Ga0439445_0014359 3300042004 Bacteria 1927
285 Ga0439432_005509 3300042006 Bacteria 4553
286 Ga0439432_013067 3300042006 Bacteria 2829
287 Ga0439449_0000083 3300042007 Bacteria 30479
288 Ga0439449_0010980 3300042007 Bacteria 3418
289 Ga0439449_0026350 3300042007 Bacteria 2170
290 Ga0439449_0031541 3300042007 Bacteria 1975
291 Ga0439449_0075319 3300042007 Bacteria 1243
292 Ga0439462_0019816 3300042015 Bacteria 1753
293 Ga0450921_000909 3300042123 Bacteria 1617
294 Ga0450923_001200 3300042125 Bacteria 3328
295 Ga0450894_004419 3300042131 Bacteria 1826
296 Ga0450896_001176 3300042133 Bacteria 3133
297 Ga0450906_013794 3300042145 Bacteria 1485
298 Ga0439446_0007222 3300042156 Bacteria 2916
299 Ga0439446_0011211 3300042156 Bacteria 2430
300 Ga0439434_0005617 3300042435 Bacteria 3662
301 Ga0451577_0030658 3300042876 Bacteria 4857
302 Ga0451577_0037263 3300042876 Bacteria 4377
303 Ga0466966_0070552 3300044684 Bacteria 2190
304 Ga0453684_0028380 3300044712 Bacteria 7986
305 Ga0466960_0049364 3300044901 Bacteria 2025
306 Ga0466959_0183974 3300045049 Bacteria 1461
307 Ga0451576_0346180 3300045051 Bacteria 1556
308 Ga0495627_034769 3300046453 Bacteria 1573
309 Ga0495638_0000159 3300046460 Bacteria 106490
310 Ga0495638_0000161 3300046460 Bacteria 104406
311 Ga0495638_0001128 3300046460 Bacteria 25882
312 Ga0495638_0051061 3300046460 Bacteria 2580
313 Ga0495650_0000197 3300046471 Bacteria 131300
314 Ga0495606_0001905 3300046507 Bacteria 25977
315 Ga0495610_0007262 3300046512 Bacteria 7423
316 Ga0495616_0055093 3300046513 Bacteria 1970
317 Ga0495631_0004929 3300046518 Bacteria 7035
318 Ga0495643_0000649 3300046522 Bacteria 41122
319 Ga0495663_0000203 3300046525 Bacteria 23635
320 Ga0495663_0003041 3300046525 Bacteria 4912
321 Ga0495663_0008948 3300046525 Bacteria 2775
322 Ga0495621_0000143 3300046539 Bacteria 15314
323 Ga0495622_0015532 3300046557 Bacteria 3540
324 Ga0495633_0016819 3300046558 Bacteria 3756
325 Ga0495656_0011638 3300046615 Bacteria 3231
326 Ga0495656_0011825 3300046615 Bacteria 3209
327 Ga0495656_0016191 3300046615 Bacteria 2826
328 Ga0495656_0076365 3300046615 Bacteria 1501
329 Ga0495668_0033993 3300046616 Bacteria 2863
330 Ga0495625_0286522 3300046660 Bacteria 1058
331 Ga0495659_0039154 3300046664 Bacteria 1685
332 Ga0495671_0009213 3300046692 Bacteria 5519
333 Ga0495649_0001857 3300046694 Bacteria 15461
334 Ga0495636_0003226 3300047318 Bacteria 6325
335 Ga0495636_0023504 3300047318 Bacteria 2495
336 Ga0495636_0033080 3300047318 Bacteria 2122
337 Ga0495672_0000134 3300047320 Bacteria 110142
338 Ga0495686_0011881 3300047472 Bacteria 6122
339 Ga0495686_0014959 3300047472 Bacteria 5321
340 Ga0496100_0048825 3300048903 Bacteria 2734
341 Ga0496100_0049326 3300048903 Bacteria 2722
342 Ga0496104_0240049 3300048907 Bacteria 1724
343 Ga0496104_0584079 3300048907 Bacteria 1028
344 Ga0496108_0180958 3300048911 Bacteria 1826
345 Ga0496109_0090719 3300048912 Bacteria 2826
346 Ga0496112_0152075 3300048915 Bacteria 2281
347 Ga0496113_0110816 3300048916 Bacteria 2136
348 Ga0496113_0169396 3300048916 Bacteria 1729
349 Ga0496113_0214061 3300048916 Bacteria 1534
350 Ga0496114_0082823 3300048917 Bacteria 2713
