F453605

General Info

Members Datasets Scaffolds Average Seq Length
488 308 474 185

Family's Representative Sequence

Representative Sequence 3300013297|Ga0157378_10300043|Ga0157378_103000431
Length 185
Sequence MPPRRRRGLSEEDRALWESVAKQVKPLRKRHRVVKPAIGSPEAESSVALRPASPKPLAPPRIIPASRPEPPPLAPIGRRERSQLSRGRKEIDARVDLHGMTQVRAHRVLLTFLQRAHGDGLTFVLVITGKGKVGGADSERGVLRRQVPQWRALPEFRSLGVGFEEAHIGHGGEGALYVRVRRVRS

Samples

Sample ID Description Type Environment
1 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
2 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
3 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
4 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
5 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
6 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
7 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
8 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
9 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
10 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
11 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
12 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
13 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
14 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
27 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
28 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
31 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
32 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
33 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
37 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
38 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
45 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
64 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
69 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
70 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
71 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
72 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
73 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
74 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
75 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
76 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
77 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
78 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
79 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
81 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
82 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
83 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
84 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
85 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
86 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
88 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
89 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
90 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
91 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
92 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
94 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
95 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
97 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
98 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
99 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
100 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
101 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
102 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
103 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
104 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
105 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
106 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
107 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
108 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
109 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
110 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
111 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
112 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
113 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
114 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
115 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
116 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
117 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
166 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
169 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
170 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
171 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
172 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
173 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
174 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
175 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
176 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
177 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
178 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
179 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
180 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
181 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
182 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
183 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
184 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
185 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
186 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
187 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
188 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
189 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
190 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
191 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
192 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
193 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
194 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
195 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
196 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
197 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
198 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
199 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
200 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
201 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
202 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
203 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
204 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
205 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
206 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
207 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
208 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
209 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
210 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
211 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
212 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
213 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
214 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
215 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
216 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
217 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
218 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
219 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
220 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
221 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
222 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
223 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
224 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
225 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
226 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
227 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
228 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
229 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
230 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
231 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
232 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
233 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
234 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
235 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
236 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
237 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
238 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
239 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
240 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
241 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
242 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
243 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
244 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
245 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
246 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
247 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
248 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
249 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
250 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
251 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
252 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
253 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
254 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
255 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
256 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
257 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
259 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
260 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
261 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
262 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
263 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
264 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
265 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
266 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
267 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
268 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
269 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
270 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
271 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
272 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
273 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
274 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
275 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
276 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
277 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
278 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
279 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
280 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
281 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
282 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
283 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
284 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
285 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
286 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
287 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
288 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
289 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
290 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
291 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
292 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
293 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
294 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
295 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
296 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
297 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
298 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
299 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
300 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
301 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
302 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
303 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
304 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
305 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
306 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
307 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
308 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.33
Metatranscriptomes 0
Isolates 2.67

