F453603

General Info

Members Datasets Scaffolds Average Seq Length
488 290 976 86

Family's Representative Sequence

Representative Sequence 3300013104|Ga0157370_11696808|Ga0157370_116968081
Length 103
Sequence MALHMGIVKISDGMHENLRIASDALSRSINAQAEHWMRVGMLAELHPGLDHREICQLLIRAELAGGFDLRVLAAESSSASTIQSKVPRATKRAKPITGTEVRP

Samples

Sample ID Description Type Environment
1 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
2 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
5 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
6 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
7 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
8 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
9 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
10 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
11 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
12 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
13 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
14 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
15 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
16 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
17 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
18 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
19 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
20 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
21 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
22 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
23 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
24 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
34 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
35 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
36 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
37 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
38 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
39 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
40 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
41 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
42 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
43 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
44 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
47 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
48 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
49 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
50 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
51 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
52 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
53 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
54 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
55 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
56 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
57 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
58 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
59 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
64 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
65 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
67 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
68 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
69 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
72 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
73 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
74 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
75 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
77 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
78 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
80 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
81 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
83 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
104 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
106 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
107 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
110 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
111 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
112 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
113 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
114 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
115 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
116 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
117 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
118 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
119 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
120 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
121 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
122 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
123 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
124 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
125 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
126 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
127 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
128 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
129 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
130 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
131 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
132 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
133 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
134 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
135 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
136 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
137 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
138 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
139 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
140 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
141 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
142 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
143 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
144 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
145 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
146 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
147 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
148 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
149 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