351 Ga0496114_0268878 3300048917 Bacteria 1502
352 Ga0496115_0000025 3300048918 Bacteria 151658
353 Ga0496115_0000704 3300048918 Bacteria 24792
354 Ga0496115_0006998 3300048918 Bacteria 8287
355 Ga0496115_0009906 3300048918 Bacteria 7099
356 Ga0496116_0003937 3300048919 Bacteria 14443
357 Ga0496116_0051158 3300048919 Bacteria 2746
358 Ga0496117_0001343 3300048920 Bacteria 36067
359 Ga0496117_0019045 3300048920 Bacteria 5654
360 Ga0496117_0032669 3300048920 Bacteria 3950
361 Ga0496118_0000145 3300048921 Bacteria 123886
362 Ga0496118_0004832 3300048921 Bacteria 15713
363 Ga0496118_0005873 3300048921 Bacteria 13756
364 Ga0496118_0020948 3300048921 Bacteria 5778
365 Ga0496118_0028507 3300048921 Bacteria 4699
366 Ga0496119_0077707 3300048922 Bacteria 1922
367 Ga0496121_0000739 3300048924 Bacteria 60228
368 Ga0496121_0005956 3300048924 Bacteria 15410
369 Ga0496121_0017314 3300048924 Bacteria 7371
370 Ga0496121_0118701 3300048924 Bacteria 2001
371 Ga0496122_0000196 3300048925 Bacteria 136499
372 Ga0496122_0023731 3300048925 Bacteria 5392
373 Ga0496122_0218912 3300048925 Bacteria 1094
374 Ga0496123_0000128 3300048926 Bacteria 154836
375 Ga0496123_0011349 3300048926 Bacteria 7735
376 Ga0496123_0017728 3300048926 Bacteria 5710
377 Ga0496123_0025233 3300048926 Bacteria 4487
378 Ga0496124_0000255 3300048927 Bacteria 102645
379 Ga0496124_0006709 3300048927 Bacteria 12453
380 Ga0496124_0015988 3300048927 Bacteria 7161
381 Ga0496124_0016529 3300048927 Bacteria 7007
382 Ga0496124_0030443 3300048927 Bacteria 4790
383 Ga0496125_0013402 3300048928 Bacteria 8062
384 Ga0496125_0030799 3300048928 Bacteria 4792
385 Ga0496125_0143856 3300048928 Bacteria 1652
386 Ga0496126_0009292 3300048929 Bacteria 10472
387 Ga0496126_0010853 3300048929 Bacteria 9496
388 Ga0496126_0190751 3300048929 Bacteria 1736
389 Ga0495678_005086 3300049459 Bacteria 7390
390 Ga0501031_0012360 3300049568 Bacteria 5568
391 Ga0501031_0018467 3300049568 Bacteria 4537
392 Ga0501032_0015729 3300049569 Bacteria 5334
393 Ga0501033_0019799 3300049570 Bacteria 5086
394 Ga0501033_0075753 3300049570 Bacteria 2469
395 Ga0501033_0165201 3300049570 Bacteria 1592
396 Ga0501034_0000273 3300049571 Bacteria 93198
397 Ga0501034_0000571 3300049571 Bacteria 58421
398 Ga0501034_0008613 3300049571 Bacteria 10764
399 Ga0501034_0009007 3300049571 Bacteria 10482
400 Ga0501036_0144241 3300049572 Bacteria 2008
401 Ga0501037_0002241 3300049573 Bacteria 13976
402 Ga0501037_0077010 3300049573 Bacteria 2420
403 Ga0501037_0128293 3300049573 Bacteria 1820
404 Ga0501038_0014142 3300049574 Bacteria 7271
405 Ga0501039_0011939 3300049575 Bacteria 6620
406 Ga0501039_0027479 3300049575 Bacteria 4375
407 Ga0501039_0056286 3300049575 Bacteria 3046
408 Ga0501040_0242355 3300049576 Bacteria 1285
409 Ga0501041_0003525 3300049577 Bacteria 9004
410 Ga0501042_0131751 3300049578 Bacteria 1802
411 Ga0501043_0009438 3300049579 Bacteria 7656
412 Ga0501043_0026459 3300049579 Bacteria 4551
413 Ga0501043_0038662 3300049579 Bacteria 3751
414 Ga0501046_0011180 3300049580 Bacteria 7691
415 Ga0501047_0123751 3300049581 Bacteria 2466
416 Ga0501047_0141227 3300049581 Bacteria 2287