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.09
Nodule 2.05
Rhizoplane 5.53
Rhizosphere 76.02
Stem 0
Stem Tuber 0
Unclassified 4.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10011431 3300001979 Bacteria 3380
2 JGI24737J22298_10004677 3300001990 Bacteria 4762
3 JGI25153J46596_10002154 3300003215 Bacteria 11522
4 rootL2_10276346 3300003322 Bacteria 1350
5 JGI25405J52794_10017838 3300003911 Bacteria 1414
6 Ga0070658_10103088 3300005327 Bacteria 2360
7 Ga0070676_10048724 3300005328 Bacteria 2477
8 Ga0070683_100033682 3300005329 Bacteria 4672
9 Ga0070690_100072006 3300005330 Bacteria 2246
10 Ga0070690_100076091 3300005330 Bacteria 2189
11 Ga0070690_100558767 3300005330 Bacteria 864
12 Ga0070670_100275077 3300005331 Bacteria 1470
13 Ga0070670_100346957 3300005331 Bacteria 1303
14 Ga0068869_100146032 3300005334 Bacteria 1831
15 Ga0070666_10194547 3300005335 Bacteria 1426
16 Ga0070680_100233288 3300005336 Bacteria 1554
17 Ga0070682_100152780 3300005337 Bacteria 1586
18 Ga0068868_100073327 3300005338 Bacteria 2733
19 Ga0068868_100087203 3300005338 Bacteria 2510
20 Ga0068868_100210208 3300005338 Bacteria 1626
21 Ga0070660_100196631 3300005339 Bacteria 1635
22 Ga0070660_100393644 3300005339 Bacteria 1145
23 Ga0070689_100188208 3300005340 Bacteria 1680
24 Ga0070691_10217059 3300005341 Bacteria 1012
25 Ga0070687_100185719 3300005343 Bacteria 1249
26 Ga0070668_100012183 3300005347 Bacteria 6404
27 Ga0070668_100065341 3300005347 Bacteria 2822
28 Ga0070668_100398625 3300005347 Bacteria 1174
29 Ga0070669_100297810 3300005353 Bacteria 1297
30 Ga0070675_100240544 3300005354 Bacteria 1582
31 Ga0070675_100647018 3300005354 Bacteria 961
32 Ga0070674_100102606 3300005356 Bacteria 2086
33 Ga0070673_100245685 3300005364 Bacteria 1558
34 Ga0070659_100431903 3300005366 Bacteria 1115
35 Ga0070659_100906084 3300005366 Bacteria 771
36 Ga0070667_100071178 3300005367 Bacteria 2961
37 Ga0070667_100239191 3300005367 Bacteria 1621
38 Ga0070713_100151163 3300005436 Bacteria 2066
39 Ga0070710_10022058 3300005437 Bacteria 3327
40 Ga0070711_100063995 3300005439 Bacteria 2569
41 Ga0070663_100016778 3300005455 Bacteria 4765
42 Ga0070663_100318213 3300005455 Bacteria 1250
43 Ga0070678_100093668 3300005456 Bacteria 2310
44 Ga0070678_100204261 3300005456 Bacteria 1633
45 Ga0070678_100764768 3300005456 Bacteria 875
46 Ga0070662_100042885 3300005457 Bacteria 3233
47 Ga0070662_100136091 3300005457 Bacteria 1900
48 Ga0070662_100934945 3300005457 Bacteria 741
49 Ga0070681_10849517 3300005458 Bacteria 831
50 Ga0068867_100109824 3300005459 Bacteria 2118
51 Ga0070685_10051354 3300005466 Bacteria 2384
52 Ga0070707_100082155 3300005468 Bacteria 3111
53 Ga0070679_100044780 3300005530 Bacteria 4408
54 Ga0070684_100012430 3300005535 Bacteria 6823
55 Ga0070684_100306996 3300005535 Bacteria 1457
56 Ga0068853_100104000 3300005539 Bacteria 2514
57 Ga0068853_100129246 3300005539 Bacteria 2260
58 Ga0068853_100159652 3300005539 Bacteria 2033
59 Ga0068853_100434545 3300005539 Bacteria 1233
60 Ga0070672_100348617 3300005543 Bacteria 1262
61 Ga0070672_100366873 3300005543 Bacteria 1230
62 Ga0070686_100233782 3300005544 Bacteria 1335
63 Ga0070665_100022177 3300005548 Bacteria 6388
64 Ga0070665_100035947 3300005548 Bacteria 4983
65 Ga0070665_100094751 3300005548 Bacteria 2990
66 Ga0070665_100115196 3300005548 Bacteria 2690
67 Ga0070665_100347277 3300005548 Bacteria 1489
68 Ga0070665_100632906 3300005548 Bacteria 1083
69 Ga0070704_100429781 3300005549 Bacteria 1133
70 Ga0068855_100026374 3300005563 Bacteria 6950
71 Ga0068855_100055289 3300005563 Bacteria 4663
72 Ga0068855_100062940 3300005563 Bacteria 4330
73 Ga0068855_100074325 3300005563 Bacteria 3948
74 Ga0068855_100348936 3300005563 Bacteria 1630
75 Ga0068857_100059164 3300005577 Bacteria 3403
76 Ga0068857_100343928 3300005577 Bacteria 1380
77 Ga0068854_100003752 3300005578 Bacteria 9498
78 Ga0068854_100057756 3300005578 Bacteria 2799
79 Ga0068856_100055177 3300005614 Bacteria 3921
80 Ga0068856_100481908 3300005614 Bacteria 1261
81 Ga0070702_100012771 3300005615 Bacteria 4224
82 Ga0070702_100055804 3300005615 Bacteria 2279
83 Ga0068852_100055421 3300005616 Bacteria 3422
84 Ga0068852_100184633 3300005616 Bacteria 1963
85 Ga0068852_100932985 3300005616 Bacteria 886
86 Ga0068859_100205095 3300005617 Bacteria 2056
87 Ga0068864_100173508 3300005618 Bacteria 1967
88 Ga0068864_100222665 3300005618 Bacteria 1741
89 Ga0068866_10244039 3300005718 Bacteria 1095
90 Ga0068861_100033316 3300005719 Bacteria 3799
91 Ga0068861_100738305 3300005719 Bacteria 918
92 Ga0068851_10000408 3300005834 Bacteria 19412
93 Ga0068851_10053909 3300005834 Bacteria 2048
94 Ga0068870_10144331 3300005840 Bacteria 1396
95 Ga0068858_100076272 3300005842 Bacteria 3113
96 Ga0068858_100320732 3300005842 Bacteria 1481
97 Ga0068860_100075850 3300005843 Bacteria 3197
98 Ga0068862_100095534 3300005844 Bacteria 2593
99 Ga0068862_100617554 3300005844 Bacteria 1043
100 Ga0081455_10004129 3300005937 Bacteria 16422
101 Ga0081455_10007101 3300005937 Bacteria 11861
102 Ga0081455_10011042 3300005937 Bacteria 9097
103 Ga0081540_1005183 3300005983 Bacteria 9759
104 Ga0081540_1006399 3300005983 Bacteria 8584
105 Ga0081540_1009930 3300005983 Bacteria 6492
106 Ga0081540_1011637 3300005983 Bacteria 5867
107 Ga0081540_1014446 3300005983 Bacteria 5057
108 Ga0081540_1015921 3300005983 Bacteria 4739
109 Ga0081540_1093813 3300005983 Bacteria 1313
110 Ga0081539_10024516 3300005985 Bacteria 3910
111 Ga0081539_10099611 3300005985 Bacteria 1484
112 Ga0070717_10009120 3300006028 Bacteria 7451
113 Ga0075365_10086169 3300006038 Bacteria 2135
114 Ga0075363_100001418 3300006048 Bacteria 9077
115 Ga0075363_100024204 3300006048 Bacteria 3084
116 Ga0075363_100035377 3300006048 Bacteria 2613
117 Ga0075363_100188424 3300006048 Bacteria 1176
118 Ga0075363_100277586 3300006048 Bacteria 969
119 Ga0075364_10022004 3300006051 Bacteria 4022
120 Ga0075364_10109068 3300006051 Bacteria 1846
121 Ga0075362_10013703 3300006177 Bacteria 3252
122 Ga0075367_10037766 3300006178 Bacteria 2808
123 Ga0075367_10077526 3300006178 Bacteria 2006
124 Ga0075367_10170766 3300006178 Bacteria 1354
125 Ga0075369_10047057 3300006186 Bacteria 1859
126 Ga0075366_10067365 3300006195 Bacteria 2130
127 Ga0075366_10254910 3300006195 Bacteria 1070
128 Ga0097621_100294561 3300006237 Bacteria 1431
129 Ga0075370_10030969 3300006353 Bacteria 2985
130 Ga0075370_10038515 3300006353 Bacteria 2690
131 Ga0068871_100175062 3300006358 Bacteria 1841
132 Ga0068871_100500742 3300006358 Bacteria 1095
133 Ga0075428_100022218 3300006844 Bacteria 7024
134 Ga0075434_100251934 3300006871 Bacteria 1785
135 Ga0068865_100377886 3300006881 Bacteria 1155
136 Ga0068865_100423018 3300006881 Bacteria 1096
137 Ga0075436_100177277 3300006914 Bacteria 1506
138 Ga0097620_100205095 3300006931 Bacteria 2056
139 Ga0075435_100284264 3300007076 Bacteria 1412
140 Ga0099795_10040767 3300007788 Bacteria 1651
141 Ga0099795_10252748 3300007788 Bacteria 761
142 Ga0105244_10211006 3300009036 Bacteria 913
143 Ga0105250_10036541 3300009092 Bacteria 1971
144 Ga0105240_10019831 3300009093 Bacteria 8981
145 Ga0105240_10070563 3300009093 Bacteria 4321
146 Ga0111539_10054020 3300009094 Bacteria 4781
147 Ga0111539_10591297 3300009094 Bacteria 1292
148 Ga0105245_10208395 3300009098 Bacteria 1880
149 Ga0105245_10735091 3300009098 Bacteria 1022
150 Ga0105247_10078572 3300009101 Bacteria 2076
151 Ga0105247_10339011 3300009101 Bacteria 1054
152 Ga0105247_10505058 3300009101 Bacteria 881
153 Ga0114129_10298268 3300009147 Bacteria 2149
154 Ga0105243_10061651 3300009148 Bacteria 3000
155 Ga0105243_10553007 3300009148 Bacteria 1100