150 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
151 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
152 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
153 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
154 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
155 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
156 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
157 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
158 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
159 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
160 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
161 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
162 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
163 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
164 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
165 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
166 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
167 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
168 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
169 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
170 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
171 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
172 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
173 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
174 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
175 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
176 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
177 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
178 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
179 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
180 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
181 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
182 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
183 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
184 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
185 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
186 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
187 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
188 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
189 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
190 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
191 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
192 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
193 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
194 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
195 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
196 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
197 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
198 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
199 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
200 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
201 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
202 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
203 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
204 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
205 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
206 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
207 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
208 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
209 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
210 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
211 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
212 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
213 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
214 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
215 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
216 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
217 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
218 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
219 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
220 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
221 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
222 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
223 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
224 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
225 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
226 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
227 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
228 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
229 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
230 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
231 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
232 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
233 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
234 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
235 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
236 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
237 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
238 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
239 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
240 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
241 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
242 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
243 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
244 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
245 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
246 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
247 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
248 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
249 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
250 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
251 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
252 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
253 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
254 3300053127 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 endosphere Metagenome Endosphere
255 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
256 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
257 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
258 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
259 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
260 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
261 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
262 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
263 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
264 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
265 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
266 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
267 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
268 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
269 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
270 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
271 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
272 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
273 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
274 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
275 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
276 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
277 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
278 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
279 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
280 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
281 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
282 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
283 2511231018 Pseudomonas sp. GM60 Isolate Nodule
284 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
285 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
286 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
287 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
288 2738543012 Acidovorax sp. CF301 Isolate Unclassified
289 2816332133 Acidovorax radicis 2721A Isolate Unclassified
290 2904541872 Variovorax sp. 1615 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.16
Metatranscriptomes 0.2
Isolates 1.64

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 34.02
Nodule 0.82
Rhizoplane 3.07
Rhizosphere 51.23
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157370_11696808 3300013104 Bacteria 567
2 JGI25155J39150_1000200 3300002704 Bacteria 25078
3 JGI25156J39149_1000451 3300002705 Bacteria 25115
4 JGI25156J39149_1014867 3300002705 Bacteria 1584
5 JGI25154J39366_1000371 3300002738 Bacteria 25115
6 JGI25157J39369_1000479 3300002741 Bacteria 25115
7 JGI25151J46595_10000568 3300003187 Bacteria 33251
8 JGI25165J46597_1000117 3300003214 Bacteria 137891
9 Ga0006562J51391_1051200 3300003578 Bacteria 1232
10 Ga0055538_1000046 3300003751 Bacteria 137891
11 Ga0055539_1000065 3300003752 Bacteria 136847
12 Ga0055533_1000075 3300003756 Bacteria 137891
13 Ga0055525_1000095 3300003759 Bacteria 137891
14 Ga0055535_1000097 3300003761 Bacteria 95927
15 Ga0055529_1000202 3300003763 Bacteria 79179
16 Ga0055537_1000421 3300003773 Bacteria 27644
17 Ga0055534_1000379 3300003784 Bacteria 27759
18 Ga0055528_1000661 3300003790 Bacteria 25015
19 Ga0055528_1008253 3300003790 Bacteria 4495
20 Ga0055540_1000754 3300003792 Bacteria 21953
21 Ga0055540_1002165 3300003792 Bacteria 10703
22 Ga0055541_1000047 3300003841 Bacteria 136847
23 Ga0065165_1002894 3300005262 Bacteria 13186
24 Ga0065714_10166450 3300005288 Bacteria 1022
25 Ga0065714_10364333 3300005288 Bacteria 622
26 Ga0065704_10059628 3300005289 Bacteria 555
27 Ga0065704_10157960 3300005289 Bacteria 1376
28 Ga0070658_10027838 3300005327 Bacteria 4535
29 Ga0070658_10547348 3300005327 Bacteria 1001
30 Ga0070658_10614399 3300005327 Bacteria 942
31 Ga0070666_10840771 3300005335 Bacteria 677
32 Ga0070660_100504625 3300005339 Bacteria 1006
33 Ga0070661_100674273 3300005344 Bacteria 841
34 Ga0070673_100256996 3300005364 Bacteria 1525
35 Ga0070659_100099662 3300005366 Bacteria 2337
36 Ga0070662_100267139 3300005457 Bacteria 1380
37 Ga0068853_100772622 3300005539 Bacteria 919
38 Ga0068855_100804990 3300005563 Bacteria 998
39 Ga0068855_100962375 3300005563 Bacteria 899
40 Ga0068852_101066437 3300005616 Bacteria 828
41 Ga0075365_10072568 3300006038 Bacteria 2319
42 Ga0075363_100062852 3300006048 Bacteria 2002
43 Ga0075363_100344936 3300006048 Bacteria 869
44 Ga0075364_10005461 3300006051 Bacteria 7389
45 Ga0075364_10354294 3300006051 Bacteria 1000
46 Ga0075364_10388104 3300006051 Bacteria 953
47 Ga0075364_10540157 3300006051 Bacteria 797
48 Ga0075364_10748113 3300006051 Bacteria 667
49 Ga0075362_10000441 3300006177 Bacteria 12035
50 Ga0075362_10102168 3300006177 Bacteria 1342
51 Ga0075362_10258387 3300006177 Bacteria 858
52 Ga0075367_10042641 3300006178 Bacteria 2656
53 Ga0075367_10126113 3300006178 Bacteria 1580
54 Ga0075367_11131129 3300006178 Bacteria 501
55 Ga0075369_10018889 3300006186 Bacteria 2810
56 Ga0075369_10075775 3300006186 Bacteria 1486
57 Ga0075366_10007581 3300006195 Bacteria 6003
58 Ga0075366_10036279 3300006195 Bacteria 2906
59 Ga0075370_10007919 3300006353 Bacteria 5439
60 Ga0075370_10011567 3300006353 Bacteria 4640
61 Ga0075370_10056851 3300006353 Bacteria 2223
62 Ga0068865_101048998 3300006881 Bacteria 716
63 Ga0079104_1026020 3300006946 Bacteria 1518
64 Ga0105251_10014478 3300009011 Bacteria 4355
65 Ga0105251_10060938 3300009011 Bacteria 1775
66 Ga0105244_10015538 3300009036 Bacteria 4362
67 Ga0105244_10016277 3300009036 Bacteria 4240
68 Ga0105244_10051708 3300009036 Bacteria 2093
69 Ga0105240_10733863 3300009093 Bacteria 1075
70 Ga0105243_10000099 3300009148 Bacteria 99838
71 Ga0105243_10002736 3300009148 Bacteria 14662
72 Ga0105243_10010523 3300009148 Bacteria 7023
73 Ga0105243_10036139 3300009148 Bacteria 3832
74 Ga0105246_10381160 3300011119 Bacteria 1165
75 Ga0105246_10434897 3300011119 Bacteria 1099
76 Ga0105246_10563400 3300011119 Bacteria 978
77 Ga0157347_1002606 3300012502 Bacteria 1560
78 Ga0157347_1074313 3300012502 Bacteria 507
79 Ga0157373_10003398 3300013100 Bacteria 12042
80 Ga0157370_10019708 3300013104 Bacteria 6754
81 Ga0157370_10031281 3300013104 Bacteria 5208
82 Ga0157370_10990998 3300013104 Bacteria 761
83 Ga0157370_11014340 3300013104 Bacteria 751
84 Ga0157369_10274606 3300013105 Bacteria 1756
85 Ga0157369_11646587 3300013105 Bacteria 652
86 Ga0157369_12164120 3300013105 Bacteria 564
87 Ga0157374_10552040 3300013296 Bacteria 1160
88 Ga0182008_10000332 3300014497 Bacteria 37231