417 Ga0501047_0302126 3300049581 Bacteria 1443
418 Ga0501048_0177264 3300049582 Bacteria 1511
419 Ga0501048_0183517 3300049582 Bacteria 1483
420 Ga0501068_0099368 3300049584 Bacteria 1803
421 Ga0501070_0006739 3300049586 Bacteria 9783
422 Ga0501071_0021419 3300049587 Bacteria 4501
423 Ga0501072_0120527 3300049588 Bacteria 2090
424 Ga0501073_0003024 3300049589 Bacteria 12606
425 Ga0501075_0043094 3300049591 Bacteria 3385
426 Ga0501076_0131164 3300049592 Bacteria 2032
427 Ga0501076_0166015 3300049592 Bacteria 1799
428 Ga0501225_0004097 3300049705 Bacteria 4361
429 Ga0501080_0052954 3300049742 Bacteria 3778
430 Ga0501080_0115242 3300049742 Bacteria 2492
431 Ga0501081_0018637 3300049743 Bacteria 4612
432 Ga0501265_001308 3300049762 Bacteria 2803
433 Ga0501275_000315 3300049772 Bacteria 5496
434 Ga0501035_0001927 3300049822 Bacteria 20784
435 Ga0501035_0185913 3300049822 Bacteria 1788
436 Ga0501035_0341789 3300049822 Bacteria 1254
437 Ga0501044_0042230 3300049823 Bacteria 4743
438 Ga0501044_0102092 3300049823 Bacteria 2884
439 Ga0501044_0171016 3300049823 Bacteria 2144
440 nmdc:mga05p37_18858_c1 3300050507 Bacteria 8339
441 Ga0500610_0000756 3300053079 Bacteria 10166
442 Ga0500651_0003496 3300053093 Bacteria 8588
443 Ga0500597_000364 3300053120 Bacteria 9410
444 Ga0501082_0011223 3300060353 Bacteria 7698
445 Ga0530510_0056679 3300061734 Bacteria 2831
446 2525557325 2524614729 Bacteria 3091755
447 2547500880 2547132130 Bacteria 4660562
448 2572255411 2571042365 Bacteria 3289345
449 2578458924 2576861471 Bacteria 4648976
450 2630650541 2627854209 Bacteria 3093011
451 2643816362 2643221559 Bacteria 4424915
452 2643831326 2643221562 Bacteria 4048635
453 2643881514 2643221573 Bacteria 4784121
454 2643905515 2643221579 Bacteria 4443405
455 2643913344 2643221581 Bacteria 3893603
456 2643938951 2643221586 Bacteria 4446529
457 2644077306 2643221612 Bacteria 4361984
458 2644529804 2643221695 Bacteria 3441323
459 2644662650 2643221720 Bacteria 4694283
460 2644694384 2643221727 Bacteria 4415595
461 2644698396 2643221728 Bacteria 4797149
462 2739731793 2739367700 Bacteria 4747630
463 2816516457 2816332141 Bacteria 4436036
464 2842392829 2842391507 Bacteria 4486072
465 2857446760 2857442823 Bacteria 4562550
466 2874221063 2874220319 Bacteria 4594709
467 2895397160 2895395659 Bacteria 3983269
468 2895527091 2895525241 Bacteria 3388457
469 2919091273 2919089067 Bacteria 4560942
470 2919136387 2919134579 Bacteria 4480386
471 2923517631 2923516293 Bacteria 3716336
472 2928497905 2928496128 Bacteria 4631123
473 2928967228 2928963466 Bacteria 5165703
474 2931381291 2931380184 Bacteria 4455911
475 2937611885 2937610967 Bacteria 4618818
476 2939590566 2939589442 Bacteria 4214238
477 2939615256 2939611941 Bacteria 3892017
478 2939622734 2939622612 Bacteria 4698046
479 2939629617 2939626828 Bacteria 4695272
480 2941489907 2941489479 Bacteria 6313767
481 2961047828 2961047084 Bacteria 4594415
482 2961067167 2961064222 Bacteria 4749990
483 2974309387 2974307012 Bacteria 4172388
484 2977250107 2977247770 Bacteria 4160543
485 2984515403 2984514374 Bacteria 4172479
486 2987607498 2987605356 Bacteria 4187822