156 Ga0105243_10557773 3300009148 Bacteria 1096
157 Ga0105241_10056204 3300009174 Bacteria 3017
158 Ga0105242_10188769 3300009176 Bacteria 1823
159 Ga0105242_10331416 3300009176 Bacteria 1399
160 Ga0105248_10074328 3300009177 Bacteria 3820
161 Ga0105248_10730383 3300009177 Bacteria 1117
162 Ga0105248_10788845 3300009177 Bacteria 1072
163 Ga0105237_10456579 3300009545 Bacteria 1283
164 Ga0105237_10576029 3300009545 Bacteria 1133
165 Ga0105237_10625293 3300009545 Bacteria 1084
166 Ga0105237_11071365 3300009545 Bacteria 813
167 Ga0105238_10005518 3300009551 Bacteria 12492
168 Ga0105238_10035767 3300009551 Bacteria 5049
169 Ga0105238_10416457 3300009551 Bacteria 1338
170 Ga0105238_11390016 3300009551 Bacteria 729
171 Ga0105239_10343931 3300010375 Bacteria 1684
172 Ga0105246_10178855 3300011119 Bacteria 1631
173 Ga0105246_10732238 3300011119 Bacteria 870
174 Ga0157373_10663523 3300013100 Bacteria 762
175 Ga0157370_10123520 3300013104 Bacteria 2417
176 Ga0157374_10108347 3300013296 Bacteria 2670
177 Ga0157374_10212674 3300013296 Bacteria 1896
178 Ga0157374_10218167 3300013296 Bacteria 1871
179 Ga0157378_10184467 3300013297 Bacteria 1964
180 Ga0157378_10300043 3300013297 Bacteria 1555
181 Ga0157378_11032859 3300013297 Bacteria 857
182 Ga0157372_11070507 3300013307 Bacteria 933
183 Ga0157375_10246663 3300013308 Bacteria 1946
184 Ga0157375_11233080 3300013308 Bacteria 878
185 Ga0163163_10196731 3300014325 Bacteria 2064
186 Ga0157380_10154863 3300014326 Bacteria 1985
187 Ga0157380_10323553 3300014326 Bacteria 1431
188 Ga0157377_10287795 3300014745 Bacteria 1080
189 Ga0157379_10149234 3300014968 Bacteria 2109
190 Ga0157379_10267749 3300014968 Bacteria 1553
191 Ga0157379_10566607 3300014968 Bacteria 1058
192 Ga0157376_10152544 3300014969 Bacteria 2085
193 Ga0163161_10162422 3300017792 Bacteria 1704
194 Ga0163161_10291639 3300017792 Bacteria 1282
195 Ga0209758_1003838 3300025297 Bacteria 13189
196 Ga0209758_1007917 3300025297 Bacteria 7053
197 Ga0207697_10101856 3300025315 Bacteria 1224
198 Ga0207656_10005406 3300025321 Bacteria 4512
199 Ga0207642_10112696 3300025899 Bacteria 1388
200 Ga0207710_10101197 3300025900 Bacteria 1359
201 Ga0207688_10110029 3300025901 Bacteria 1598
202 Ga0207680_10204990 3300025903 Bacteria 1346
203 Ga0207647_10001150 3300025904 Bacteria 20374
204 Ga0207647_10362534 3300025904 Bacteria 820
205 Ga0207645_10022525 3300025907 Bacteria 4097
206 Ga0207645_10263631 3300025907 Bacteria 1142
207 Ga0207643_10079148 3300025908 Bacteria 1902
208 Ga0207654_10000058 3300025911 Bacteria 75628
209 Ga0207695_10000453 3300025913 Bacteria 89314
210 Ga0207695_10066247 3300025913 Bacteria 3710
211 Ga0207695_10131408 3300025913 Bacteria 2461
212 Ga0207671_10124157 3300025914 Bacteria 1976
213 Ga0207660_10093789 3300025917 Bacteria 2231
214 Ga0207657_10722564 3300025919 Bacteria 773
215 Ga0207652_10122654 3300025921 Bacteria 2313
216 Ga0207694_10001512 3300025924 Bacteria 19799
217 Ga0207650_10312948 3300025925 Bacteria 1285
218 Ga0207687_10116362 3300025927 Bacteria 1993
219 Ga0207687_11117439 3300025927 Bacteria 677
220 Ga0207664_10374193 3300025929 Bacteria 1264
221 Ga0207644_10198077 3300025931 Bacteria 1583
222 Ga0207690_10343839 3300025932 Bacteria 1178
223 Ga0207706_10115646 3300025933 Bacteria 2359
224 Ga0207706_10848324 3300025933 Bacteria 774
225 Ga0207709_10206402 3300025935 Bacteria 1407
226 Ga0207709_10649889 3300025935 Bacteria 839
227 Ga0207670_10009317 3300025936 Bacteria 5598
228 Ga0207669_10566818 3300025937 Bacteria 918
229 Ga0207704_10008040 3300025938 Bacteria 5018
230 Ga0207691_10097203 3300025940 Bacteria 2632
231 Ga0207711_10359394 3300025941 Bacteria 1349
232 Ga0207711_10662516 3300025941 Bacteria 974
233 Ga0207689_10056391 3300025942 Bacteria 3233
234 Ga0207689_10167637 3300025942 Bacteria 1809
235 Ga0207667_10007600 3300025949 Bacteria 12999
236 Ga0207667_10058734 3300025949 Bacteria 4032
237 Ga0207667_10466636 3300025949 Bacteria 1282
238 Ga0207667_10853950 3300025949 Bacteria 904
239 Ga0207651_10242049 3300025960 Bacteria 1471
240 Ga0207651_10622041 3300025960 Bacteria 946
241 Ga0207712_10370545 3300025961 Bacteria 1196
242 Ga0207668_10031635 3300025972 Bacteria 3487
243 Ga0207668_10335360 3300025972 Bacteria 1259
244 Ga0207640_10013128 3300025981 Bacteria 4738
245 Ga0207640_10038241 3300025981 Bacteria 3026
246 Ga0207640_10078319 3300025981 Bacteria 2249
247 Ga0207658_10635316 3300025986 Bacteria 961
248 Ga0207677_10278054 3300026023 Bacteria 1373
249 Ga0207703_10029876 3300026035 Bacteria 4303
250 Ga0207703_10197973 3300026035 Bacteria 1784
251 Ga0207703_10257829 3300026035 Bacteria 1575
252 Ga0207639_10041951 3300026041 Bacteria 3427
253 Ga0207639_10073450 3300026041 Bacteria 2681
254 Ga0207639_10090193 3300026041 Bacteria 2451
255 Ga0207639_10750501 3300026041 Bacteria 907
256 Ga0207678_10046422 3300026067 Bacteria 3756
257 Ga0207678_10061814 3300026067 Bacteria 3221
258 Ga0207678_10064888 3300026067 Bacteria 3137
259 Ga0207678_10122717 3300026067 Bacteria 2217
260 Ga0207678_10140716 3300026067 Bacteria 2059
261 Ga0207708_10081953 3300026075 Bacteria 2480
262 Ga0207708_10402323 3300026075 Bacteria 1132
263 Ga0207702_10000004 3300026078 Bacteria 422182
264 Ga0207702_10009402 3300026078 Bacteria 8209
265 Ga0207641_10126124 3300026088 Bacteria 2292
266 Ga0207641_10675132 3300026088 Bacteria 1016
267 Ga0207641_10743882 3300026088 Bacteria 968
268 Ga0207648_10023188 3300026089 Bacteria 5566
269 Ga0207648_10275971 3300026089 Bacteria 1503
270 Ga0207676_10209316 3300026095 Bacteria 1729
271 Ga0207674_10000890 3300026116 Bacteria 39065
272 Ga0207674_10012685 3300026116 Bacteria 9415
273 Ga0207674_10262464 3300026116 Bacteria 1674
274 Ga0207675_100112919 3300026118 Bacteria 2565
275 Ga0207683_10056479 3300026121 Bacteria 3443
276 Ga0207683_10059388 3300026121 Bacteria 3359
277 Ga0207683_10187778 3300026121 Bacteria 1875
278 Ga0207698_10063006 3300026142 Bacteria 2899
279 Ga0207698_10138145 3300026142 Bacteria 2094
280 Ga0209813_10024248 3300027866 Bacteria 1733
281 Ga0268266_10001190 3300028379 Bacteria 32120
282 Ga0268266_10003966 3300028379 Bacteria 14358
283 Ga0268266_10318659 3300028379 Bacteria 1455
284 Ga0268266_10504799 3300028379 Bacteria 1155
285 Ga0268264_10088565 3300028381 Bacteria 2664
286 Ga0307517_10001338 3300028786 Bacteria 41372
287 Ga0307517_10278341 3300028786 Bacteria 956
288 Ga0307511_10243079 3300030521 Bacteria 875
289 Ga0265330_10034200 3300031235 Bacteria 2271
290 Ga0265332_10055871 3300031238 Bacteria 1692
291 Ga0265328_10058220 3300031239 Bacteria 1419
292 Ga0265340_10025938 3300031247 Bacteria 2965
293 Ga0265316_10389342 3300031344 Bacteria 1005
294 Ga0307513_10292358 3300031456 Bacteria 1400
295 Ga0307509_10168707 3300031507 Bacteria 2072
296 Ga0307509_10577345 3300031507 Bacteria 799
297 Ga0307516_10219715 3300031730 Bacteria 1610
298 Ga0307405_10411947 3300031731 Bacteria 1061
299 Ga0307413_10038452 3300031824 Bacteria 2774
300 Ga0307412_10275164 3300031911 Bacteria 1319
301 Ga0307412_11208678 3300031911 Bacteria 677
302 Ga0307409_100438250 3300031995 Bacteria 1258
303 Ga0307409_100483087 3300031995 Bacteria 1202
304 Ga0307411_10130416 3300032005 Bacteria 1836
305 Ga0307415_100325089 3300032126 Bacteria 1284
306 Ga0307510_10001271 3300033180 Bacteria 27493
307 Ga0307510_10043589 3300033180 Bacteria 4875
308 Ga0373954_0058546 3300035118 Bacteria 1815
309 Ga0373927_0230191 3300035695 Bacteria 1218
310 Ga0373933_0000031 3300035724 Bacteria 85038
311 Ga0373933_0196265 3300035724 Bacteria 1291
312 Ga0373937_0046264 3300036401 Bacteria 3979
313 Ga0395899_0100188 3300037312 Bacteria 2092