89 Ga0182008_10027471 3300014497 Bacteria 2882
90 Ga0182008_10055218 3300014497 Bacteria 1965
91 Ga0182006_1007168 3300015261 Bacteria 5125
92 Ga0182006_1018832 3300015261 Bacteria 2912
93 Ga0182006_1083911 3300015261 Bacteria 1158
94 Ga0182006_1103153 3300015261 Bacteria 1010
95 Ga0182007_10118065 3300015262 Bacteria 886
96 Ga0182007_10201944 3300015262 Bacteria 695
97 Ga0182007_10209787 3300015262 Bacteria 684
98 Ga0182005_1077910 3300015265 Bacteria 914
99 Ga0183362_10006 3300015683 Bacteria 287231
100 Ga0163161_10001155 3300017792 Bacteria 19878
101 Ga0163161_10210170 3300017792 Bacteria 1503
102 Ga0209435_100002 3300025206 Bacteria 794178
103 Ga0209784_100010 3300025224 Bacteria 683664
104 Ga0209566_100008 3300025225 Bacteria 683664
105 Ga0209674_100019 3300025226 Bacteria 683664
106 Ga0209563_100021 3300025230 Bacteria 683764
107 Ga0207427_100688 3300025231 Bacteria 16016
108 Ga0209437_100019 3300025233 Bacteria 683764
109 Ga0209258_100162 3300025242 Bacteria 151725
110 Ga0207425_1003817 3300025245 Bacteria 4698
111 Ga0209646_1000001 3300025246 Bacteria 3092932
112 Ga0209026_1000001 3300025250 Bacteria 1228671
113 Ga0209026_1015204 3300025250 Bacteria 1268
114 Ga0209677_100011 3300025253 Bacteria 683664
115 Ga0209677_103035 3300025253 Bacteria 5768
116 Ga0209148_1010210 3300025254 Bacteria 1792
117 Ga0209759_1000001 3300025256 Bacteria 2799452
118 Ga0209759_1000752 3300025256 Bacteria 27992
119 Ga0209759_1001132 3300025256 Bacteria 17105
120 Ga0209759_1011774 3300025256 Bacteria 2464
121 Ga0209129_1002545 3300025258 Bacteria 8823
122 Ga0209233_1000025 3300025261 Bacteria 683764
123 Ga0209565_1000042 3300025263 Bacteria 239712
124 Ga0209455_1000128 3300025272 Bacteria 162413
125 Ga0209673_1000071 3300025273 Bacteria 239966
126 Ga0209673_1001220 3300025273 Bacteria 27195
127 Ga0209673_1008072 3300025273 Bacteria 4736
128 Ga0209675_1000041 3300025291 Bacteria 239712
129 Ga0209676_1000434 3300025292 Bacteria 72286
130 Ga0209025_1000029 3300025294 Bacteria 488571
131 Ga0209025_1000174 3300025294 Bacteria 158915
132 Ga0209025_1020778 3300025294 Bacteria 3568
133 Ga0209025_1023408 3300025294 Bacteria 3228
134 Ga0209564_1078407 3300025295 Bacteria 655
135 Ga0209050_1000783 3300025298 Bacteria 45279
136 Ga0209256_1014718 3300025299 Bacteria 2790
137 Ga0209256_1024992 3300025299 Bacteria 1749
138 Ga0209256_1046101 3300025299 Bacteria 1079
139 Ga0209051_1000128 3300025303 Bacteria 142159
140 Ga0209051_1000174 3300025303 Bacteria 116896
141 Ga0209051_1006169 3300025303 Bacteria 6807
142 Ga0209051_1012193 3300025303 Bacteria 4170
143 Ga0209051_1021746 3300025303 Bacteria 2719
144 Ga0209257_1007035 3300025304 Bacteria 6969
145 Ga0209257_1043789 3300025304 Bacteria 1310
146 Ga0207696_1003166 3300025711 Bacteria 7635
147 Ga0207655_1000083 3300025728 Bacteria 213295
148 Ga0207655_1000432 3300025728 Bacteria 56332
149 Ga0207655_1008146 3300025728 Bacteria 6699
150 Ga0207655_1010665 3300025728 Bacteria 5555
151 Ga0207655_1043077 3300025728 Bacteria 1914
152 Ga0207713_1000551 3300025735 Bacteria 37432
153 Ga0207713_1000698 3300025735 Bacteria 31417
154 Ga0207705_10091942 3300025909 Bacteria 2223
155 Ga0207705_10188792 3300025909 Bacteria 1557
156 Ga0207705_10622366 3300025909 Bacteria 839
157 Ga0207695_11634889 3300025913 Bacteria 525
158 Ga0207657_10036670 3300025919 Bacteria 4387
159 Ga0207649_11232631 3300025920 Bacteria 591
160 Ga0207690_10104283 3300025932 Bacteria 2031
161 Ga0207690_10636404 3300025932 Bacteria 873
162 Ga0207706_10040427 3300025933 Bacteria 4133
163 Ga0207709_10000014 3300025935 Bacteria 526302
164 Ga0207709_10000242 3300025935 Bacteria 67423
165 Ga0207709_10005811 3300025935 Bacteria 6972
166 Ga0207709_10148530 3300025935 Bacteria 1620
167 Ga0207704_10667232 3300025938 Bacteria 858
168 Ga0207667_10168974 3300025949 Bacteria 2248
169 Ga0207667_10394764 3300025949 Bacteria 1409
170 Ga0207667_11063566 3300025949 Bacteria 794
171 Ga0207651_10133226 3300025960 Bacteria 1906
172 Ga0207658_10136006 3300025986 Bacteria 1982
173 Ga0207677_10977933 3300026023 Bacteria 766
174 Ga0207639_11808065 3300026041 Bacteria 572
175 Ga0207648_12283344 3300026089 Bacteria 501
176 Ga0207698_10207069 3300026142 Bacteria 1762
177 Ga0209281_1015729 3300027111 Bacteria 1570
178 Ga0209970_1000621 3300027614 Bacteria 6141
179 Ga0209282_1001255 3300027666 Bacteria 13745
180 Ga0209813_10149230 3300027866 Bacteria 836
181 Ga0209974_10045148 3300027876 Bacteria 1471
182 Ga0268265_10499994 3300028380 Bacteria 1145
183 Ga0265336_10000008 3300028666 Bacteria 336082
184 Ga0307515_10081373 3300028794 Bacteria 4208
185 Ga0265324_10020068 3300029957 Bacteria 2405
186 Ga0265327_10000085 3300031251 Bacteria 203068
187 Ga0265327_10473042 3300031251 Bacteria 541
188 Ga0307513_10000113 3300031456 Bacteria 114576
189 Ga0307513_10228533 3300031456 Bacteria 1675
190 Ga0307509_10264843 3300031507 Bacteria 1491
191 Ga0307408_100000095 3300031548 Bacteria 97142
192 Ga0307408_100001479 3300031548 Bacteria 17438
193 Ga0307408_100033800 3300031548 Bacteria 3576
194 Ga0307408_100411023 3300031548 Bacteria 1164
195 Ga0307514_10001347 3300031649 Bacteria 31156
196 Ga0307514_10002374 3300031649 Bacteria 19732
197 Ga0307516_10002207 3300031730 Bacteria 26364
198 Ga0307405_10027210 3300031731 Bacteria 3312
199 Ga0307406_10000416 3300031901 Bacteria 24765
200 Ga0307406_10005909 3300031901 Bacteria 6714
201 Ga0307407_10714736 3300031903 Bacteria 756
202 Ga0307412_10185508 3300031911 Bacteria 1568
203 Ga0307416_100069586 3300032002 Bacteria 2913
204 Ga0307416_101628393 3300032002 Bacteria 751
205 Ga0307416_102059199 3300032002 Bacteria 673
206 Ga0373931_0021168 3300035691 Bacteria 3261
207 Ga0237819_01124 3300038705 Bacteria 7786
208 Ga0439461_0111790 3300041410 Bacteria 675
209 Ga0451789_0408296 3300041443 Bacteria 894
210 Ga0451791_1809961 3300041451 Bacteria 749
211 Ga0451793_0139614 3300041452 Bacteria 559
212 Ga0451793_0140803 3300041452 Bacteria 878
213 Ga0451807_1749711 3300041486 Bacteria 555
214 Ga0451837_0636074 3300041494 Bacteria 693
215 Ga0451843_1748445 3300041509 Bacteria 508
216 Ga0439445_0114956 3300042004 Bacteria 770
217 Ga0450911_000107 3300042115 Bacteria 34252
218 Ga0450919_004569 3300042121 Bacteria 1688
219 Ga0450920_057299 3300042122 Bacteria 785
220 Ga0450890_079653 3300042127 Bacteria 533