487 8002869614 8002869464 Bacteria 3588529
488 8003016646 8003014200 Bacteria 4059994
489 Ga0105032_100446
490 SwRhRL2b_contig_1905644
491 JGI24735J21928_10000216
492 JGI25156J39149_1007651
493 JGI25162J39368_1000068
494 JGI25157J39369_1000333
495 JGI25157J39369_1001030
496 JGI25163J39215_1000714
497 JGI25164J39214_1000216
498 JGI25165J46597_1000058
499 Ga0055538_1000501
500 Ga0055535_1000034
501 Ga0055542_1000081
502 Ga0055542_1000112
503 Ga0055529_1000083
504 Ga0055526_1000008
505 Ga0055526_1001472
506 Ga0055526_1004394
507 Ga0055537_1000343
508 Ga0055537_1000713
509 Ga0055524_1001290
510 Ga0055536_1003090
511 Ga0055536_1006496
512 Ga0055536_1010079
513 Ga0055534_1000003
514 Ga0055534_1000717
515 Ga0055528_1000019
516 Ga0055528_1003920
517 Ga0055530_10002049
518 Ga0055530_10002802
519 Ga0055531_10001707
520 Ga0055531_10003092
521 Ga0055531_10004113
522 Ga0055531_10006002
523 Ga0055531_10006102
524 Ga0055531_10024100
525 Ga0065714_10073604
526 Ga0065704_10003114
527 Ga0065704_10149466
528 Ga0065715_10024549
529 Ga0070670_100121929
530 Ga0070666_10177339
531 Ga0070660_100087997
532 Ga0070660_100152225
533 Ga0070661_100068660
534 Ga0070692_10047688
535 Ga0070668_100018345
536 Ga0070669_100008706
537 Ga0070675_100093951
538 Ga0070688_100427113
539 Ga0070714_100000146
540 Ga0070714_100000542
541 Ga0070663_100024745
542 Ga0070663_100159611
543 Ga0070681_10000098
544 Ga0070681_10013088
545 Ga0070681_10026203
546 Ga0070679_100019818
547 Ga0070679_100495250
548 Ga0068853_100002988
549 Ga0070672_100019667
550 Ga0070693_100000408
551 Ga0070665_100050079
552 Ga0070665_100100637
553 Ga0070665_100156765
554 Ga0070665_100242631
555 Ga0070665_100319788
556 Ga0068855_100009797
557 Ga0068855_100054835
558 Ga0068857_100017944
559 Ga0068857_100552834
560 Ga0068863_100070264
561 Ga0068860_100407691
562 Ga0068862_100261633
563 Ga0075369_10026735
564 Ga0105244_10120871
565 Ga0111539_10016650
566 Ga0114129_10027566
567 Ga0105243_10036979
568 Ga0105248_10004818
569 Ga0105238_10475331
570 Ga0105028_101279
571 Ga0105239_10005689
572 Ga0105239_10018168
573 Ga0157327_1000205
574 Ga0157373_10039249
575 Ga0157373_10046951
576 Ga0157373_10104466
577 Ga0157373_10205264
578 Ga0157371_10014829
579 Ga0157371_10066583
580 Ga0157371_10290164
581 Ga0157370_10009145
582 Ga0157370_10038628
583 Ga0157370_10218998
584 Ga0157369_10039748
585 Ga0157369_10051627
586 Ga0157369_10440538
587 Ga0157374_10012095
588 Ga0163162_10224821
589 Ga0157372_10047785
590 Ga0157375_10297073
591 Ga0157380_10000739
592 Ga0157380_10016968
593 Ga0182008_10000269
594 Ga0182008_10007697
595 Ga0182008_10014010
596 Ga0182008_10018108
597 Ga0182008_10038435
598 Ga0157376_10064687
599 Ga0182006_1015159
600 Ga0182006_1022739
601 Ga0182007_10010309
602 Ga0183369_1013
603 Ga0183368_1003
604 Ga0183360_10001
605 Ga0209435_103316
606 Ga0209760_100241
607 Ga0209784_100016
608 Ga0209674_100012
609 Ga0209674_100795
610 Ga0209672_102473
611 Ga0207427_100019
612 Ga0207427_102079
613 Ga0209437_100012
614 Ga0209437_100289
615 Ga0209258_100039
616 Ga0209258_100308
617 Ga0207425_1002572
618 Ga0209646_1001527
619 Ga0209646_1011250
620 Ga0209026_1000012
621 Ga0209026_1000139