314 Ga0395900_0081148 3300037418 Bacteria 3332
315 Ga0395905_0779649 3300037471 Bacteria 859
316 Ga0439448_0088874 3300042005 Bacteria 1043
317 Ga0451576_0676949 3300045051 Bacteria 1084
318 Ga0466967_0623114 3300045976 Bacteria 1066
319 Ga0495603_0015386 3300046455 Bacteria 4628
320 Ga0495603_0025650 3300046455 Bacteria 3564
321 Ga0495603_0096703 3300046455 Bacteria 1725
322 Ga0495590_0034524 3300046457 Bacteria 1766
323 Ga0495591_066054 3300046458 Bacteria 950
324 Ga0495629_0040530 3300046459 Bacteria 3276
325 Ga0495638_0080333 3300046460 Bacteria 1981
326 Ga0495641_0042320 3300046461 Bacteria 2112
327 Ga0495582_0404588 3300046473 Bacteria 787
328 Ga0495605_0104917 3300046474 Bacteria 1295
329 Ga0495584_0039800 3300046491 Bacteria 2375
330 Ga0495585_0059225 3300046492 Bacteria 2111
331 Ga0495585_0099602 3300046492 Bacteria 1555
332 Ga0495594_0072086 3300046499 Bacteria 1921
333 Ga0495594_0397479 3300046499 Bacteria 784
334 Ga0495583_0034391 3300046506 Bacteria 2428
335 Ga0495606_0157649 3300046507 Bacteria 1327
336 Ga0495606_0363226 3300046507 Bacteria 765
337 Ga0495606_0456612 3300046507 Bacteria 653
338 Ga0495620_0082385 3300046515 Bacteria 1300
339 Ga0495620_0090121 3300046515 Bacteria 1231
340 Ga0495632_0090373 3300046519 Bacteria 1452
341 Ga0495632_0139354 3300046519 Bacteria 1126
342 Ga0495632_0307106 3300046519 Bacteria 702
343 Ga0495644_0055137 3300046523 Bacteria 1493
344 Ga0495644_0084592 3300046523 Bacteria 1196
345 Ga0495663_0113672 3300046525 Bacteria 901
346 Ga0495666_0055322 3300046526 Bacteria 1902
347 Ga0495642_0058689 3300046528 Bacteria 1594
348 Ga0495598_0023245 3300046537 Bacteria 1667
349 Ga0495621_0037585 3300046539 Bacteria 1684
350 Ga0495622_0016497 3300046557 Bacteria 3440
351 Ga0495633_0023633 3300046558 Bacteria 3043
352 Ga0495633_0230315 3300046558 Bacteria 847
353 Ga0495656_0010968 3300046615 Bacteria 3313
354 Ga0495656_0033230 3300046615 Bacteria 2104
355 Ga0495656_0139185 3300046615 Bacteria 1162
356 Ga0495611_0028936 3300046648 Bacteria 2428
357 Ga0495625_0327531 3300046660 Bacteria 974
358 Ga0495625_0422690 3300046660 Bacteria 828
359 Ga0495659_0011528 3300046664 Bacteria 2848
360 Ga0495659_0011645 3300046664 Bacteria 2834
361 Ga0495659_0024645 3300046664 Bacteria 2053
362 Ga0495661_0139551 3300046665 Bacteria 1320
363 Ga0495588_0015061 3300046674 Bacteria 3714
364 Ga0495658_0206415 3300046683 Bacteria 1226
365 Ga0495669_0023468 3300046684 Bacteria 2685
366 Ga0495670_0021268 3300046691 Bacteria 3199
367 Ga0495671_0139525 3300046692 Bacteria 1181
368 Ga0495589_0075529 3300046794 Bacteria 1643
369 Ga0495636_0047517 3300047318 Bacteria 1792
370 Ga0495672_0037014 3300047320 Bacteria 2990
371 Ga0495676_0213437 3300047321 Bacteria 1334
372 Ga0495683_0128992 3300047323 Bacteria 1194
373 Ga0495677_0034964 3300047445 Bacteria 1834
374 Ga0495679_040427 3300047446 Bacteria 1450
375 Ga0495681_0109677 3300047470 Bacteria 1197
376 Ga0495593_0195138 3300047673 Bacteria 1018
377 Ga0495615_0039525 3300048090 Bacteria 1171
378 Ga0496100_0401208 3300048903 Bacteria 1044
379 Ga0496101_0100995 3300048904 Bacteria 2159
380 Ga0496102_0182181 3300048905 Bacteria 1979
381 Ga0496102_0223362 3300048905 Bacteria 1776
382 Ga0496102_0262686 3300048905 Bacteria 1628
383 Ga0496102_0510473 3300048905 Bacteria 1124
384 Ga0496103_0344186 3300048906 Bacteria 959
385 Ga0496104_0152979 3300048907 Bacteria 2214
386 Ga0496104_0221400 3300048907 Bacteria 1805
387 Ga0496106_0101788 3300048909 Bacteria 2228
388 Ga0496106_0192399 3300048909 Bacteria 1622
389 Ga0496106_0461618 3300048909 Bacteria 1020
390 Ga0496107_0048005 3300048910 Bacteria 3075
391 Ga0496107_0149528 3300048910 Bacteria 1727
392 Ga0496108_0116469 3300048911 Bacteria 2289
393 Ga0496109_0128618 3300048912 Bacteria 2363
394 Ga0496109_0842954 3300048912 Bacteria 854
395 Ga0496110_0244413 3300048913 Bacteria 1633
396 Ga0496110_0847324 3300048913 Bacteria 819
397 Ga0496111_0154673 3300048914 Bacteria 1702
398 Ga0496111_0232625 3300048914 Bacteria 1369
399 Ga0496112_0105467 3300048915 Bacteria 2788
400 Ga0496112_0372197 3300048915 Bacteria 1370
401 Ga0496113_0015561 3300048916 Bacteria 5233
402 Ga0496113_0430142 3300048916 Bacteria 1060
403 Ga0496114_0516683 3300048917 Bacteria 1056
404 Ga0496115_0098213 3300048918 Bacteria 2398
405 Ga0496118_0179431 3300048921 Bacteria 1281
406 Ga0496118_0226509 3300048921 Bacteria 1083
407 Ga0496125_0245032 3300048928 Bacteria 1135
408 Ga0496126_0002460 3300048929 Bacteria 24974
409 Ga0496126_0050930 3300048929 Bacteria 3773
410 Ga0496126_0176271 3300048929 Bacteria 1818
411 Ga0496126_0195213 3300048929 Bacteria 1712
412 Ga0495682_0121028 3300049460 Bacteria 937
413 Ga0501032_0032946 3300049569 Bacteria 3551
414 Ga0501032_0419689 3300049569 Bacteria 858
415 Ga0501033_0533828 3300049570 Bacteria 809
416 Ga0501034_0045067 3300049571 Bacteria 4458
417 Ga0501036_0243620 3300049572 Bacteria 1507
418 Ga0501038_0461395 3300049574 Bacteria 976
419 Ga0501039_0529898 3300049575 Bacteria 925
420 Ga0501047_0154913 3300049581 Bacteria 2165
421 Ga0501048_0260943 3300049582 Bacteria 1231
422 Ga0501069_0397578 3300049585 Bacteria 815
423 Ga0501070_0084261 3300049586 Bacteria 2632
424 Ga0501079_0403465 3300049741 Bacteria 1072
425 Ga0501079_0426050 3300049741 Bacteria 1042
426 Ga0501035_0099746 3300049822 Bacteria 2549
427 Ga0501044_0105366 3300049823 Bacteria 2833
428 Ga0501044_0156223 3300049823 Bacteria 2260
429 nmdc:mga03683_432866_c1 3300050489 Bacteria 631
430 nmdc:mga03n38_20190_c1 3300050490 Bacteria 1624
431 nmdc:mga03n38_343072_c1 3300050490 Bacteria 811
432 nmdc:mga0yw44_165494_c1 3300050492 Bacteria 1450
433 nmdc:mga0k408_205498_c1 3300050493 Bacteria 1176
434 nmdc:mga0k408_246831_c1 3300050493 Bacteria 1066
435 nmdc:mga0k408_45110_c1 3300050493 Bacteria 2543
436 nmdc:mga06z11_54791_c1 3300050494 Bacteria 2057
437 nmdc:mga04h51_251967_c1 3300050495 Bacteria 708
438 nmdc:mga07m45_23488_c1 3300050496 Bacteria 3371
439 nmdc:mga07m45_4388_c1 3300050496 Bacteria 6902
440 nmdc:mga05p37_213719_c1 3300050507 Bacteria 2330
441 nmdc:mga0qj67_502945_c1 3300050509 Bacteria 974
442 nmdc:mga08y16_1434773_c1 3300050511 Bacteria 652
443 nmdc:mga08y16_96350_c1 3300050511 Bacteria 3081
444 nmdc:mga0rr50_292057_c1 3300050513 Bacteria 1362
445 nmdc:mga0a205_852013_c1 3300050515 Bacteria 758
446 Ga0500635_0024824 3300053080 Bacteria 1884
447 Ga0495655_0048070 3300053083 Bacteria 1119
448 Ga0495619_0642703 3300053085 Bacteria 724
449 Ga0500566_0000151 3300053094 Bacteria 35674
450 Ga0500566_0003924 3300053094 Bacteria 8868
451 Ga0500641_0002993 3300053096 Bacteria 5985
452 Ga0500641_0017212 3300053096 Bacteria 2700
453 Ga0500554_036882 3300053102 Bacteria 1479
454 Ga0500555_044303 3300053103 Bacteria 1232
455 Ga0500556_0057921 3300053104 Bacteria 1420
456 Ga0500562_069306 3300053108 Bacteria 951
457 Ga0500591_130324 3300053115 Bacteria 1015
458 Ga0500595_000265 3300053119 Bacteria 34660
459 Ga0500595_009408 3300053119 Bacteria 3945
460 Ga0500642_0281570 3300053130 Bacteria 755
461 Ga0500658_0102250 3300053134 Bacteria 1252
462 Ga0500559_0046555 3300053136 Bacteria 1902
463 Ga0500589_093782 3300053147 Bacteria 1316
464 Ga0500590_037600 3300053148 Bacteria 2500
465 Ga0500603_000295 3300053150 Bacteria 13130
466 Ga0500603_038954 3300053150 Bacteria 1260
467 Ga0500603_067870 3300053150 Bacteria 1010
468 Ga0500619_087407 3300053154 Bacteria 1051
469 Ga0500630_032801 3300053159 Bacteria 2548
470 Ga0500638_000539 3300053162 Bacteria 9511
471 Ga0500638_008140 3300053162 Bacteria 4450
472 Ga0500637_0113623 3300053178 Bacteria 1570
473 Ga0500645_041562 3300053730 Bacteria 1357
474 Ga0500596_002798 3300053735 Bacteria 3408

