F453619

General Info

Members Datasets Scaffolds Average Seq Length
488 132 488 88

Family's Representative Sequence

Representative Sequence 3300026078|Ga0207702_10822671|Ga0207702_108226712
Length 96
Sequence MMLYDFLSGAVVLGFLTCALFFLRFWTRTREGLFLAFALAFILLGAGQTVLALGNIPTEERGSLYLIRLAAYLLIFAAIIRKNRGSRANRNRQGSD

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
27 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
37 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
38 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
39 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
43 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
44 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
45 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
46 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
47 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
48 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
49 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
50 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
51 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
52 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
53 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
54 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
55 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
56 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
91 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
92 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
93 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
94 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
95 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
96 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
97 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
98 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
99 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
100 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
101 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
102 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
103 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
104 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
105 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
106 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
107 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
108 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
109 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
110 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
111 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
112 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
113 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
114 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
115 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
116 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
117 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
118 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
119 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
120 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
121 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
122 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
123 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
124 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
125 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
126 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
127 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
128 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
129 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
130 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
131 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
132 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.8
Metatranscriptomes 0.2
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.61
Rhizosphere 99.18
Stem 0
Stem Tuber 0
Unclassified 0.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10112529 3300001979 Bacteria 686
2 JGI24737J22298_10044515 3300001990 Bacteria 1357
3 JGI24737J22298_10053363 3300001990 Unclassified 1224
4 rootH1_10049039 3300003323 Bacteria 2252
5 Ga0070658_10003471 3300005327 Bacteria 12948
6 Ga0070658_10061266 3300005327 Bacteria 3065
7 Ga0070658_10102197 3300005327 Bacteria 2370
8 Ga0070658_10222541 3300005327 Bacteria 1596
9 Ga0070658_10406753 3300005327 Bacteria 1169
10 Ga0070658_10896471 3300005327 Bacteria 771
11 Ga0070658_11380363 3300005327 Unclassified 611
12 Ga0070658_11448319 3300005327 Unclassified 596
13 Ga0070683_100002165 3300005329 Bacteria 15542
14 Ga0070683_100150197 3300005329 Bacteria 2209
15 Ga0070683_101015834 3300005329 Unclassified 796
16 Ga0070683_101125936 3300005329 Bacteria 754
17 Ga0070666_10038626 3300005335 Bacteria 3177
18 Ga0070666_10172968 3300005335 Bacteria 1513
19 Ga0070680_100000406 3300005336 Bacteria 29408
20 Ga0070680_100014855 3300005336 Bacteria 6091
21 Ga0070680_100065871 3300005336 Bacteria 2969
22 Ga0070680_100255921 3300005336 Bacteria 1481
23 Ga0070682_100717276 3300005337 Bacteria 803
24 Ga0068868_100213742 3300005338 Bacteria 1612
25 Ga0070660_100039308 3300005339 Bacteria 3595
26 Ga0070660_100142968 3300005339 Bacteria 1921
27 Ga0070660_100174220 3300005339 Bacteria 1739
28 Ga0070660_100186629 3300005339 Bacteria 1679
29 Ga0070660_100423697 3300005339 Unclassified 1102
30 Ga0070660_100583485 3300005339 Bacteria 934
31 Ga0070661_100012128 3300005344 Bacteria 6026
32 Ga0070661_100027889 3300005344 Bacteria 4069
33 Ga0070661_100123408 3300005344 Bacteria 1941
34 Ga0070661_100164979 3300005344 Unclassified 1679
35 Ga0070661_100287256 3300005344 Bacteria 1277
36 Ga0070692_10043610 3300005345 Bacteria 2307
37 Ga0070692_10230543 3300005345 Bacteria 1099
38 Ga0070692_10386466 3300005345 Unclassified 880
39 Ga0070692_10629429 3300005345 Bacteria 714
40 Ga0070668_100788867 3300005347 Unclassified 843
41 Ga0070671_100160636 3300005355 Bacteria 1899
42 Ga0070671_100652246 3300005355 Bacteria 911
43 Ga0070673_100522807 3300005364 Bacteria 1075
44 Ga0070659_100007212 3300005366 Bacteria 8068
45 Ga0070659_100104690 3300005366 Bacteria 2280
46 Ga0070659_100137331 3300005366 Bacteria 1988
47 Ga0070659_100173702 3300005366 Bacteria 1766
48 Ga0070659_100619168 3300005366 Bacteria 931
49 Ga0070659_100711626 3300005366 Bacteria 869
50 Ga0070659_101152851 3300005366 Unclassified 684
51 Ga0070659_101153057 3300005366 Bacteria 684
52 Ga0070659_102094306 3300005366 Unclassified 508
53 Ga0070667_100302407 3300005367 Bacteria 1441
54 Ga0070667_100974004 3300005367 Bacteria 791
55 Ga0070714_100132585 3300005435 Bacteria 2227
56 Ga0070714_100170620 3300005435 Bacteria 1974