622 Ga0209026_1002408
623 Ga0209148_1000001
624 Ga0209148_1000005
625 Ga0209759_1000450
626 Ga0209233_1000002
627 Ga0209565_1000001
628 Ga0209565_1000014
629 Ga0209565_1001868
630 Ga0209455_1000039
631 Ga0209455_1006151
632 Ga0209673_1000001
633 Ga0209673_1000570
634 Ga0209673_1003433
635 Ga0209130_1004717
636 Ga0209675_1000001
637 Ga0209675_1000021
638 Ga0209675_1014381
639 Ga0209675_1021462
640 Ga0209676_1000027
641 Ga0209676_1000079
642 Ga0209676_1002120
643 Ga0209676_1003018
644 Ga0209676_1004237
645 Ga0209676_1006659
646 Ga0209676_1015826
647 Ga0209025_1000102
648 Ga0209025_1003190
649 Ga0209025_1008168
650 Ga0209564_1000001
651 Ga0209564_1000263
652 Ga0209564_1017327
653 Ga0209758_1016028
654 Ga0209050_1000153
655 Ga0209050_1002909
656 Ga0209050_1011351
657 Ga0209256_1000002
658 Ga0209256_1002605
659 Ga0209256_1002692
660 Ga0209256_1012976
661 Ga0209256_1019957
662 Ga0209051_1003925
663 Ga0209051_1006455
664 Ga0209051_1014207
665 Ga0209257_1000081
666 Ga0209257_1000274
667 Ga0209257_1000664
668 Ga0209257_1001912
669 Ga0209257_1003022
670 Ga0209257_1009435
671 Ga0209257_1018201
672 Ga0207692_10081075
673 Ga0207680_10086896
674 Ga0207647_10021705
675 Ga0207647_10031863
676 Ga0207705_10051501
677 Ga0207695_10006886
678 Ga0207657_10022548
679 Ga0207657_10057451
680 Ga0207649_10080260
681 Ga0207649_10260078
682 Ga0207652_10085138
683 Ga0207652_10158138
684 Ga0207681_10004382
685 Ga0207694_10067506
686 Ga0207650_10079095
687 Ga0207700_10008552
688 Ga0207664_10000055
689 Ga0207664_10001653
690 Ga0207644_10003679
691 Ga0207690_10000313
692 Ga0207690_10004851
693 Ga0207706_10011536
694 Ga0207709_10000930
695 Ga0207670_10009743
696 Ga0207691_10003043
697 Ga0207711_10015800
698 Ga0207689_10067461
699 Ga0207679_10064741
700 Ga0207667_10072729
701 Ga0207668_10021664
702 Ga0207639_10001337
703 Ga0207639_10038897
704 Ga0207639_10060717
705 Ga0207678_10037637
706 Ga0207674_10102659
707 Ga0207674_10323079
708 Ga0209999_1000781
709 Ga0209970_1010503
710 Ga0209983_1001529
711 Ga0209971_1000260
712 Ga0209974_10010916
713 Ga0207428_10000848
714 Ga0268266_10111497
715 Ga0268266_10212633
716 Ga0268264_10209736
717 Ga0307515_10101456
718 Ga0307408_100003974
719 Ga0307408_100118063
720 Ga0307405_10006565
721 Ga0307405_10333177
722 Ga0307413_10118086
723 Ga0307413_10190694
724 Ga0307410_10032560
725 Ga0307410_10287116
726 Ga0307406_10000786
727 Ga0307407_10030213
728 Ga0307407_10232307
729 Ga0307412_10001071
730 Ga0307412_10001303
731 Ga0307412_10243896
732 Ga0307409_100006911
733 Ga0307409_100022734
734 Ga0307409_100214887
735 Ga0307416_100000996
736 Ga0307416_100023676
737 Ga0307414_10008457
738 Ga0307414_10010491
739 Ga0307414_10019664
740 Ga0307414_10055785
741 Ga0307414_10098772
742 Ga0307414_10111243
743 Ga0307414_10384018
744 Ga0307411_10010753
745 Ga0307411_10016111
746 Ga0307411_10327160
747 Ga0307411_10376331
748 Ga0307415_100013211
749 Ga0316574_0021604
750 Ga0316582_0159789
751 Ga0395899_0033704
752 Ga0395900_0007406
753 Ga0395900_0014741
754 Ga0395898_0179911
755 Ga0395898_0394681
756 Ga0395905_0003749
757 Ga0395905_0054798
758 Ga0395901_0012006
759 Ga0237816_00114
760 Ga0439436_0001743