221 Ga0439434_0160684 3300042435 Bacteria 746
222 Ga0450916_037881 3300042530 Bacteria 725
223 Ga0450918_000149 3300042531 Bacteria 15335
224 Ga0450901_001068 3300042533 Bacteria 3180
225 Ga0451577_0040016 3300042876 Bacteria 4209
226 Ga0451577_0639133 3300042876 Bacteria 965
227 Ga0466969_0033535 3300044656 Bacteria 2606
228 Ga0453683_0008646 3300044673 Bacteria 6828
229 Ga0466965_0002973 3300044683 Bacteria 7345
230 Ga0466965_0391847 3300044683 Bacteria 766
231 Ga0466966_0001207 3300044684 Bacteria 16577
232 Ga0466961_0671062 3300044693 Bacteria 621
233 Ga0466961_0798115 3300044693 Bacteria 563
234 Ga0466963_0031744 3300044694 Bacteria 3416
235 Ga0466964_0001075 3300044706 Bacteria 9139
236 Ga0453684_0032248 3300044712 Bacteria 7338
237 Ga0466971_0015245 3300044719 Bacteria 3382
238 Ga0466968_0021580 3300044735 Bacteria 2609
239 Ga0466968_0527277 3300044735 Bacteria 591
240 Ga0466970_0033246 3300044765 Bacteria 2726
241 Ga0466957_0056231 3300044842 Bacteria 2405
242 Ga0466957_0065553 3300044842 Bacteria 2237
243 Ga0466959_0002935 3300045049 Bacteria 11001
244 Ga0451576_0010225 3300045051 Bacteria 10787
245 Ga0451576_0096340 3300045051 Bacteria 3078
246 Ga0466967_0583280 3300045976 Bacteria 1102
247 Ga0495627_000058 3300046453 Bacteria 143802
248 Ga0495591_040057 3300046458 Bacteria 1338
249 Ga0495638_0015482 3300046460 Bacteria 5119
250 Ga0495638_0071155 3300046460 Bacteria 2128
251 Ga0495651_0211803 3300046462 Bacteria 1348
252 Ga0495651_0671769 3300046462 Bacteria 648
253 Ga0495650_0065254 3300046471 Bacteria 1445
254 Ga0495605_0000017 3300046474 Bacteria 273775
255 Ga0495605_0000637 3300046474 Bacteria 26949
256 Ga0495605_0000644 3300046474 Bacteria 26743
257 Ga0495605_0035398 3300046474 Bacteria 2523
258 Ga0495639_0009102 3300046475 Bacteria 4257
259 Ga0495585_0006402 3300046492 Bacteria 7312
260 Ga0495585_0037990 3300046492 Bacteria 2711
261 Ga0495607_0000022 3300046501 Bacteria 162516
262 Ga0495607_0000309 3300046501 Bacteria 50842
263 Ga0495607_0000594 3300046501 Bacteria 35287
264 Ga0495607_0003863 3300046501 Bacteria 11286
265 Ga0495607_0006488 3300046501 Bacteria 8227
266 Ga0495607_0185993 3300046501 Bacteria 1038
267 Ga0495607_0234401 3300046501 Bacteria 891
268 Ga0495607_0243255 3300046501 Bacteria 869
269 Ga0495607_0367143 3300046501 Bacteria 661
270 Ga0495583_0007320 3300046506 Bacteria 6967
271 Ga0495606_0000343 3300046507 Bacteria 79977
272 Ga0495606_0067428 3300046507 Bacteria 2266
273 Ga0495606_0079910 3300046507 Bacteria 2036
274 Ga0495606_0380751 3300046507 Bacteria 740
275 Ga0495610_0033124 3300046512 Bacteria 2674
276 Ga0495610_0160019 3300046512 Bacteria 952
277 Ga0495616_0000919 3300046513 Bacteria 21169
278 Ga0495616_0020145 3300046513 Bacteria 3633
279 Ga0495616_0215456 3300046513 Bacteria 838
280 Ga0495620_0000105 3300046515 Bacteria 67077
281 Ga0495620_0000377 3300046515 Bacteria 30539
282 Ga0495620_0051737 3300046515 Bacteria 1747
283 Ga0495620_0248961 3300046515 Bacteria 677
284 Ga0495631_0000242 3300046518 Bacteria 37711
285 Ga0495632_0001855 3300046519 Bacteria 16991
286 Ga0495632_0051084 3300046519 Bacteria 2036
287 Ga0495637_0000050 3300046520 Bacteria 101502
288 Ga0495637_0000267 3300046520 Bacteria 41093
289 Ga0495637_0007847 3300046520 Bacteria 5266
290 Ga0495637_0042327 3300046520 Bacteria 1949
291 Ga0495637_0108766 3300046520 Bacteria 1076
292 Ga0495648_0008028 3300046524 Bacteria 8356
293 Ga0495652_0110426 3300046529 Bacteria 2212
294 Ga0495654_0019026 3300046530 Bacteria 3594
295 Ga0495654_0040437 3300046530 Bacteria 2324
296 Ga0495654_0103703 3300046530 Bacteria 1306
297 Ga0495654_0117863 3300046530 Bacteria 1204
298 Ga0495654_0296296 3300046530 Bacteria 661
299 Ga0495654_0299552 3300046530 Bacteria 657
300 Ga0495654_0324674 3300046530 Bacteria 624
301 Ga0495654_0353515 3300046530 Bacteria 590
302 Ga0495587_0249126 3300046536 Bacteria 999
303 Ga0495609_0000104 3300046538 Bacteria 98657
304 Ga0495609_0037708 3300046538 Bacteria 2180
305 Ga0495621_0035667 3300046539 Bacteria 1723
306 Ga0495597_0071107 3300046542 Bacteria 1499
307 Ga0495597_0147994 3300046542 Bacteria 965
308 Ga0495597_0223401 3300046542 Bacteria 747
309 Ga0495645_0184757 3300046543 Bacteria 1425
310 Ga0495668_0008272 3300046616 Bacteria 6517
311 Ga0495668_0309180 3300046616 Bacteria 867
312 Ga0495611_0000276 3300046648 Bacteria 35066
313 Ga0495625_0000224 3300046660 Bacteria 89521
314 Ga0495625_0236479 3300046660 Bacteria 1191
315 Ga0495625_0633358 3300046660 Bacteria 638
316 Ga0495625_0690882 3300046660 Bacteria 604
317 Ga0495661_0001358 3300046665 Bacteria 20680
318 Ga0495661_0092616 3300046665 Bacteria 1717
319 Ga0495661_0276248 3300046665 Bacteria 848
320 Ga0495588_0012903 3300046674 Bacteria 3964
321 Ga0495588_0137601 3300046674 Bacteria 1289
322 Ga0495599_0351310 3300046678 Bacteria 884
323 Ga0495658_0029185 3300046683 Bacteria 2983
324 Ga0495624_0285649 3300046690 Bacteria 996
325 Ga0495671_0003518 3300046692 Bacteria 9589
326 Ga0495671_0349057 3300046692 Bacteria 709
327 Ga0495649_0145759 3300046694 Bacteria 1245
328 Ga0495649_0248452 3300046694 Bacteria 914
329 Ga0495600_0741458 3300046809 Bacteria 588
330 Ga0495660_0000461 3300046810 Bacteria 33748
331 Ga0495660_0007116 3300046810 Bacteria 6591
332 Ga0495660_0493415 3300046810 Bacteria 524
333 Ga0495581_0733512 3300047315 Bacteria 569
334 Ga0495672_0020797 3300047320 Bacteria 4292
335 Ga0495672_0039621 3300047320 Bacteria 2864
336 Ga0495676_0000043 3300047321 Bacteria 103066
337 Ga0495676_0538976 3300047321 Bacteria 763
338 Ga0495680_0016081 3300047322 Bacteria 6432
339 Ga0495683_0017825 3300047323 Bacteria 3676
340 Ga0495683_0345309 3300047323 Bacteria 629
341 Ga0495677_0084638 3300047445 Bacteria 1191
342 Ga0495673_0000211 3300047469 Bacteria 87639
343 Ga0495673_0000702 3300047469 Bacteria 32531
344 Ga0495673_0002359 3300047469 Bacteria 13406
345 Ga0495673_0004117 3300047469 Bacteria 9217
346 Ga0495673_0012556 3300047469 Bacteria 4484
347 Ga0495681_0006730 3300047470 Bacteria 7498
348 Ga0495593_0004969 3300047673 Bacteria 7877
349 Ga0495614_0034408 3300048089 Bacteria 2178
350 Ga0496102_0255120 3300048905 Bacteria 1653
351 Ga0496103_0251511 3300048906 Bacteria 1137
352 Ga0496108_1761076 3300048911 Bacteria 508
353 Ga0496110_0190254 3300048913 Bacteria 1864
354 Ga0496110_0609589 3300048913 Bacteria 990