57 Ga0070714_100825545 3300005435 Bacteria 898
58 Ga0070714_101478539 3300005435 Bacteria 663
59 Ga0070714_101683676 3300005435 Bacteria 619
60 Ga0070663_100041359 3300005455 Bacteria 3232
61 Ga0070663_100277031 3300005455 Bacteria 1335
62 Ga0070662_100011566 3300005457 Bacteria 5823
63 Ga0070662_100028062 3300005457 Bacteria 3914
64 Ga0070681_10184695 3300005458 Bacteria 2006
65 Ga0070681_10385139 3300005458 Bacteria 1313
66 Ga0070681_10740196 3300005458 Bacteria 899
67 Ga0070681_10960181 3300005458 Bacteria 774
68 Ga0068867_100071155 3300005459 Bacteria 2602
69 Ga0068867_100237885 3300005459 Bacteria 1475
70 Ga0070679_100060072 3300005530 Bacteria 3789
71 Ga0070679_100225644 3300005530 Bacteria 1834
72 Ga0070679_100250873 3300005530 Bacteria 1726
73 Ga0070679_100895212 3300005530 Bacteria 831
74 Ga0070679_102153650 3300005530 Unclassified 507
75 Ga0070684_100032970 3300005535 Bacteria 4419
76 Ga0070684_100804699 3300005535 Bacteria 879
77 Ga0070684_101034588 3300005535 Bacteria 771
78 Ga0068853_100161067 3300005539 Bacteria 2025
79 Ga0068853_100612475 3300005539 Unclassified 1035
80 Ga0068853_101171866 3300005539 Bacteria 742
81 Ga0068853_101273152 3300005539 Bacteria 710
82 Ga0070696_101007458 3300005546 Bacteria 696
83 Ga0070693_100107599 3300005547 Bacteria 1709
84 Ga0070665_101200268 3300005548 Bacteria 769
85 Ga0068855_100044730 3300005563 Bacteria 5239
86 Ga0068855_100060863 3300005563 Bacteria 4413
87 Ga0068855_100204771 3300005563 Bacteria 2220
88 Ga0068855_100373268 3300005563 Bacteria 1567
89 Ga0068855_100404542 3300005563 Bacteria 1495
90 Ga0068855_100741020 3300005563 Bacteria 1048
91 Ga0068855_100809089 3300005563 Bacteria 995
92 Ga0068855_100999816 3300005563 Bacteria 879
93 Ga0068855_101074476 3300005563 Bacteria 842
94 Ga0068855_101258928 3300005563 Bacteria 767
95 Ga0068855_101444957 3300005563 Bacteria 707
96 Ga0068855_101779553 3300005563 Bacteria 626
97 Ga0068855_102160479 3300005563 Unclassified 559
98 Ga0070664_100049737 3300005564 Bacteria 3545
99 Ga0070664_100320616 3300005564 Unclassified 1404
100 Ga0070664_100637911 3300005564 Bacteria 989
101 Ga0068857_100103545 3300005577 Bacteria 2555
102 Ga0068857_100289045 3300005577 Bacteria 1509
103 Ga0068854_100020244 3300005578 Bacteria 4498
104 Ga0068854_100025501 3300005578 Bacteria 4058
105 Ga0068854_100069812 3300005578 Bacteria 2566
106 Ga0068854_100337153 3300005578 Bacteria 1230
107 Ga0068856_100011210 3300005614 Bacteria 8700
108 Ga0068856_100119339 3300005614 Bacteria 2638
109 Ga0068856_100236350 3300005614 Bacteria 1843
110 Ga0068856_100301739 3300005614 Bacteria 1619
111 Ga0068856_100567228 3300005614 Bacteria 1156
112 Ga0068856_101264728 3300005614 Bacteria 754
113 Ga0068856_102016211 3300005614 Unclassified 587
114 Ga0068856_102379741 3300005614 Bacteria 537
115 Ga0070702_101630616 3300005615 Bacteria 534
116 Ga0068852_100004297 3300005616 Bacteria 10055
117 Ga0068852_100006103 3300005616 Bacteria 8685
118 Ga0068852_100056586 3300005616 Bacteria 3390
119 Ga0068852_100136113 3300005616 Bacteria 2268
120 Ga0068852_100172570 3300005616 Bacteria 2028
121 Ga0068852_100384523 3300005616 Bacteria 1377
122 Ga0068852_100395434 3300005616 Bacteria 1358
123 Ga0068852_100822797 3300005616 Bacteria 943
124 Ga0068852_101613827 3300005616 Bacteria 671
125 Ga0068852_101885481 3300005616 Bacteria 620
126 Ga0068852_102179321 3300005616 Bacteria 576