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005327 Ga0070658_10103088 Ga0070658_101030881 158
2 3300005336 Ga0070680_100233288 Ga0070680_1002332882 158
3 3300005436 Ga0070713_100151163 Ga0070713_1001511632 158
4 3300005530 Ga0070679_100044780 Ga0070679_1000447805 158
5 3300005535 Ga0070684_100306996 Ga0070684_1003069962 158
6 3300005539 Ga0068853_100434545 Ga0068853_1004345452 158
7 3300005563 Ga0068855_100348936 Ga0068855_1003489362 158
8 3300009093 Ga0105240_10070563 Ga0105240_100705634 158
9 3300013104 Ga0157370_10123520 Ga0157370_101235202 158
10 3300025904 Ga0207647_10362534 Ga0207647_103625342 158
11 3300025913 Ga0207695_10066247 Ga0207695_100662472 158
12 3300025917 Ga0207660_10093789 Ga0207660_100937892 158
13 3300025949 Ga0207667_10853950 Ga0207667_108539501 158
14 3300053096 Ga0500641_0002993 Ga0500641_0002993_1071_1667 159
15 3300053147 Ga0500589_093782 Ga0500589_093782_35_631 159
16 3300005539 Ga0068853_100129246 Ga0068853_1001292462 160
17 3300005548 Ga0070665_100115196 Ga0070665_1001151962 160
18 3300005563 Ga0068855_100026374 Ga0068855_1000263748 160
19 3300005577 Ga0068857_100343928 Ga0068857_1003439282 160
20 3300006881 Ga0068865_100377886 Ga0068865_1003778862 160
21 3300009094 Ga0111539_10054020 Ga0111539_100540202 160
22 3300009177 Ga0105248_10730383 Ga0105248_107303832 160
23 3300009551 Ga0105238_10035767 Ga0105238_100357672 160
24 3300013296 Ga0157374_10108347 Ga0157374_101083472 160
25 3300026041 Ga0207639_10041951 Ga0207639_100419512 160
26 3300050511 nmdc:mga08y16_96350_c1 nmdc:mga08y16_96350_c1_1634_2227 160
27 3300050515 nmdc:mga0a205_852013_c1 nmdc:mga0a205_852013_c1_38_631 160
28 3300005456 Ga0070678_100764768 Ga0070678_1007647682 161
29 3300005543 Ga0070672_100348617 Ga0070672_1003486172 161
30 3300006028 Ga0070717_10009120 Ga0070717_100091204 161
31 3300037312 Ga0395899_0100188 Ga0395899_0100188_116_721 161
32 3300037418 Ga0395900_0081148 Ga0395900_0081148_116_721 161
33 3300046474 Ga0495605_0104917 Ga0495605_0104917_17_607 161
34 3300046660 Ga0495625_0327531 Ga0495625_0327531_57_650 161
35 3300048090 Ga0495615_0039525 Ga0495615_0039525_535_1131 161
36 3300005330 Ga0070690_100072006 Ga0070690_1000720062 162
37 3300005338 Ga0068868_100210208 Ga0068868_1002102082 162
38 3300005340 Ga0070689_100188208 Ga0070689_1001882082 162
39 3300005343 Ga0070687_100185719 Ga0070687_1001857192 162
40 3300005347 Ga0070668_100398625 Ga0070668_1003986252 162
41 3300005356 Ga0070674_100102606 Ga0070674_1001026062 162
42 3300005366 Ga0070659_100431903 Ga0070659_1004319031 162
43 3300005367 Ga0070667_100239191 Ga0070667_1002391912 162
44 3300005456 Ga0070678_100093668 Ga0070678_1000936682 162
45 3300005459 Ga0068867_100109824 Ga0068867_1001098242 162
46 3300005543 Ga0070672_100366873 Ga0070672_1003668732 162
47 3300005544 Ga0070686_100233782 Ga0070686_1002337822 162
48 3300005548 Ga0070665_100632906 Ga0070665_1006329062 162
49 3300005719 Ga0068861_100738305 Ga0068861_1007383051 162
50 3300005844 Ga0068862_100617554 Ga0068862_1006175541 162
51 3300006358 Ga0068871_100500742 Ga0068871_1005007422 162
52 3300006881 Ga0068865_100423018 Ga0068865_1004230182 162
53 3300009148 Ga0105243_10061651 Ga0105243_100616513 162
54 3300009176 Ga0105242_10188769 Ga0105242_101887692 162
55 3300013297 Ga0157378_11032859 Ga0157378_110328591 162
56 3300013308 Ga0157375_11233080 Ga0157375_112330802 162
57 3300017792 Ga0163161_10291639 Ga0163161_102916391 162
58 3300025921 Ga0207652_10122654 Ga0207652_101226542 162
59 3300025932 Ga0207690_10343839 Ga0207690_103438392 162
60 3300025935 Ga0207709_10206402 Ga0207709_102064022 162
61 3300025936 Ga0207670_10009317 Ga0207670_100093177 162
62 3300025937 Ga0207669_10566818 Ga0207669_105668181 162
63 3300025938 Ga0207704_10008040 Ga0207704_100080402 162
64 3300025940 Ga0207691_10097203 Ga0207691_100972033 162
65 3300025961 Ga0207712_10370545 Ga0207712_103705452 162
66 3300025972 Ga0207668_10335360 Ga0207668_103353601 162
67 3300026041 Ga0207639_10750501 Ga0207639_107505011 162
68 3300026067 Ga0207678_10064888 Ga0207678_100648882 162
69 3300026075 Ga0207708_10081953 Ga0207708_100819533 162
70 3300026089 Ga0207648_10023188 Ga0207648_100231883 162
71 3300026121 Ga0207683_10056479 Ga0207683_100564793 162
72 3300026142 Ga0207698_10138145 Ga0207698_101381452 162
73 3300046515 Ga0495620_0082385 Ga0495620_0082385_107_700 162
74 3300046519 Ga0495632_0139354 Ga0495632_0139354_379_972 162
75 3300046523 Ga0495644_0084592 Ga0495644_0084592_265_858 162
76 3300046615 Ga0495656_0033230 Ga0495656_0033230_86_679 162
77 3300046664 Ga0495659_0024645 Ga0495659_0024645_1066_1659 162
78 3300048903 Ga0496100_0401208 Ga0496100_0401208_232_825 162
79 3300048904 Ga0496101_0100995 Ga0496101_0100995_1450_2043 162
80 3300048905 Ga0496102_0182181 Ga0496102_0182181_698_1291 162
81 3300048909 Ga0496106_0192399 Ga0496106_0192399_469_1062 162
82 3300048910 Ga0496107_0149528 Ga0496107_0149528_703_1296 162
83 3300005578 Ga0068854_100057756 Ga0068854_1000577562 163
84 3300025904 Ga0207647_10001150 Ga0207647_1000115017 163
85 3300025981 Ga0207640_10013128 Ga0207640_100131283 163
86 3300026041 Ga0207639_10073450 Ga0207639_100734502 163
87 3300001990 JGI24737J22298_10004677 JGI24737J22298_100046776 164
88 3300005329 Ga0070683_100033682 Ga0070683_1000336824 164
89 3300005330 Ga0070690_100076091 Ga0070690_1000760912 164
90 3300005334 Ga0068869_100146032 Ga0068869_1001460322 164
91 3300005339 Ga0070660_100196631 Ga0070660_1001966312 164
92 3300005354 Ga0070675_100240544 Ga0070675_1002405442 164
93 3300005457 Ga0070662_100042885 Ga0070662_1000428853 164
94 3300005535 Ga0070684_100012430 Ga0070684_1000124303 164
95 3300005615 Ga0070702_100012771 Ga0070702_1000127714 164
96 3300005983 Ga0081540_1014446 Ga0081540_10144463 164
97 3300009551 Ga0105238_10416457 Ga0105238_104164571 164
98 3300009551 Ga0105238_11390016 Ga0105238_113900161 164
99 3300010375 Ga0105239_10343931 Ga0105239_103439312 164
100 3300014968 Ga0157379_10149234 Ga0157379_101492341 164
101 3300025907 Ga0207645_10263631 Ga0207645_102636311 164
102 3300025933 Ga0207706_10115646 Ga0207706_101156462 164
103 3300025942 Ga0207689_10167637 Ga0207689_101676372 164
104 3300026035 Ga0207703_10197973 Ga0207703_101979731 164
105 3300049575 Ga0501039_0529898 Ga0501039_0529898_206_805 164
106 3300049741 Ga0501079_0426050 Ga0501079_0426050_424_1023 164
107 3300005937 Ga0081455_10004129 Ga0081455_100041294 165
108 3300005983 Ga0081540_1005183 Ga0081540_100518311 165
109 3300048906 Ga0496103_0344186 Ga0496103_0344186_346_942 166
110 3300005468 Ga0070707_100082155 Ga0070707_1000821552 167
111 3300005983 Ga0081540_1093813 Ga0081540_10938132 167
112 3300005985 Ga0081539_10099611 Ga0081539_100996112 167
113 3300017792 Ga0163161_10162422 Ga0163161_101624222 167
114 3300025927 Ga0207687_11117439 Ga0207687_111174391 167
115 3300025933 Ga0207706_10848324 Ga0207706_108483241 167
116 3300025935 Ga0207709_10649889 Ga0207709_106498892 167
117 3300026067 Ga0207678_10122717 Ga0207678_101227172 167
118 3300031247 Ga0265340_10025938 Ga0265340_100259382 167
119 3300031911 Ga0307412_10275164 Ga0307412_102751642 167
120 3300032126 Ga0307415_100325089 Ga0307415_1003250892 167
121 3300053154 Ga0500619_087407 Ga0500619_087407_463_1026 167
122 3300005983 Ga0081540_1011637 Ga0081540_10116373 168
123 3300005985 Ga0081539_10024516 Ga0081539_100245162 168
124 3300009545 Ga0105237_11071365 Ga0105237_110713652 168
125 3300042005 Ga0439448_0088874 Ga0439448_0088874_77_670 168