355 Ga0496111_0311365 3300048914 Bacteria 1167
356 Ga0496112_0803817 3300048915 Bacteria 865
357 Ga0496113_0116646 3300048916 Bacteria 2084
358 Ga0496113_0826425 3300048916 Bacteria 735
359 Ga0496114_0821856 3300048917 Bacteria 809
360 Ga0496116_0206819 3300048919 Bacteria 1021
361 Ga0496117_0186697 3300048920 Bacteria 1185
362 Ga0496117_0247028 3300048920 Bacteria 976
363 Ga0496117_0608032 3300048920 Bacteria 510
364 Ga0496118_0044021 3300048921 Bacteria 3500
365 Ga0496121_0001896 3300048924 Bacteria 33498
366 Ga0496121_0008101 3300048924 Bacteria 12499
367 Ga0496121_0012358 3300048924 Bacteria 9334
368 Ga0496121_0627468 3300048924 Bacteria 658
369 Ga0496122_0021966 3300048925 Bacteria 5688
370 Ga0496122_0176243 3300048925 Bacteria 1281
371 Ga0496122_0209079 3300048925 Bacteria 1132
372 Ga0496123_0032241 3300048926 Bacteria 3798
373 Ga0496123_0045829 3300048926 Bacteria 2974
374 Ga0496124_0000007 3300048927 Bacteria 883534
375 Ga0496124_0000229 3300048927 Bacteria 109277
376 Ga0496124_0001793 3300048927 Bacteria 29861
377 Ga0496124_0012520 3300048927 Bacteria 8366
378 Ga0496124_0811595 3300048927 Bacteria 578
379 Ga0496125_0001361 3300048928 Bacteria 36000
380 Ga0496125_0140244 3300048928 Bacteria 1682
381 Ga0496125_0277661 3300048928 Bacteria 1040
382 Ga0496125_0456183 3300048928 Bacteria 731
383 Ga0495678_000201 3300049459 Bacteria 70179
384 Ga0495682_0000272 3300049460 Bacteria 40618
385 Ga0501238_016652 3300049671 Bacteria 1020
386 Ga0501266_000359 3300049763 Bacteria 6064
387 nmdc:mga03683_156013_c1 3300050489 Bacteria 701
388 nmdc:mga03683_424_c1 3300050489 Bacteria 12206
389 nmdc:mga03n38_835197_c1 3300050490 Bacteria 538
390 nmdc:mga00v17_2000_c1 3300050491 Bacteria 10515
391 nmdc:mga00v17_208857_c1 3300050491 Bacteria 1263
392 nmdc:mga00v17_488535_c1 3300050491 Bacteria 798
393 nmdc:mga00v17_610636_c1 3300050491 Bacteria 703
394 nmdc:mga0k408_52596_c1 3300050493 Bacteria 2361
395 nmdc:mga0k408_570177_c1 3300050493 Bacteria 668
396 nmdc:mga0k408_79716_c1 3300050493 Bacteria 1916
397 nmdc:mga06z11_18907_c1 3300050494 Bacteria 3156
398 nmdc:mga06z11_734683_c1 3300050494 Bacteria 601
399 nmdc:mga04h51_294141_c1 3300050495 Bacteria 660
400 nmdc:mga07m45_13281_c1 3300050496 Bacteria 4367
401 nmdc:mga07m45_18740_c1 3300050496 Bacteria 3743
402 nmdc:mga07m45_34207_c1 3300050496 Bacteria 2824
403 nmdc:mga07m45_34984_c1 3300050496 Bacteria 2793
404 nmdc:mga07m45_457734_c1 3300050496 Bacteria 740
405 nmdc:mga0sz30_168834_c1 3300050516 Bacteria 970
406 nmdc:mga0sz30_186652_c2 3300050516 Bacteria 570
407 nmdc:mga0sz30_29930_c1 3300050516 Bacteria 2247
408 Ga0500610_0000764 3300053079 Bacteria 10101
409 Ga0500610_0001126 3300053079 Bacteria 8805
410 Ga0500610_0047171 3300053079 Bacteria 2238
411 Ga0500635_0000003 3300053080 Bacteria 216927
412 Ga0500578_0000489 3300053086 Bacteria 48205
413 Ga0500578_0501377 3300053086 Bacteria 683
414 Ga0500643_003916 3300053087 Bacteria 6911
415 Ga0500644_0050561 3300053088 Bacteria 1423
416 Ga0500581_302898 3300053089 Bacteria 635
417 Ga0500646_0023786 3300053090 Bacteria 1645
418 Ga0500646_0027601 3300053090 Bacteria 1546
419 Ga0500651_0000099 3300053093 Bacteria 53568
420 Ga0500651_0021571 3300053093 Bacteria 4017
421 Ga0500651_0092055 3300053093 Bacteria 1865
422 Ga0500566_0256519 3300053094 Bacteria 847
423 Ga0500641_0358595 3300053096 Bacteria 584
424 Ga0500650_0062119 3300053098 Bacteria 1745
425 Ga0500650_0077550 3300053098 Bacteria 1553
426 Ga0500555_142214 3300053103 Bacteria 591
427 Ga0500557_224433 3300053105 Bacteria 596
428 Ga0500562_015310 3300053108 Bacteria 1966
429 Ga0500562_088270 3300053108 Bacteria 841
430 Ga0500569_168625 3300053109 Bacteria 742
431 Ga0500569_241558 3300053109 Bacteria 613
432 Ga0500571_000006 3300053110 Bacteria 105538
433 Ga0500572_144483 3300053111 Bacteria 776
434 Ga0500592_017962 3300053116 Bacteria 1135
435 Ga0500593_000094 3300053117 Bacteria 33196
436 Ga0500593_001559 3300053117 Bacteria 8244
437 Ga0500593_004378 3300053117 Bacteria 5460
438 Ga0500594_0057462 3300053118 Bacteria 1112
439 Ga0500597_073217 3300053120 Bacteria 1482
440 Ga0500608_008720 3300053122 Bacteria 4276
441 Ga0500623_067171 3300053127 Bacteria 1751
442 Ga0500626_016530 3300053128 Bacteria 3231
443 Ga0500628_001277 3300053129 Bacteria 4357
444 Ga0500642_0010101 3300053130 Bacteria 3314
445 Ga0500652_001765 3300053131 Bacteria 6559
446 Ga0500652_322077 3300053131 Bacteria 592
447 Ga0500655_000056 3300053133 Bacteria 30742
448 Ga0500658_0000091 3300053134 Bacteria 41865
449 Ga0500658_0000546 3300053134 Bacteria 15824
450 Ga0500559_0006383 3300053136 Bacteria 5325
451 Ga0500559_0008166 3300053136 Bacteria 4603
452 Ga0500564_013014 3300053138 Bacteria 3715
453 Ga0500564_126908 3300053138 Bacteria 1107
454 Ga0500568_0001840 3300053139 Bacteria 13074
455 Ga0500568_0032575 3300053139 Bacteria 2142
456 Ga0500568_0153480 3300053139 Bacteria 851
457 Ga0500573_0003269 3300053140 Bacteria 8357
458 Ga0500574_084714 3300053141 Bacteria 937
459 Ga0500577_0176108 3300053142 Bacteria 916
460 Ga0500604_0002668 3300053151 Bacteria 4850
461 Ga0500604_0125878 3300053151 Bacteria 859
462 Ga0500616_0019407 3300053153 Bacteria 3832
463 Ga0500619_202855 3300053154 Bacteria 665
464 Ga0500622_0002046 3300053156 Bacteria 15030
465 Ga0500622_0144024 3300053156 Bacteria 1133
466 Ga0500624_142491 3300053157 Bacteria 512
467 Ga0500627_0001913 3300053158 Bacteria 5978
468 Ga0500627_0359202 3300053158 Bacteria 627
469 Ga0500633_0156177 3300053160 Bacteria 856
470 Ga0500634_0012153 3300053161 Bacteria 4474
471 Ga0500634_0113031 3300053161 Bacteria 1336
472 Ga0500638_008716 3300053162 Bacteria 4342
473 Ga0500636_0181112 3300053177 Bacteria 1131
474 Ga0500567_242103 3300053723 Bacteria 546
475 Ga0500570_187268 3300053724 Bacteria 655
476 Ga0500645_000090 3300053730 Bacteria 70818
477 Ga0500596_010596 3300053735 Bacteria 1421
478 Ga0500661_001113 3300055283 Bacteria 5047
479 Ga0466962_0002841 3300061719 Bacteria 8245
480 Ga0466962_0441606 3300061719 Bacteria 655
481 2511340665 2511231018 Bacteria 6436256
482 2643971547 2643221592 Bacteria 6608788
483 2644141082 2643221625 Bacteria 6512927
484 2644244186 2643221644 Bacteria 6865017
485 2644276874 2643221648 Bacteria 6521465
486 2739242503 2738543012 Bacteria 7115078
487 2816473175 2816332133 Bacteria 7249298
488 2904545428 2904541872 Bacteria 8915136