127 Ga0068866_10429425 3300005718 Bacteria 859
128 Ga0068851_10029382 3300005834 Bacteria 2721
129 Ga0070717_11571497 3300006028 Unclassified 596
130 Ga0097621_100035316 3300006237 Bacteria 3994
131 Ga0097621_100872222 3300006237 Bacteria 837
132 Ga0068865_100400994 3300006881 Bacteria 1123
133 Ga0105240_10136153 3300009093 Bacteria 2941
134 Ga0105240_10262243 3300009093 Bacteria 1993
135 Ga0105240_10334650 3300009093 Bacteria 1721
136 Ga0105240_12291214 3300009093 Bacteria 559
137 Ga0105240_12751697 3300009093 Unclassified 506
138 Ga0105248_10047878 3300009177 Bacteria 4795
139 Ga0105237_10360543 3300009545 Bacteria 1458
140 Ga0105238_10604791 3300009551 Unclassified 1104
141 Ga0105238_12316722 3300009551 Unclassified 572
142 Ga0105239_10559244 3300010375 Bacteria 1303
143 Ga0105239_12885371 3300010375 Unclassified 561
144 Ga0157373_10090777 3300013100 Bacteria 2151
145 Ga0157373_10093962 3300013100 Bacteria 2112
146 Ga0157373_10122994 3300013100 Bacteria 1824
147 Ga0157373_10239231 3300013100 Bacteria 1283
148 Ga0157373_10458750 3300013100 Unclassified 918
149 Ga0157373_10502625 3300013100 Bacteria 876
150 Ga0157373_10557814 3300013100 Bacteria 831
151 Ga0157373_11055080 3300013100 Unclassified 608
152 Ga0157371_10065589 3300013102 Bacteria 2571
153 Ga0157371_10094652 3300013102 Bacteria 2117
154 Ga0157371_10102338 3300013102 Bacteria 2032
155 Ga0157371_10102381 3300013102 Bacteria 2032
156 Ga0157371_10113752 3300013102 Bacteria 1922
157 Ga0157371_10128882 3300013102 Bacteria 1799
158 Ga0157371_10136268 3300013102 Bacteria 1748
159 Ga0157371_10174954 3300013102 Bacteria 1534
160 Ga0157371_10482459 3300013102 Unclassified 914
161 Ga0157371_10919220 3300013102 Bacteria 664
162 Ga0157371_11414829 3300013102 Bacteria 540
163 Ga0157370_10094507 3300013104 Bacteria 2804
164 Ga0157370_10099268 3300013104 Bacteria 2729
165 Ga0157370_10146191 3300013104 Bacteria 2201
166 Ga0157370_10846134 3300013104 Bacteria 831
167 Ga0157370_10885916 3300013104 Bacteria 810
168 Ga0157370_10887244 3300013104 Bacteria 810
169 Ga0157370_11239386 3300013104 Unclassified 673
170 Ga0157370_11417802 3300013104 Unclassified 625
171 Ga0157369_10005054 3300013105 Bacteria 15446
172 Ga0157369_10049843 3300013105 Bacteria 4537
173 Ga0157369_10203373 3300013105 Bacteria 2078
174 Ga0157369_10276880 3300013105 Unclassified 1748
175 Ga0157369_10432286 3300013105 Bacteria 1364
176 Ga0157369_10720720 3300013105 Bacteria 1027
177 Ga0157369_10996497 3300013105 Bacteria 858
178 Ga0157369_12316454 3300013105 Bacteria 544
179 Ga0163162_10075213 3300013306 Bacteria 3438
180 Ga0157372_10059383 3300013307 Bacteria 4277
181 Ga0157372_10421495 3300013307 Unclassified 1555
182 Ga0157372_10473895 3300013307 Bacteria 1459
183 Ga0157372_10747958 3300013307 Bacteria 1137
184 Ga0157372_11307414 3300013307 Unclassified 837
185 Ga0157372_12113336 3300013307 Bacteria 647
186 Ga0157372_12305679 3300013307 Bacteria 618
187 Ga0157372_13429403 3300013307 Unclassified 504
188 Ga0157375_11264244 3300013308 Bacteria 867
189 Ga0157376_10301935 3300014969 Bacteria 1516
190 Ga0163161_10096122 3300017792 Bacteria 2199
191 Ga0206353_11339572 3300020082 Bacteria 2047
192 Ga0207656_10065913 3300025321 Bacteria 1599
193 Ga0207688_10177649 3300025901 Bacteria 1268
194 Ga0207680_10183538 3300025903 Bacteria 1416
195 Ga0207647_10008080 3300025904 Bacteria 7562