126 3300003322 rootL2_10276346 rootL2_102763461 169
127 3300045976 Ga0466967_0623114 Ga0466967_0623114_420_1010 169
128 3300009545 Ga0105237_10625293 Ga0105237_106252931 170
129 3300049823 Ga0501044_0105366 Ga0501044_0105366_1042_1632 170
130 3300050489 nmdc:mga03683_432866_c1 nmdc:mga03683_432866_c1_17_589 170
131 3300007788 Ga0099795_10040767 Ga0099795_100407672 171
132 3300035724 Ga0373933_0000031 Ga0373933_0000031_33465_33995 171
133 3300048929 Ga0496126_0050930 Ga0496126_0050930_676_1266 171
134 3300046457 Ga0495590_0034524 Ga0495590_0034524_1175_1750 172
135 3300005983 Ga0081540_1009930 Ga0081540_10099302 173
136 3300006048 Ga0075363_100188424 Ga0075363_1001884242 173
137 3300025297 Ga0209758_1003838 Ga0209758_100383814 173
138 3300031238 Ga0265332_10055871 Ga0265332_100558712 173
139 3300031344 Ga0265316_10389342 Ga0265316_103893422 173
140 3300031730 Ga0307516_10219715 Ga0307516_102197151 173
141 3300031911 Ga0307412_11208678 Ga0307412_112086781 173
142 3300031995 Ga0307409_100438250 Ga0307409_1004382502 173
143 3300032005 Ga0307411_10130416 Ga0307411_101304162 173
144 3300047320 Ga0495672_0037014 Ga0495672_0037014_1550_2083 173
145 3300053119 Ga0500595_009408 Ga0500595_009408_2621_3169 173
146 3300005331 Ga0070670_100346957 Ga0070670_1003469572 174
147 3300005347 Ga0070668_100065341 Ga0070668_1000653413 174
148 3300005353 Ga0070669_100297810 Ga0070669_1002978102 174
149 3300005457 Ga0070662_100136091 Ga0070662_1001360912 174
150 3300005548 Ga0070665_100022177 Ga0070665_1000221773 174
151 3300005844 Ga0068862_100095534 Ga0068862_1000955342 174
152 3300009098 Ga0105245_10735091 Ga0105245_107350912 174
153 3300011119 Ga0105246_10178855 Ga0105246_101788552 174
154 3300014326 Ga0157380_10154863 Ga0157380_101548632 174
155 3300003215 JGI25153J46596_10002154 JGI25153J46596_100021549 175
156 3300003911 JGI25405J52794_10017838 JGI25405J52794_100178381 175
157 3300005338 Ga0068868_100087203 Ga0068868_1000872032 175
158 3300005367 Ga0070667_100071178 Ga0070667_1000711783 175
159 3300005539 Ga0068853_100104000 Ga0068853_1001040002 175
160 3300005937 Ga0081455_10011042 Ga0081455_100110427 175
161 3300006871 Ga0075434_100251934 Ga0075434_1002519342 175
162 3300009545 Ga0105237_10456579 Ga0105237_104565792 175
163 3300013100 Ga0157373_10663523 Ga0157373_106635231 175
164 3300026088 Ga0207641_10743882 Ga0207641_107438822 175
165 3300045051 Ga0451576_0676949 Ga0451576_0676949_119_712 175
166 3300046507 Ga0495606_0363226 Ga0495606_0363226_76_657 175
167 3300053130 Ga0500642_0281570 Ga0500642_0281570_182_745 175
168 3300025297 Ga0209758_1007917 Ga0209758_10079178 176
169 3300053094 Ga0500566_0003924 Ga0500566_0003924_2099_2695 176
170 3300053096 Ga0500641_0017212 Ga0500641_0017212_1333_1926 176
171 3300053119 Ga0500595_000265 Ga0500595_000265_3445_4041 176
172 3300053150 Ga0500603_038954 Ga0500603_038954_46_642 176
173 3300053162 Ga0500638_000539 Ga0500638_000539_8037_8633 176
174 3300046460 Ga0495638_0080333 Ga0495638_0080333_1386_1961 177
175 3300053085 Ga0495619_0642703 Ga0495619_0642703_41_640 177
176 3300053094 Ga0500566_0000151 Ga0500566_0000151_26913_27512 177
177 3300053115 Ga0500591_130324 Ga0500591_130324_24_623 177
178 3300053136 Ga0500559_0046555 Ga0500559_0046555_1038_1637 177
179 3300053148 Ga0500590_037600 Ga0500590_037600_389_988 177
180 3300053150 Ga0500603_067870 Ga0500603_067870_389_988 177
181 3300053159 Ga0500630_032801 Ga0500630_032801_712_1311 177
182 3300053162 Ga0500638_008140 Ga0500638_008140_3827_4426 177
183 3300053735 Ga0500596_002798 Ga0500596_002798_1356_1955 177
184 3300006186 Ga0075369_10047057 Ga0075369_100470572 178
185 3300031239 Ga0265328_10058220 Ga0265328_100582202 178
186 3300035724 Ga0373933_0196265 Ga0373933_0196265_595_1200 178
187 3300049569 Ga0501032_0032946 Ga0501032_0032946_2825_3424 178
188 iso_pu_bacteria 2889033259 2889035505 178
189 3300005338 Ga0068868_100073327 Ga0068868_1000733272 179
190 3300005366 Ga0070659_100906084 Ga0070659_1009060841 179
191 3300005983 Ga0081540_1015921 Ga0081540_10159213 179
192 3300006177 Ga0075362_10013703 Ga0075362_100137032 179
193 3300006195 Ga0075366_10254910 Ga0075366_102549102 179
194 3300006914 Ga0075436_100177277 Ga0075436_1001772772 179
195 3300007076 Ga0075435_100284264 Ga0075435_1002842642 179
196 3300009545 Ga0105237_10576029 Ga0105237_105760291 179
197 3300025315 Ga0207697_10101856 Ga0207697_101018562 179
198 3300025914 Ga0207671_10124157 Ga0207671_101241572 179
199 3300025986 Ga0207658_10635316 Ga0207658_106353162 179
200 3300027866 Ga0209813_10024248 Ga0209813_100242482 179
201 3300028379 Ga0268266_10318659 Ga0268266_103186592 179
202 3300050493 nmdc:mga0k408_205498_c1 nmdc:mga0k408_205498_c1_372_965 179
203 3300050493 nmdc:mga0k408_45110_c1 nmdc:mga0k408_45110_c1_1654_2250 179
204 3300050513 nmdc:mga0rr50_292057_c1 nmdc:mga0rr50_292057_c1_588_1181 179
205 3300005548 Ga0070665_100347277 Ga0070665_1003472772 180
206 3300005549 Ga0070704_100429781 Ga0070704_1004297812 180
207 3300006048 Ga0075363_100024204 Ga0075363_1000242042 180
208 3300009148 Ga0105243_10553007 Ga0105243_105530071 180
209 3300026118 Ga0207675_100112919 Ga0207675_1001129192 180
210 3300046459 Ga0495629_0040530 Ga0495629_0040530_1029_1622 180
211 3300046473 Ga0495582_0404588 Ga0495582_0404588_107_700 180
212 3300047673 Ga0495593_0195138 Ga0495593_0195138_208_801 180
213 3300050490 nmdc:mga03n38_20190_c1 nmdc:mga03n38_20190_c1_876_1472 180
214 3300006048 Ga0075363_100035377 Ga0075363_1000353772 181
215 3300011119 Ga0105246_10732238 Ga0105246_107322381 181
216 3300013297 Ga0157378_10300043 Ga0157378_103000431 181
217 3300049569 Ga0501032_0419689 Ga0501032_0419689_196_789 181
218 3300049570 Ga0501033_0533828 Ga0501033_0533828_159_758 182
219 3300049571 Ga0501034_0045067 Ga0501034_0045067_1204_1803 182
220 3300049581 Ga0501047_0154913 Ga0501047_0154913_1370_1969 182
221 3300049582 Ga0501048_0260943 Ga0501048_0260943_574_1173 182
222 3300049585 Ga0501069_0397578 Ga0501069_0397578_164_763 182
223 3300049586 Ga0501070_0084261 Ga0501070_0084261_876_1475 182
224 3300049822 Ga0501035_0099746 Ga0501035_0099746_1913_2512 182
225 3300049823 Ga0501044_0156223 Ga0501044_0156223_72_671 182
226 3300050509 nmdc:mga0qj67_502945_c1 nmdc:mga0qj67_502945_c1_180_776 182
227 3300028786 Ga0307517_10001338 Ga0307517_1000133820 183
228 3300046558 Ga0495633_0230315 Ga0495633_0230315_131_724 183
229 3300046664 Ga0495659_0011645 Ga0495659_0011645_379_972 183
230 3300047446 Ga0495679_040427 Ga0495679_040427_10_603 183
231 3300048913 Ga0496110_0847324 Ga0496110_0847324_128_724 183
232 3300048916 Ga0496113_0015561 Ga0496113_0015561_3764_4360 183
233 3300046499 Ga0495594_0397479 Ga0495594_0397479_17_589 184
234 3300046515 Ga0495620_0090121 Ga0495620_0090121_18_590 184
235 3300046528 Ga0495642_0058689 Ga0495642_0058689_594_1190 184
236 3300046692 Ga0495671_0139525 Ga0495671_0139525_359_955 184
237 3300049460 Ga0495682_0121028 Ga0495682_0121028_210_806 184
238 3300005616 Ga0068852_100932985 Ga0068852_1009329851 185
239 iso_pu_bacteria 2728368998 2728754975 185
240 3300031507 Ga0307509_10577345 Ga0307509_105773452 186
241 3300046455 Ga0495603_0096703 Ga0495603_0096703_944_1546 186
242 3300046507 Ga0495606_0157649 Ga0495606_0157649_159_743 186
243 3300053080 Ga0500635_0024824 Ga0500635_0024824_1052_1654 186
244 3300053150 Ga0500603_000295 Ga0500603_000295_2077_2679 186
245 3300053178 Ga0500637_0113623 Ga0500637_0113623_646_1248 186