489 Ga0157370_11696808
490 JGI25155J39150_1000200
491 JGI25156J39149_1000451
492 JGI25156J39149_1014867
493 JGI25154J39366_1000371
494 JGI25157J39369_1000479
495 JGI25151J46595_10000568
496 JGI25165J46597_1000117
497 Ga0006562J51391_1051200
498 Ga0055538_1000046
499 Ga0055539_1000065
500 Ga0055533_1000075
501 Ga0055525_1000095
502 Ga0055535_1000097
503 Ga0055529_1000202
504 Ga0055537_1000421
505 Ga0055534_1000379
506 Ga0055528_1000661
507 Ga0055528_1008253
508 Ga0055540_1000754
509 Ga0055540_1002165
510 Ga0055541_1000047
511 Ga0065165_1002894
512 Ga0065714_10166450
513 Ga0065714_10364333
514 Ga0065704_10059628
515 Ga0065704_10157960
516 Ga0070658_10027838
517 Ga0070658_10547348
518 Ga0070658_10614399
519 Ga0070666_10840771
520 Ga0070660_100504625
521 Ga0070661_100674273
522 Ga0070673_100256996
523 Ga0070659_100099662
524 Ga0070662_100267139
525 Ga0068853_100772622
526 Ga0068855_100804990
527 Ga0068855_100962375
528 Ga0068852_101066437
529 Ga0075365_10072568
530 Ga0075363_100062852
531 Ga0075363_100344936
532 Ga0075364_10005461
533 Ga0075364_10354294
534 Ga0075364_10388104
535 Ga0075364_10540157
536 Ga0075364_10748113
537 Ga0075362_10000441
538 Ga0075362_10102168
539 Ga0075362_10258387
540 Ga0075367_10042641
541 Ga0075367_10126113
542 Ga0075367_11131129
543 Ga0075369_10018889
544 Ga0075369_10075775
545 Ga0075366_10007581
546 Ga0075366_10036279
547 Ga0075370_10007919
548 Ga0075370_10011567
549 Ga0075370_10056851
550 Ga0068865_101048998
551 Ga0079104_1026020
552 Ga0105251_10014478
553 Ga0105251_10060938
554 Ga0105244_10015538
555 Ga0105244_10016277
556 Ga0105244_10051708
557 Ga0105240_10733863
558 Ga0105243_10000099
559 Ga0105243_10002736
560 Ga0105243_10010523
561 Ga0105243_10036139
562 Ga0105246_10381160
563 Ga0105246_10434897
564 Ga0105246_10563400
565 Ga0157347_1002606
566 Ga0157347_1074313
567 Ga0157373_10003398
568 Ga0157370_10019708
569 Ga0157370_10031281
570 Ga0157370_10990998
571 Ga0157370_11014340
572 Ga0157369_10274606
573 Ga0157369_11646587
574 Ga0157369_12164120
575 Ga0157374_10552040
576 Ga0182008_10000332
577 Ga0182008_10027471
578 Ga0182008_10055218
579 Ga0182006_1007168
580 Ga0182006_1018832
581 Ga0182006_1083911
582 Ga0182006_1103153
583 Ga0182007_10118065
584 Ga0182007_10201944
585 Ga0182007_10209787
586 Ga0182005_1077910
587 Ga0183362_10006
588 Ga0163161_10001155
589 Ga0163161_10210170
590 Ga0209435_100002
591 Ga0209784_100010
592 Ga0209566_100008
593 Ga0209674_100019
594 Ga0209563_100021
595 Ga0207427_100688
596 Ga0209437_100019
597 Ga0209258_100162
598 Ga0207425_1003817
599 Ga0209646_1000001
600 Ga0209026_1000001
601 Ga0209026_1015204
602 Ga0209677_100011
603 Ga0209677_103035
604 Ga0209148_1010210
605 Ga0209759_1000001
606 Ga0209759_1000752
607 Ga0209759_1001132
608 Ga0209759_1011774
609 Ga0209129_1002545
610 Ga0209233_1000025
611 Ga0209565_1000042
612 Ga0209455_1000128
613 Ga0209673_1000071
614 Ga0209673_1001220
615 Ga0209673_1008072
616 Ga0209675_1000041
617 Ga0209676_1000434
618 Ga0209025_1000029
619 Ga0209025_1000174
620 Ga0209025_1020778
621 Ga0209025_1023408
622 Ga0209564_1078407
623 Ga0209050_1000783
624 Ga0209256_1014718
625 Ga0209256_1024992
626 Ga0209256_1046101
627 Ga0209051_1000128
628 Ga0209051_1000174
629 Ga0209051_1006169
630 Ga0209051_1012193
631 Ga0209051_1021746
632 Ga0209257_1007035
633 Ga0209257_1043789
634 Ga0207696_1003166
635 Ga0207655_1000083
636 Ga0207655_1000432
637 Ga0207655_1008146
638 Ga0207655_1010665
639 Ga0207655_1043077
640 Ga0207713_1000551
641 Ga0207713_1000698
642 Ga0207705_10091942
643 Ga0207705_10188792
644 Ga0207705_10622366
645 Ga0207695_11634889
646 Ga0207657_10036670
647 Ga0207649_11232631
648 Ga0207690_10104283
649 Ga0207690_10636404
650 Ga0207706_10040427
651 Ga0207709_10000014
652 Ga0207709_10000242
653 Ga0207709_10005811
654 Ga0207709_10148530
655 Ga0207704_10667232
656 Ga0207667_10168974
657 Ga0207667_10394764
658 Ga0207667_11063566
659 Ga0207651_10133226
660 Ga0207658_10136006
661 Ga0207677_10977933
662 Ga0207639_11808065
663 Ga0207648_12283344
664 Ga0207698_10207069
665 Ga0209281_1015729
666 Ga0209970_1000621
667 Ga0209282_1001255
668 Ga0209813_10149230
669 Ga0209974_10045148
670 Ga0268265_10499994
671 Ga0265336_10000008
672 Ga0307515_10081373
673 Ga0265324_10020068
674 Ga0265327_10000085
675 Ga0265327_10473042
676 Ga0307513_10000113
677 Ga0307513_10228533
678 Ga0307509_10264843
679 Ga0307408_100000095
680 Ga0307408_100001479
681 Ga0307408_100033800
682 Ga0307408_100411023
683 Ga0307514_10001347
684 Ga0307514_10002374
685 Ga0307516_10002207
686 Ga0307405_10027210
687 Ga0307406_10000416
688 Ga0307406_10005909
689 Ga0307407_10714736
690 Ga0307412_10185508
691 Ga0307416_100069586
692 Ga0307416_101628393
693 Ga0307416_102059199
694 Ga0373931_0021168
695 Ga0237819_01124
696 Ga0439461_0111790
697 Ga0451789_0408296
698 Ga0451791_1809961
699 Ga0451793_0139614
700 Ga0451793_0140803
701 Ga0451807_1749711
702 Ga0451837_0636074
703 Ga0451843_1748445
704 Ga0439445_0114956
705 Ga0450911_000107
706 Ga0450919_004569
707 Ga0450920_057299
708 Ga0450890_079653
709 Ga0439434_0160684
710 Ga0450916_037881
711 Ga0450918_000149
712 Ga0450901_001068
713 Ga0451577_0040016
714 Ga0451577_0639133
715 Ga0466969_0033535
716 Ga0453683_0008646
717 Ga0466965_0002973
718 Ga0466965_0391847
719 Ga0466966_0001207
720 Ga0466961_0671062
721 Ga0466961_0798115
722 Ga0466963_0031744
723 Ga0466964_0001075
724 Ga0453684_0032248
725 Ga0466971_0015245
726 Ga0466968_0021580
727 Ga0466968_0527277
728 Ga0466970_0033246
729 Ga0466957_0056231
730 Ga0466957_0065553
731 Ga0466959_0002935
732 Ga0451576_0010225
733 Ga0451576_0096340
734 Ga0466967_0583280
735 Ga0495627_000058
736 Ga0495591_040057
737 Ga0495638_0015482
738 Ga0495638_0071155
739 Ga0495651_0211803
740 Ga0495651_0671769
741 Ga0495650_0065254
742 Ga0495605_0000017
743 Ga0495605_0000637
744 Ga0495605_0000644
745 Ga0495605_0035398
746 Ga0495639_0009102
747 Ga0495585_0006402
748 Ga0495585_0037990
749 Ga0495607_0000022
750 Ga0495607_0000309
751 Ga0495607_0000594
752 Ga0495607_0003863
753 Ga0495607_0006488
754 Ga0495607_0185993
755 Ga0495607_0234401
756 Ga0495607_0243255
757 Ga0495607_0367143
758 Ga0495583_0007320
759 Ga0495606_0000343
760 Ga0495606_0067428
761 Ga0495606_0079910
762 Ga0495606_0380751
763 Ga0495610_0033124
764 Ga0495610_0160019
765 Ga0495616_0000919
766 Ga0495616_0020145