196 Ga0207647_10056487 3300025904 Bacteria 2408
197 Ga0207647_10099366 3300025904 Bacteria 1728
198 Ga0207647_10202700 3300025904 Bacteria 1147
199 Ga0207645_10032903 3300025907 Bacteria 3333
200 Ga0207705_10000151 3300025909 Bacteria 74614
201 Ga0207705_10003327 3300025909 Bacteria 12220
202 Ga0207705_10011443 3300025909 Bacteria 6420
203 Ga0207705_10056365 3300025909 Bacteria 2833
204 Ga0207705_10134775 3300025909 Bacteria 1840
205 Ga0207705_10768412 3300025909 Bacteria 748
206 Ga0207705_10969259 3300025909 Unclassified 658
207 Ga0207654_11381392 3300025911 Unclassified 514
208 Ga0207707_10160872 3300025912 Bacteria 1963
209 Ga0207707_10274616 3300025912 Bacteria 1460
210 Ga0207707_11647794 3300025912 Bacteria 504
211 Ga0207695_10181081 3300025913 Bacteria 2028
212 Ga0207695_10592609 3300025913 Bacteria 990
213 Ga0207695_10676261 3300025913 Bacteria 913
214 Ga0207671_10762927 3300025914 Bacteria 768
215 Ga0207663_11430481 3300025916 Bacteria 557
216 Ga0207660_10000515 3300025917 Bacteria 25797
217 Ga0207660_10003161 3300025917 Bacteria 10785
218 Ga0207660_10013286 3300025917 Bacteria 5396
219 Ga0207660_10061262 3300025917 Bacteria 2708
220 Ga0207657_10039431 3300025919 Bacteria 4198
221 Ga0207657_10059875 3300025919 Bacteria 3270
222 Ga0207657_10135110 3300025919 Bacteria 2019
223 Ga0207657_10236534 3300025919 Bacteria 1459
224 Ga0207657_10342456 3300025919 Unclassified 1180
225 Ga0207657_10528351 3300025919 Bacteria 923
226 Ga0207649_10007523 3300025920 Bacteria 5920
227 Ga0207649_10010370 3300025920 Bacteria 5117
228 Ga0207649_10293073 3300025920 Bacteria 1187
229 Ga0207649_10363101 3300025920 Bacteria 1075
230 Ga0207652_10129994 3300025921 Bacteria 2245
231 Ga0207652_10191918 3300025921 Bacteria 1837
232 Ga0207652_10277644 3300025921 Unclassified 1511
233 Ga0207652_10365920 3300025921 Bacteria 1301
234 Ga0207652_11508389 3300025921 Bacteria 576
235 Ga0207664_10969612 3300025929 Bacteria 762
236 Ga0207664_11053171 3300025929 Bacteria 728
237 Ga0207644_10090695 3300025931 Bacteria 2278
238 Ga0207690_10009076 3300025932 Bacteria 5902
239 Ga0207690_10011217 3300025932 Bacteria 5351
240 Ga0207690_10120864 3300025932 Bacteria 1902
241 Ga0207690_10170640 3300025932 Bacteria 1629
242 Ga0207690_10259607 3300025932 Bacteria 1345
243 Ga0207690_10622090 3300025932 Unclassified 883
244 Ga0207690_10673501 3300025932 Bacteria 849
245 Ga0207706_10008288 3300025933 Bacteria 9585
246 Ga0207706_10025496 3300025933 Bacteria 5297
247 Ga0207706_10061204 3300025933 Bacteria 3315
248 Ga0207706_10465600 3300025933 Bacteria 1093
249 Ga0207704_10531004 3300025938 Bacteria 953
250 Ga0207711_11259197 3300025941 Bacteria 681
251 Ga0207711_11562030 3300025941 Bacteria 603
252 Ga0207661_10067204 3300025944 Bacteria 2914
253 Ga0207661_10520481 3300025944 Bacteria 1088
254 Ga0207661_10571281 3300025944 Bacteria 1037
255 Ga0207661_11508767 3300025944 Bacteria 616
256 Ga0207679_10019082 3300025945 Bacteria 4601
257 Ga0207679_10956974 3300025945 Bacteria 784
258 Ga0207667_10030235 3300025949 Bacteria 5862
259 Ga0207667_10037667 3300025949 Bacteria 5169
260 Ga0207667_10084658 3300025949 Bacteria 3283
261 Ga0207667_10102242 3300025949 Bacteria 2956
262 Ga0207667_10179975 3300025949 Bacteria 2171
263 Ga0207667_10183168 3300025949 Bacteria 2150
264 Ga0207667_10241774 3300025949 Bacteria 1847
265 Ga0207667_10354690 3300025949 Bacteria 1496