761 Ga0439439_0000383
762 Ga0439447_002530
763 Ga0439465_0000443
764 Ga0439465_0003713
765 Ga0439465_0012195
766 Ga0439465_0014765
767 Ga0451804_0532257
768 Ga0451853_0443933
769 Ga0451853_3465305
770 Ga0439443_000504
771 Ga0439445_0011536
772 Ga0439445_0014359
773 Ga0439432_005509
774 Ga0439432_013067
775 Ga0439449_0000083
776 Ga0439449_0010980
777 Ga0439449_0026350
778 Ga0439449_0031541
779 Ga0439449_0075319
780 Ga0439462_0019816
781 Ga0450921_000909
782 Ga0450923_001200
783 Ga0450894_004419
784 Ga0450896_001176
785 Ga0450906_013794
786 Ga0439446_0007222
787 Ga0439446_0011211
788 Ga0439434_0005617
789 Ga0451577_0030658
790 Ga0451577_0037263
791 Ga0466966_0070552
792 Ga0453684_0028380
793 Ga0466960_0049364
794 Ga0466959_0183974
795 Ga0451576_0346180
796 Ga0495627_034769
797 Ga0495638_0000159
798 Ga0495638_0000161
799 Ga0495638_0001128
800 Ga0495638_0051061
801 Ga0495650_0000197
802 Ga0495606_0001905
803 Ga0495610_0007262
804 Ga0495616_0055093
805 Ga0495631_0004929
806 Ga0495643_0000649
807 Ga0495663_0000203
808 Ga0495663_0003041
809 Ga0495663_0008948
810 Ga0495621_0000143
811 Ga0495622_0015532
812 Ga0495633_0016819
813 Ga0495656_0011638
814 Ga0495656_0011825
815 Ga0495656_0016191
816 Ga0495656_0076365
817 Ga0495668_0033993
818 Ga0495625_0286522
819 Ga0495659_0039154
820 Ga0495671_0009213
821 Ga0495649_0001857
822 Ga0495636_0003226
823 Ga0495636_0023504
824 Ga0495636_0033080
825 Ga0495672_0000134
826 Ga0495686_0011881
827 Ga0495686_0014959
828 Ga0496100_0048825
829 Ga0496100_0049326
830 Ga0496104_0240049
831 Ga0496104_0584079
832 Ga0496108_0180958
833 Ga0496109_0090719
834 Ga0496112_0152075
835 Ga0496113_0110816
836 Ga0496113_0169396
837 Ga0496113_0214061
838 Ga0496114_0082823
839 Ga0496114_0268878
840 Ga0496115_0000025
841 Ga0496115_0000704
842 Ga0496115_0006998
843 Ga0496115_0009906
844 Ga0496116_0003937
845 Ga0496116_0051158
846 Ga0496117_0001343
847 Ga0496117_0019045
848 Ga0496117_0032669
849 Ga0496118_0000145
850 Ga0496118_0004832
851 Ga0496118_0005873
852 Ga0496118_0020948
853 Ga0496118_0028507
854 Ga0496119_0077707
855 Ga0496121_0000739
856 Ga0496121_0005956
857 Ga0496121_0017314
858 Ga0496121_0118701
859 Ga0496122_0000196
860 Ga0496122_0023731
861 Ga0496122_0218912
862 Ga0496123_0000128
863 Ga0496123_0011349
864 Ga0496123_0017728
865 Ga0496123_0025233
866 Ga0496124_0000255
867 Ga0496124_0006709
868 Ga0496124_0015988
869 Ga0496124_0016529
870 Ga0496124_0030443
871 Ga0496125_0013402
872 Ga0496125_0030799
873 Ga0496125_0143856
874 Ga0496126_0009292
875 Ga0496126_0010853
876 Ga0496126_0190751
877 Ga0495678_005086
878 Ga0501031_0012360
879 Ga0501031_0018467
880 Ga0501032_0015729
881 Ga0501033_0019799
882 Ga0501033_0075753
883 Ga0501033_0165201
884 Ga0501034_0000273
885 Ga0501034_0000571
886 Ga0501034_0008613
887 Ga0501034_0009007
888 Ga0501036_0144241
889 Ga0501037_0002241
890 Ga0501037_0077010
891 Ga0501037_0128293
892 Ga0501038_0014142
893 Ga0501039_0011939
894 Ga0501039_0027479
895 Ga0501039_0056286
896 Ga0501040_0242355
897 Ga0501041_0003525
898 Ga0501042_0131751
899 Ga0501043_0009438
900 Ga0501043_0026459
901 Ga0501043_0038662
902 Ga0501046_0011180
903 Ga0501047_0123751
904 Ga0501047_0141227