246 iso_pu_bacteria 8056673599 8056675729 186
247 3300033180 Ga0307510_10043589 Ga0307510_100435892 187
248 3300053102 Ga0500554_036882 Ga0500554_036882_340_942 187
249 iso_pu_bacteria 8006984368 8006990908 187
250 3300048917 Ga0496114_0516683 Ga0496114_0516683_192_773 188
251 3300049572 Ga0501036_0243620 Ga0501036_0243620_862_1461 188
252 iso_pu_bacteria 2513237101 2513695096 188
253 iso_pu_bacteria 2721755755 2723841628 188
254 iso_pu_bacteria 2791355199 2793082764 188
255 iso_pu_bacteria 2874604998 2874608078 188
256 iso_pu_bacteria 2876808645 2876810839 188
257 iso_pu_bacteria 2879110137 2879112157 188
258 iso_pu_bacteria 2922361189 2922364014 188
259 iso_pu_bacteria 2922386360 2922392552 188
260 iso_pu_bacteria 8006964411 8006969346 188
261 iso_pu_bacteria 8006994254 8006996525 188
262 3300006358 Ga0068871_100175062 Ga0068871_1001750621 190
263 3300048907 Ga0496104_0221400 Ga0496104_0221400_856_1452 190
264 3300048914 Ga0496111_0154673 Ga0496111_0154673_395_991 190
265 3300049574 Ga0501038_0461395 Ga0501038_0461395_215_805 190
266 3300049741 Ga0501079_0403465 Ga0501079_0403465_443_1033 190
267 3300005328 Ga0070676_10048724 Ga0070676_100487242 191
268 3300005330 Ga0070690_100558767 Ga0070690_1005587671 191
269 3300005331 Ga0070670_100275077 Ga0070670_1002750772 191
270 3300005335 Ga0070666_10194547 Ga0070666_101945472 191
271 3300005337 Ga0070682_100152780 Ga0070682_1001527802 191
272 3300005339 Ga0070660_100393644 Ga0070660_1003936442 191
273 3300005341 Ga0070691_10217059 Ga0070691_102170592 191
274 3300005347 Ga0070668_100012183 Ga0070668_1000121833 191
275 3300005354 Ga0070675_100647018 Ga0070675_1006470181 191
276 3300005364 Ga0070673_100245685 Ga0070673_1002456852 191
277 3300005455 Ga0070663_100016778 Ga0070663_1000167783 191
278 3300005455 Ga0070663_100318213 Ga0070663_1003182132 191
279 3300005456 Ga0070678_100204261 Ga0070678_1002042612 191
280 3300005457 Ga0070662_100934945 Ga0070662_1009349451 191
281 3300005466 Ga0070685_10051354 Ga0070685_100513542 191
282 3300005548 Ga0070665_100035947 Ga0070665_1000359472 191
283 3300005548 Ga0070665_100094751 Ga0070665_1000947513 191
284 3300005563 Ga0068855_100062940 Ga0068855_1000629402 191
285 3300005614 Ga0068856_100055177 Ga0068856_1000551773 191
286 3300005615 Ga0070702_100055804 Ga0070702_1000558042 191
287 3300005617 Ga0068859_100205095 Ga0068859_1002050952 191
288 3300005618 Ga0068864_100173508 Ga0068864_1001735082 191
289 3300005618 Ga0068864_100222665 Ga0068864_1002226652 191
290 3300005718 Ga0068866_10244039 Ga0068866_102440392 191
291 3300005719 Ga0068861_100033316 Ga0068861_1000333163 191
292 3300005840 Ga0068870_10144331 Ga0068870_101443312 191
293 3300005842 Ga0068858_100076272 Ga0068858_1000762722 191
294 3300005842 Ga0068858_100320732 Ga0068858_1003207322 191
295 3300005843 Ga0068860_100075850 Ga0068860_1000758502 191
296 3300006038 Ga0075365_10086169 Ga0075365_100861692 191
297 3300006048 Ga0075363_100001418 Ga0075363_1000014187 191
298 3300006051 Ga0075364_10022004 Ga0075364_100220043 191
299 3300006051 Ga0075364_10109068 Ga0075364_101090682 191
300 3300006178 Ga0075367_10037766 Ga0075367_100377663 191
301 3300006178 Ga0075367_10077526 Ga0075367_100775262 191
302 3300006237 Ga0097621_100294561 Ga0097621_1002945612 191
303 3300006353 Ga0075370_10038515 Ga0075370_100385153 191
304 3300006844 Ga0075428_100022218 Ga0075428_1000222185 191
305 3300006931 Ga0097620_100205095 Ga0097620_1002050952 191
306 3300007788 Ga0099795_10252748 Ga0099795_102527482 191
307 3300009036 Ga0105244_10211006 Ga0105244_102110061 191
308 3300009094 Ga0111539_10591297 Ga0111539_105912971 191
309 3300009098 Ga0105245_10208395 Ga0105245_102083952 191
310 3300009101 Ga0105247_10078572 Ga0105247_100785722 191
311 3300009101 Ga0105247_10505058 Ga0105247_105050582 191
312 3300009148 Ga0105243_10557773 Ga0105243_105577732 191
313 3300009174 Ga0105241_10056204 Ga0105241_100562043 191
314 3300009176 Ga0105242_10331416 Ga0105242_103314161 191
315 3300009177 Ga0105248_10074328 Ga0105248_100743282 191
316 3300009177 Ga0105248_10788845 Ga0105248_107888452 191
317 3300013296 Ga0157374_10212674 Ga0157374_102126742 191
318 3300013296 Ga0157374_10218167 Ga0157374_102181672 191
319 3300013297 Ga0157378_10184467 Ga0157378_101844672 191
320 3300013307 Ga0157372_11070507 Ga0157372_110705071 191
321 3300013308 Ga0157375_10246663 Ga0157375_102466632 191
322 3300014325 Ga0163163_10196731 Ga0163163_101967312 191
323 3300014326 Ga0157380_10323553 Ga0157380_103235532 191
324 3300014745 Ga0157377_10287795 Ga0157377_102877952 191
325 3300014968 Ga0157379_10267749 Ga0157379_102677492 191
326 3300014968 Ga0157379_10566607 Ga0157379_105666072 191
327 3300014969 Ga0157376_10152544 Ga0157376_101525442 191
328 3300025899 Ga0207642_10112696 Ga0207642_101126962 191
329 3300025900 Ga0207710_10101197 Ga0207710_101011972 191
330 3300025901 Ga0207688_10110029 Ga0207688_101100292 191
331 3300025903 Ga0207680_10204990 Ga0207680_102049902 191
332 3300025907 Ga0207645_10022525 Ga0207645_100225252 191
333 3300025908 Ga0207643_10079148 Ga0207643_100791481 191
334 3300025919 Ga0207657_10722564 Ga0207657_107225641 191
335 3300025925 Ga0207650_10312948 Ga0207650_103129482 191
336 3300025927 Ga0207687_10116362 Ga0207687_101163622 191
337 3300025931 Ga0207644_10198077 Ga0207644_101980771 191
338 3300025941 Ga0207711_10359394 Ga0207711_103593942 191
339 3300025941 Ga0207711_10662516 Ga0207711_106625161 191
340 3300025949 Ga0207667_10058734 Ga0207667_100587343 191
341 3300025960 Ga0207651_10242049 Ga0207651_102420492 191
342 3300025960 Ga0207651_10622041 Ga0207651_106220412 191
343 3300025972 Ga0207668_10031635 Ga0207668_100316352 191
344 3300025981 Ga0207640_10078319 Ga0207640_100783192 191
345 3300026023 Ga0207677_10278054 Ga0207677_102780542 191
346 3300026035 Ga0207703_10029876 Ga0207703_100298763 191
347 3300026035 Ga0207703_10257829 Ga0207703_102578292 191
348 3300026067 Ga0207678_10046422 Ga0207678_100464222 191
349 3300026067 Ga0207678_10061814 Ga0207678_100618143 191
350 3300026067 Ga0207678_10140716 Ga0207678_101407162 191
351 3300026075 Ga0207708_10402323 Ga0207708_104023232 191
352 3300026088 Ga0207641_10126124 Ga0207641_101261242 191
353 3300026088 Ga0207641_10675132 Ga0207641_106751322 191
354 3300026089 Ga0207648_10275971 Ga0207648_102759712 191
355 3300026095 Ga0207676_10209316 Ga0207676_102093162 191
356 3300026121 Ga0207683_10059388 Ga0207683_100593883 191
357 3300026121 Ga0207683_10187778 Ga0207683_101877782 191
358 3300028379 Ga0268266_10001190 Ga0268266_100011906 191
359 3300028379 Ga0268266_10003966 Ga0268266_100039669 191
360 3300028379 Ga0268266_10504799 Ga0268266_105047992 191
361 3300028381 Ga0268264_10088565 Ga0268264_100885653 191
362 3300031235 Ga0265330_10034200 Ga0265330_100342002 191
363 3300031456 Ga0307513_10292358 Ga0307513_102923582 191
364 3300031507 Ga0307509_10168707 Ga0307509_101687072 191
365 3300031731 Ga0307405_10411947 Ga0307405_104119472 191
366 3300031824 Ga0307413_10038452 Ga0307413_100384522 191
367 3300031995 Ga0307409_100483087 Ga0307409_1004830872 191
368 3300033180 Ga0307510_10001271 Ga0307510_100012718 191
369 3300035695 Ga0373927_0230191 Ga0373927_0230191_106_699 191
370 3300046455 Ga0495603_0015386 Ga0495603_0015386_1929_2522 191
371 3300046455 Ga0495603_0025650 Ga0495603_0025650_805_1398 191
372 3300046458 Ga0495591_066054 Ga0495591_066054_247_840 191
373 3300046461 Ga0495641_0042320 Ga0495641_0042320_192_785 191