266 Ga0207667_10471357 3300025949 Bacteria 1275
267 Ga0207667_12083404 3300025949 Bacteria 526
268 Ga0207640_10034110 3300025981 Bacteria 3173
269 Ga0207640_10087890 3300025981 Bacteria 2144
270 Ga0207640_10507068 3300025981 Bacteria 1006
271 Ga0207640_10915205 3300025981 Bacteria 767
272 Ga0207640_12101708 3300025981 Bacteria 512
273 Ga0207658_10190368 3300025986 Bacteria 1705
274 Ga0207658_10461961 3300025986 Bacteria 1125
275 Ga0207703_10343372 3300026035 Unclassified 1373
276 Ga0207639_10256540 3300026041 Bacteria 1527
277 Ga0207639_10496425 3300026041 Unclassified 1114
278 Ga0207639_10665192 3300026041 Bacteria 964
279 Ga0207639_10740535 3300026041 Bacteria 913
280 Ga0207639_10969074 3300026041 Bacteria 796
281 Ga0207678_10023177 3300026067 Bacteria 5431
282 Ga0207678_10080669 3300026067 Bacteria 2785
283 Ga0207678_10897043 3300026067 Bacteria 784
284 Ga0207678_11489586 3300026067 Unclassified 597
285 Ga0207702_10010126 3300026078 Bacteria 7897
286 Ga0207702_10030457 3300026078 Bacteria 4497
287 Ga0207702_10083747 3300026078 Bacteria 2775
288 Ga0207702_10219750 3300026078 Bacteria 1770
289 Ga0207702_10254474 3300026078 Bacteria 1651
290 Ga0207702_10314673 3300026078 Bacteria 1489
291 Ga0207702_10593124 3300026078 Bacteria 1087
292 Ga0207702_10822671 3300026078 Unclassified 919
293 Ga0207702_10835549 3300026078 Bacteria 911
294 Ga0207702_10842827 3300026078 Bacteria 907
295 Ga0207702_12147528 3300026078 Unclassified 548
296 Ga0207648_10061057 3300026089 Bacteria 3287
297 Ga0207648_10506441 3300026089 Bacteria 1105
298 Ga0207674_10132233 3300026116 Bacteria 2458
299 Ga0207674_10315053 3300026116 Bacteria 1513
300 Ga0207698_10005763 3300026142 Bacteria 7687
301 Ga0207698_10016415 3300026142 Bacteria 4989
302 Ga0207698_10059662 3300026142 Bacteria 2963
303 Ga0207698_10079117 3300026142 Bacteria 2643
304 Ga0207698_10896726 3300026142 Bacteria 894
305 Ga0207698_11211283 3300026142 Bacteria 769
306 Ga0207698_11243091 3300026142 Bacteria 759
307 Ga0207698_11810767 3300026142 Unclassified 626
308 Ga0268266_11108710 3300028379 Bacteria 766
309 Ga0307408_100441036 3300031548 Unclassified 1127
310 Ga0307405_10175013 3300031731 Bacteria 1535
311 Ga0307405_10202811 3300031731 Bacteria 1442
312 Ga0307405_10209212 3300031731 Bacteria 1423
313 Ga0307405_11204297 3300031731 Bacteria 655
314 Ga0307405_11217383 3300031731 Unclassified 652
315 Ga0307413_10012230 3300031824 Bacteria 4264
316 Ga0307413_10396669 3300031824 Bacteria 1080
317 Ga0307413_10679535 3300031824 Unclassified 853
318 Ga0307413_11840992 3300031824 Bacteria 542
319 Ga0307410_10045022 3300031852 Bacteria 2935
320 Ga0307410_10073374 3300031852 Bacteria 2379
321 Ga0307410_10118807 3300031852 Bacteria 1924
322 Ga0307410_10301071 3300031852 Bacteria 1265
323 Ga0307410_11318163 3300031852 Bacteria 632
324 Ga0307406_10268967 3300031901 Bacteria 1294
325 Ga0307406_10913687 3300031901 Bacteria 748
326 Ga0307407_10102953 3300031903 Bacteria 1776
327 Ga0307407_10642707 3300031903 Unclassified 794
328 Ga0307412_10082449 3300031911 Bacteria 2227
329 Ga0307412_10608669 3300031911 Bacteria 926
330 Ga0307409_100114715 3300031995 Bacteria 2267
331 Ga0307409_100117826 3300031995 Bacteria 2241
332 Ga0307409_100135292 3300031995 Bacteria 2114
333 Ga0307409_100311558 3300031995 Unclassified 1469
334 Ga0307409_100954809 3300031995 Bacteria 873