767 Ga0495616_0215456
768 Ga0495620_0000105
769 Ga0495620_0000377
770 Ga0495620_0051737
771 Ga0495620_0248961
772 Ga0495631_0000242
773 Ga0495632_0001855
774 Ga0495632_0051084
775 Ga0495637_0000050
776 Ga0495637_0000267
777 Ga0495637_0007847
778 Ga0495637_0042327
779 Ga0495637_0108766
780 Ga0495648_0008028
781 Ga0495652_0110426
782 Ga0495654_0019026
783 Ga0495654_0040437
784 Ga0495654_0103703
785 Ga0495654_0117863
786 Ga0495654_0296296
787 Ga0495654_0299552
788 Ga0495654_0324674
789 Ga0495654_0353515
790 Ga0495587_0249126
791 Ga0495609_0000104
792 Ga0495609_0037708
793 Ga0495621_0035667
794 Ga0495597_0071107
795 Ga0495597_0147994
796 Ga0495597_0223401
797 Ga0495645_0184757
798 Ga0495668_0008272
799 Ga0495668_0309180
800 Ga0495611_0000276
801 Ga0495625_0000224
802 Ga0495625_0236479
803 Ga0495625_0633358
804 Ga0495625_0690882
805 Ga0495661_0001358
806 Ga0495661_0092616
807 Ga0495661_0276248
808 Ga0495588_0012903
809 Ga0495588_0137601
810 Ga0495599_0351310
811 Ga0495658_0029185
812 Ga0495624_0285649
813 Ga0495671_0003518
814 Ga0495671_0349057
815 Ga0495649_0145759
816 Ga0495649_0248452
817 Ga0495600_0741458
818 Ga0495660_0000461
819 Ga0495660_0007116
820 Ga0495660_0493415
821 Ga0495581_0733512
822 Ga0495672_0020797
823 Ga0495672_0039621
824 Ga0495676_0000043
825 Ga0495676_0538976
826 Ga0495680_0016081
827 Ga0495683_0017825
828 Ga0495683_0345309
829 Ga0495677_0084638
830 Ga0495673_0000211
831 Ga0495673_0000702
832 Ga0495673_0002359
833 Ga0495673_0004117
834 Ga0495673_0012556
835 Ga0495681_0006730
836 Ga0495593_0004969
837 Ga0495614_0034408
838 Ga0496102_0255120
839 Ga0496103_0251511
840 Ga0496108_1761076
841 Ga0496110_0190254
842 Ga0496110_0609589
843 Ga0496111_0311365
844 Ga0496112_0803817
845 Ga0496113_0116646
846 Ga0496113_0826425
847 Ga0496114_0821856
848 Ga0496116_0206819
849 Ga0496117_0186697
850 Ga0496117_0247028
851 Ga0496117_0608032
852 Ga0496118_0044021
853 Ga0496121_0001896
854 Ga0496121_0008101
855 Ga0496121_0012358
856 Ga0496121_0627468
857 Ga0496122_0021966
858 Ga0496122_0176243
859 Ga0496122_0209079
860 Ga0496123_0032241
861 Ga0496123_0045829
862 Ga0496124_0000007
863 Ga0496124_0000229
864 Ga0496124_0001793
865 Ga0496124_0012520
866 Ga0496124_0811595
867 Ga0496125_0001361
868 Ga0496125_0140244
869 Ga0496125_0277661
870 Ga0496125_0456183
871 Ga0495678_000201
872 Ga0495682_0000272
873 Ga0501238_016652
874 Ga0501266_000359
875 nmdc:mga03683_156013_c1
876 nmdc:mga03683_424_c1
877 nmdc:mga03n38_835197_c1
878 nmdc:mga00v17_2000_c1
879 nmdc:mga00v17_208857_c1
880 nmdc:mga00v17_488535_c1
881 nmdc:mga00v17_610636_c1
882 nmdc:mga0k408_52596_c1
883 nmdc:mga0k408_570177_c1
884 nmdc:mga0k408_79716_c1
885 nmdc:mga06z11_18907_c1
886 nmdc:mga06z11_734683_c1
887 nmdc:mga04h51_294141_c1
888 nmdc:mga07m45_13281_c1
889 nmdc:mga07m45_18740_c1
890 nmdc:mga07m45_34207_c1
891 nmdc:mga07m45_34984_c1
892 nmdc:mga07m45_457734_c1
893 nmdc:mga0sz30_168834_c1
894 nmdc:mga0sz30_186652_c2
895 nmdc:mga0sz30_29930_c1
896 Ga0500610_0000764
897 Ga0500610_0001126
898 Ga0500610_0047171
899 Ga0500635_0000003
900 Ga0500578_0000489
901 Ga0500578_0501377
902 Ga0500643_003916
903 Ga0500644_0050561
904 Ga0500581_302898
905 Ga0500646_0023786
906 Ga0500646_0027601
907 Ga0500651_0000099
908 Ga0500651_0021571
909 Ga0500651_0092055
910 Ga0500566_0256519
911 Ga0500641_0358595
912 Ga0500650_0062119
913 Ga0500650_0077550
914 Ga0500555_142214
915 Ga0500557_224433
916 Ga0500562_015310
917 Ga0500562_088270
918 Ga0500569_168625
919 Ga0500569_241558
920 Ga0500571_000006
921 Ga0500572_144483
922 Ga0500592_017962
923 Ga0500593_000094
924 Ga0500593_001559
925 Ga0500593_004378
926 Ga0500594_0057462
927 Ga0500597_073217
928 Ga0500608_008720
929 Ga0500623_067171
930 Ga0500626_016530
931 Ga0500628_001277
932 Ga0500642_0010101
933 Ga0500652_001765
934 Ga0500652_322077
935 Ga0500655_000056
936 Ga0500658_0000091
937 Ga0500658_0000546
938 Ga0500559_0006383
939 Ga0500559_0008166
940 Ga0500564_013014
941 Ga0500564_126908
942 Ga0500568_0001840
943 Ga0500568_0032575
944 Ga0500568_0153480
945 Ga0500573_0003269
946 Ga0500574_084714
947 Ga0500577_0176108
948 Ga0500604_0002668
949 Ga0500604_0125878
950 Ga0500616_0019407
951 Ga0500619_202855
952 Ga0500622_0002046
953 Ga0500622_0144024
954 Ga0500624_142491
955 Ga0500627_0001913
956 Ga0500627_0359202
957 Ga0500633_0156177
958 Ga0500634_0012153
959 Ga0500634_0113031
960 Ga0500638_008716
961 Ga0500636_0181112
962 Ga0500567_242103
963 Ga0500570_187268
964 Ga0500645_000090
965 Ga0500596_010596
966 Ga0500661_001113
967 Ga0466962_0002841
968 Ga0466962_0441606
969 2511340665
970 2643971547
971 2644141082
972 2644244186
973 2644276874
974 2739242503
975 2816473175
976 2904545428

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11903

ParD_like

ParD-like antitoxin of type II bacterial toxin-antitoxin system

5

77

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
6erc-assembly2.cif.gz_B peroxidase a from dictyostelium discoideum (ddpoxa) 0.8743 31 53
1wq2-assembly1.cif.gz_B neutron crystal structure of dissimilatory sulfite reductase d (dsrd) 0.8366 34 60
3olu-assembly1.cif.gz_A x-ray crystal structure of 1-arachidonoyl glycerol bound to the cyclooxygenase channel of r513h murine cox-2 0.6509 32 53
1wq2-assembly1.cif.gz_B neutron crystal structure of dissimilatory sulfite reductase d (dsrd) 0.3829 34 60
6erc-assembly2.cif.gz_B peroxidase a from dictyostelium discoideum (ddpoxa) 0.2653 31 53
ID Description Score Start End Superfamily
af_Q5A9X7_12_215_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.973 31 53 3.30.420.40
af_Q6TMK4_14_531_1.10.640.10 Mainly Alpha;Orthogonal Bundle;Myeloperoxidase, subunit C;Haem peroxidase domain superfamily, animal type 0.8853 31 53 1.10.640.10
af_Q6IQF6_129_231_1.10.238.10 Mainly Alpha;Orthogonal Bundle;Recoverin; domain 1;EF-hand 0.8213 34 60 1.10.238.10
af_Q8IKX3_745_864_3.40.50.80 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 0.7722 27 60 3.40.50.80
2jnfA02 Mainly Alpha;Orthogonal Bundle;Recoverin; domain 1;EF-hand 0.7628 34 61 1.10.238.10
ID Description Score Start End GO Terms
AF-F3LU61-F1-model_v4 deleted 0.7488 11 71
AF-A0A837ALV3-F1-model_v4 deleted 0.7415 11 74
AF-F3LU61-F1-model_v4 deleted 0.6725 11 71
AF-A0A165HZW3-F1-model_v4 ParD-like antitoxin of type II toxin-antitoxin system 0.6545 1 84
AF-A0A837ALV3-F1-model_v4 deleted 0.6542 11 74

Map