905 Ga0501047_0302126
906 Ga0501048_0177264
907 Ga0501048_0183517
908 Ga0501068_0099368
909 Ga0501070_0006739
910 Ga0501071_0021419
911 Ga0501072_0120527
912 Ga0501073_0003024
913 Ga0501075_0043094
914 Ga0501076_0131164
915 Ga0501076_0166015
916 Ga0501225_0004097
917 Ga0501080_0052954
918 Ga0501080_0115242
919 Ga0501081_0018637
920 Ga0501265_001308
921 Ga0501275_000315
922 Ga0501035_0001927
923 Ga0501035_0185913
924 Ga0501035_0341789
925 Ga0501044_0042230
926 Ga0501044_0102092
927 Ga0501044_0171016
928 nmdc:mga05p37_18858_c1
929 Ga0500610_0000756
930 Ga0500651_0003496
931 Ga0500597_000364
932 Ga0501082_0011223
933 Ga0530510_0056679
934 2525557325
935 2547500880
936 2572255411
937 2578458924
938 2630650541
939 2643816362
940 2643831326
941 2643881514
942 2643905515
943 2643913344
944 2643938951
945 2644077306
946 2644529804
947 2644662650
948 2644694384
949 2644698396
950 2739731793
951 2816516457
952 2842392829
953 2857446760
954 2874221063
955 2895397160
956 2895527091
957 2919091273
958 2919136387
959 2923517631
960 2928497905
961 2928967228
962 2931381291
963 2937611885
964 2939590566
965 2939615256
966 2939622734
967 2939629617
968 2941489907
969 2961047828
970 2961067167
971 2974309387
972 2977250107
973 2984515403
974 2987607498
975 8002869614
976 8003016646

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

65

209

0.96

PF13304

AAA_21

AAA domain, putative AbiEii toxin, Type IV TA system

111

240

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
1vpl-assembly1.cif.gz_A-2 crystal structure of abc transporter atp-binding protein (tm0544) from thermotoga maritima at 2.10 a resolution 0.953 9 229
6z4w-assembly1.cif.gz_A ftse structure from streptococcus pneumoniae in complex with adp (space group p 1) 0.9523 8 222
2pcj-assembly1.cif.gz_B crystal structure of abc transporter (aq_297) from aquifex aeolicus vf5 0.942 8 222
5lj9-assembly3.cif.gz_C structure of the e. coli macb abc domain (c2221) 0.936 8 222
8tzj-assembly1.cif.gz_A cryo-em structure of vibrio cholerae ftse/ftsx complex 0.9357 9 217
ID Description Score Start End Superfamily
af_P0A9U1_1_234_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9587 8 233 3.40.50.300
1vplA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.953 9 229 3.40.50.300
af_P0A9U1_321_563_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9525 7 231 3.40.50.300
af_A1ZBS3_1241_1472_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9517 10 231 3.40.50.300
af_Q8T6J5_1286_1532_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9499 7 229 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A7S3DN60-F1-model_v4 ABC transporter domain-containing protein 0.9677 7 164 GO:0005319
GO:0005524
GO:0016020
GO:0016887
GO:0043231
GO:0140359
AF-A0A511X0H7-F1-model_v4 ABC transporter domain-containing protein 0.9648 7 189 GO:0005524
GO:0016887
AF-Q8VR06-F1-model_v4 Putative ABC transporter protein 0.9644 87 230 GO:0005524
GO:0016887
AF-A0A2W7B2T3-F1-model_v4 Multidrug ABC transporter ATP-binding protein 0.9641 8 212 GO:0005524
GO:0016887
AF-A0A3B9BHG2-F1-model_v4 ABC transporter ATP-binding protein 0.9628 1 229 GO:0005524
GO:0016887

Map