335 Ga0307409_102035817 3300031995 Bacteria 604
336 Ga0307409_102481244 3300031995 Bacteria 547
337 Ga0307416_100008744 3300032002 Bacteria 6562
338 Ga0307416_100088754 3300032002 Bacteria 2645
339 Ga0307416_100277672 3300032002 Bacteria 1650
340 Ga0307416_100325149 3300032002 Bacteria 1542
341 Ga0307416_100730762 3300032002 Bacteria 1081
342 Ga0307416_102248541 3300032002 Unclassified 646
343 Ga0307414_10275426 3300032004 Bacteria 1411
344 Ga0307414_10327780 3300032004 Unclassified 1306
345 Ga0307414_10872510 3300032004 Bacteria 824
346 Ga0307411_10084871 3300032005 Bacteria 2191
347 Ga0307411_10277099 3300032005 Bacteria 1333
348 Ga0307411_10287413 3300032005 Bacteria 1312
349 Ga0307411_10424126 3300032005 Bacteria 1106
350 Ga0307411_10838973 3300032005 Unclassified 812
351 Ga0307415_100043806 3300032126 Bacteria 2988
352 Ga0307415_100053997 3300032126 Bacteria 2741
353 Ga0307415_100230747 3300032126 Bacteria 1490
354 Ga0307415_100533547 3300032126 Bacteria 1032
355 Ga0307415_100545555 3300032126 Bacteria 1022
356 Ga0307415_101021828 3300032126 Bacteria 770
357 Ga0395899_0001656 3300037312 Bacteria 18573
358 Ga0395899_0011524 3300037312 Bacteria 6768
359 Ga0395899_0037068 3300037312 Bacteria 3656
360 Ga0395899_0050080 3300037312 Bacteria 3102
361 Ga0395899_0053012 3300037312 Bacteria 3004
362 Ga0395899_0060377 3300037312 Bacteria 2793
363 Ga0395899_0076150 3300037312 Bacteria 2450
364 Ga0395899_0114907 3300037312 Bacteria 1932
365 Ga0395899_0146065 3300037312 Bacteria 1679
366 Ga0395899_0259876 3300037312 Bacteria 1188
367 Ga0395899_0328907 3300037312 Bacteria 1027
368 Ga0395899_0343866 3300037312 Bacteria 999
369 Ga0395899_0367587 3300037312 Unclassified 958
370 Ga0395899_0408094 3300037312 Bacteria 897
371 Ga0395899_0563362 3300037312 Unclassified 730
372 Ga0395900_0000336 3300037418 Bacteria 69212
373 Ga0395900_0001394 3300037418 Bacteria 28915
374 Ga0395900_0002890 3300037418 Bacteria 18700
375 Ga0395900_0033844 3300037418 Bacteria 5258
376 Ga0395900_0055140 3300037418 Bacteria 4092
377 Ga0395900_0075837 3300037418 Bacteria 3456
378 Ga0395900_0090514 3300037418 Plasmid 3145
379 Ga0395900_0098145 3300037418 Bacteria 3010
380 Ga0395900_0120394 3300037418 Bacteria 2693
381 Ga0395900_0215443 3300037418 Bacteria 1938
382 Ga0395900_0260164 3300037418 Bacteria 1733
383 Ga0395900_0264197 3300037418 Bacteria 1717
384 Ga0395900_0293007 3300037418 Bacteria 1615
385 Ga0395900_0334101 3300037418 Bacteria 1492
386 Ga0395900_0450727 3300037418 Bacteria 1243
387 Ga0395900_0499748 3300037418 Bacteria 1166
388 Ga0395900_0579933 3300037418 Bacteria 1063
389 Ga0395900_0902404 3300037418 Bacteria 807
390 Ga0395900_1302525 3300037418 Unclassified 640
391 Ga0395900_1908472 3300037418 Bacteria 504
392 Ga0395900_1927354 3300037418 Bacteria 501
393 Ga0395898_0005813 3300037466 Bacteria 13272
394 Ga0395898_0043323 3300037466 Bacteria 4434
395 Ga0395898_0102346 3300037466 Bacteria 2749
396 Ga0395898_0133757 3300037466 Bacteria 2374
397 Ga0395898_0154932 3300037466 Bacteria 2192
398 Ga0395898_0205035 3300037466 Bacteria 1881
399 Ga0395898_0517435 3300037466 Bacteria 1134
400 Ga0395898_0643695 3300037466 Bacteria 1002
401 Ga0395898_0695901 3300037466 Bacteria 958
402 Ga0395898_1473911 3300037466 Bacteria 607
403 Ga0395905_0001106 3300037471 Bacteria 33891
404 Ga0395905_0005930 3300037471 Bacteria 12382
405 Ga0395905_0018444 3300037471 Bacteria 6623