374 3300046491 Ga0495584_0039800 Ga0495584_0039800_1579_2172 191
375 3300046492 Ga0495585_0059225 Ga0495585_0059225_631_1224 191
376 3300046492 Ga0495585_0099602 Ga0495585_0099602_196_789 191
377 3300046499 Ga0495594_0072086 Ga0495594_0072086_733_1326 191
378 3300046519 Ga0495632_0307106 Ga0495632_0307106_86_679 191
379 3300046523 Ga0495644_0055137 Ga0495644_0055137_544_1137 191
380 3300046525 Ga0495663_0113672 Ga0495663_0113672_278_871 191
381 3300046526 Ga0495666_0055322 Ga0495666_0055322_1059_1652 191
382 3300046537 Ga0495598_0023245 Ga0495598_0023245_251_844 191
383 3300046539 Ga0495621_0037585 Ga0495621_0037585_165_758 191
384 3300046557 Ga0495622_0016497 Ga0495622_0016497_105_698 191
385 3300046558 Ga0495633_0023633 Ga0495633_0023633_1184_1777 191
386 3300046615 Ga0495656_0010968 Ga0495656_0010968_1050_1643 191
387 3300046615 Ga0495656_0139185 Ga0495656_0139185_392_985 191
388 3300046648 Ga0495611_0028936 Ga0495611_0028936_682_1275 191
389 3300046660 Ga0495625_0422690 Ga0495625_0422690_97_690 191
390 3300046664 Ga0495659_0011528 Ga0495659_0011528_970_1563 191
391 3300046665 Ga0495661_0139551 Ga0495661_0139551_174_767 191
392 3300046674 Ga0495588_0015061 Ga0495588_0015061_2955_3548 191
393 3300046683 Ga0495658_0206415 Ga0495658_0206415_431_1024 191
394 3300046684 Ga0495669_0023468 Ga0495669_0023468_753_1346 191
395 3300046691 Ga0495670_0021268 Ga0495670_0021268_1646_2239 191
396 3300046794 Ga0495589_0075529 Ga0495589_0075529_354_947 191
397 3300047318 Ga0495636_0047517 Ga0495636_0047517_915_1508 191
398 3300047321 Ga0495676_0213437 Ga0495676_0213437_447_1040 191
399 3300047323 Ga0495683_0128992 Ga0495683_0128992_418_1011 191
400 3300047445 Ga0495677_0034964 Ga0495677_0034964_171_764 191
401 3300047470 Ga0495681_0109677 Ga0495681_0109677_322_915 191
402 3300048905 Ga0496102_0262686 Ga0496102_0262686_837_1430 191
403 3300048905 Ga0496102_0510473 Ga0496102_0510473_223_816 191
404 3300048907 Ga0496104_0152979 Ga0496104_0152979_993_1586 191
405 3300048909 Ga0496106_0101788 Ga0496106_0101788_653_1246 191
406 3300048909 Ga0496106_0461618 Ga0496106_0461618_382_975 191
407 3300048910 Ga0496107_0048005 Ga0496107_0048005_787_1380 191
408 3300048911 Ga0496108_0116469 Ga0496108_0116469_1483_2076 191
409 3300048912 Ga0496109_0128618 Ga0496109_0128618_1544_2137 191
410 3300048912 Ga0496109_0842954 Ga0496109_0842954_55_648 191
411 3300048913 Ga0496110_0244413 Ga0496110_0244413_1011_1604 191
412 3300048914 Ga0496111_0232625 Ga0496111_0232625_331_924 191
413 3300048915 Ga0496112_0105467 Ga0496112_0105467_1413_2006 191
414 3300048915 Ga0496112_0372197 Ga0496112_0372197_60_653 191
415 3300048916 Ga0496113_0430142 Ga0496113_0430142_424_1017 191
416 3300048918 Ga0496115_0098213 Ga0496115_0098213_901_1494 191
417 3300048921 Ga0496118_0179431 Ga0496118_0179431_409_1002 191
418 3300048921 Ga0496118_0226509 Ga0496118_0226509_465_1058 191
419 3300048929 Ga0496126_0195213 Ga0496126_0195213_336_929 191
420 3300050492 nmdc:mga0yw44_165494_c1 nmdc:mga0yw44_165494_c1_774_1367 191
421 3300050493 nmdc:mga0k408_246831_c1 nmdc:mga0k408_246831_c1_89_682 191
422 3300050494 nmdc:mga06z11_54791_c1 nmdc:mga06z11_54791_c1_723_1316 191
423 3300050495 nmdc:mga04h51_251967_c1 nmdc:mga04h51_251967_c1_100_693 191
424 3300050496 nmdc:mga07m45_4388_c1 nmdc:mga07m45_4388_c1_4282_4875 191
425 3300050507 nmdc:mga05p37_213719_c1 nmdc:mga05p37_213719_c1_890_1483 191
426 3300050511 nmdc:mga08y16_1434773_c1 nmdc:mga08y16_1434773_c1_10_603 191
427 3300053083 Ga0495655_0048070 Ga0495655_0048070_80_673 191
428 3300053108 Ga0500562_069306 Ga0500562_069306_84_677 191
429 3300005458 Ga0070681_10849517 Ga0070681_108495171 192
430 3300005937 Ga0081455_10007101 Ga0081455_1000710111 192
431 3300005983 Ga0081540_1006399 Ga0081540_10063994 192
432 3300006048 Ga0075363_100277586 Ga0075363_1002775862 192
433 3300006178 Ga0075367_10170766 Ga0075367_101707662 192
434 3300006195 Ga0075366_10067365 Ga0075366_100673652 192
435 3300006353 Ga0075370_10030969 Ga0075370_100309693 192
436 3300009092 Ga0105250_10036541 Ga0105250_100365412 192
437 3300009101 Ga0105247_10339011 Ga0105247_103390112 192
438 3300009147 Ga0114129_10298268 Ga0114129_102982682 192
439 3300025942 Ga0207689_10056391 Ga0207689_100563913 192
440 3300026116 Ga0207674_10262464 Ga0207674_102624642 192
441 3300028786 Ga0307517_10278341 Ga0307517_102783412 192
442 3300030521 Ga0307511_10243079 Ga0307511_102430791 192
443 3300035118 Ga0373954_0058546 Ga0373954_0058546_76_672 192
444 3300036401 Ga0373937_0046264 Ga0373937_0046264_696_1292 192
445 3300037471 Ga0395905_0779649 Ga0395905_0779649_71_667 192
446 3300046506 Ga0495583_0034391 Ga0495583_0034391_1737_2333 192
447 3300046507 Ga0495606_0456612 Ga0495606_0456612_18_614 192
448 3300046519 Ga0495632_0090373 Ga0495632_0090373_328_924 192
449 3300048905 Ga0496102_0223362 Ga0496102_0223362_25_621 192
450 3300048928 Ga0496125_0245032 Ga0496125_0245032_378_974 192
451 3300048929 Ga0496126_0002460 Ga0496126_0002460_2703_3299 192
452 3300048929 Ga0496126_0176271 Ga0496126_0176271_780_1376 192
453 3300050490 nmdc:mga03n38_343072_c1 nmdc:mga03n38_343072_c1_136_732 192
454 3300050496 nmdc:mga07m45_23488_c1 nmdc:mga07m45_23488_c1_672_1268 192
455 3300053103 Ga0500555_044303 Ga0500555_044303_378_974 192
456 3300053104 Ga0500556_0057921 Ga0500556_0057921_196_792 192
457 3300053134 Ga0500658_0102250 Ga0500658_0102250_640_1236 192
458 3300053730 Ga0500645_041562 Ga0500645_041562_532_1128 192
459 3300005437 Ga0070710_10022058 Ga0070710_100220583 193
460 3300005439 Ga0070711_100063995 Ga0070711_1000639953 193
461 3300025929 Ga0207664_10374193 Ga0207664_103741932 193
462 3300005577 Ga0068857_100059164 Ga0068857_1000591642 195
463 3300005578 Ga0068854_100003752 Ga0068854_1000037522 195
464 3300005616 Ga0068852_100184633 Ga0068852_1001846332 195
465 3300005834 Ga0068851_10000408 Ga0068851_1000040818 195
466 3300025981 Ga0207640_10038241 Ga0207640_100382413 195
467 3300026116 Ga0207674_10012685 Ga0207674_100126856 195
468 3300026142 Ga0207698_10063006 Ga0207698_100630063 195
469 3300005563 Ga0068855_100055289 Ga0068855_1000552893 199
470 3300005616 Ga0068852_100055421 Ga0068852_1000554212 199
471 3300005834 Ga0068851_10053909 Ga0068851_100539092 199
472 3300025913 Ga0207695_10131408 Ga0207695_101314081 199
473 3300025949 Ga0207667_10466636 Ga0207667_104666361 199
474 3300026078 Ga0207702_10009402 Ga0207702_100094023 199
475 3300026116 Ga0207674_10000890 Ga0207674_1000089018 199
476 3300001979 JGI24740J21852_10011431 JGI24740J21852_100114313 200
477 3300005539 Ga0068853_100159652 Ga0068853_1001596522 200
478 3300005563 Ga0068855_100074325 Ga0068855_1000743254 200
479 3300005614 Ga0068856_100481908 Ga0068856_1004819082 200
480 3300009093 Ga0105240_10019831 Ga0105240_100198318 200
481 3300009551 Ga0105238_10005518 Ga0105238_100055182 200
482 3300025321 Ga0207656_10005406 Ga0207656_100054064 200
483 3300025911 Ga0207654_10000058 Ga0207654_1000005871 200
484 3300025913 Ga0207695_10000453 Ga0207695_1000045356 200
485 3300025924 Ga0207694_10001512 Ga0207694_1000151215 200
486 3300025949 Ga0207667_10007600 Ga0207667_100076002 200
487 3300026041 Ga0207639_10090193 Ga0207639_100901931 200
488 3300026078 Ga0207702_10000004 Ga0207702_10000004254 200

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01713

Smr

Smr domain

95

181

0.93

Feature Viewer

pLDDT pTM Quality
57.37 0.46 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map