406 Ga0395905_0020753 3300037471 Bacteria 6220
407 Ga0395905_0029534 3300037471 Bacteria 5165
408 Ga0395905_0057730 3300037471 Bacteria 3630
409 Ga0395905_0096797 3300037471 Bacteria 2771
410 Ga0395905_0107873 3300037471 Bacteria 2614
411 Ga0395905_0253280 3300037471 Bacteria 1644
412 Ga0395905_0448127 3300037471 Bacteria 1188
413 Ga0395905_0508653 3300037471 Bacteria 1105
414 Ga0395905_0540374 3300037471 Bacteria 1066
415 Ga0395905_0562541 3300037471 Bacteria 1041
416 Ga0395905_0616994 3300037471 Bacteria 986
417 Ga0395905_1015994 3300037471 Bacteria 732
418 Ga0395905_1130674 3300037471 Unclassified 686
419 Ga0395905_1561485 3300037471 Bacteria 565
420 Ga0395905_1637767 3300037471 Bacteria 548
421 Ga0395905_1785659 3300037471 Unclassified 521
422 Ga0395901_0000770 3300038443 Bacteria 35923
423 Ga0395901_0028509 3300038443 Bacteria 5741
424 Ga0395901_0057025 3300038443 Bacteria 4063
425 Ga0395901_0083360 3300038443 Bacteria 3341
426 Ga0395901_0083426 3300038443 Bacteria 3340
427 Ga0395901_0110392 3300038443 Bacteria 2887
428 Ga0395901_0146486 3300038443 Unclassified 2481
429 Ga0395901_0151409 3300038443 Bacteria 2437
430 Ga0395901_0186600 3300038443 Bacteria 2175
431 Ga0395901_0303822 3300038443 Bacteria 1654
432 Ga0395901_0540852 3300038443 Bacteria 1181
433 Ga0395901_1317091 3300038443 Bacteria 683
434 Ga0395901_1517650 3300038443 Bacteria 625
435 Ga0395901_1627893 3300038443 Bacteria 598
436 Ga0439445_0008474 3300042004 Bacteria 2405
437 Ga0439432_010454 3300042006 Bacteria 3211
438 Ga0439459_0087762 3300042438 Bacteria 744
439 Ga0466969_0420909 3300044656 Unclassified 607
440 Ga0466961_0105155 3300044693 Bacteria 1777
441 Ga0466961_0651193 3300044693 Unclassified 632
442 Ga0466963_0024100 3300044694 Bacteria 3872
443 Ga0466963_0052565 3300044694 Bacteria 2704
444 Ga0466963_0054733 3300044694 Bacteria 2652
445 Ga0466963_0062146 3300044694 Bacteria 2498
446 Ga0466963_0073077 3300044694 Bacteria 2311
447 Ga0466971_0025965 3300044719 Bacteria 2617
448 Ga0466971_0054324 3300044719 Bacteria 1805
449 Ga0466971_0152639 3300044719 Bacteria 1079
450 Ga0466970_0055232 3300044765 Bacteria 2121
451 Ga0466970_0231261 3300044765 Unclassified 1033
452 Ga0466957_0015168 3300044842 Bacteria 4498
453 Ga0466957_0162462 3300044842 Unclassified 1451
454 Ga0466957_0841745 3300044842 Bacteria 653
455 Ga0466957_1198930 3300044842 Bacteria 549
456 Ga0466960_0007103 3300044901 Bacteria 4528
457 Ga0466960_0672063 3300044901 Unclassified 619
458 Ga0466959_0065414 3300045049 Bacteria 2638
459 Ga0466958_0023831 3300045836 Bacteria 3597
460 Ga0466958_0088031 3300045836 Bacteria 1918
461 Ga0466958_0472173 3300045836 Unclassified 813
462 Ga0466967_0003430 3300045976 Bacteria 10341
463 Ga0466967_0005288 3300045976 Bacteria 8910
464 Ga0466967_0024994 3300045976 Bacteria 4918
465 Ga0466967_0035860 3300045976 Bacteria 4227
466 Ga0466967_0058604 3300045976 Bacteria 3404
467 Ga0466967_0061476 3300045976 Bacteria 3332
468 Ga0466967_0415938 3300045976 Bacteria 1310
469 Ga0466967_0688042 3300045976 Bacteria 1012
470 Ga0466967_0855523 3300045976 Bacteria 904
471 Ga0466967_0876677 3300045976 Bacteria 892
472 Ga0495642_0372244 3300046528 Unclassified 629
473 Ga0495621_0019365 3300046539 Bacteria 2222
474 Ga0496100_0306453 3300048903 Bacteria 1190
475 Ga0496109_0875358 3300048912 Bacteria 836
476 Ga0496110_0794333 3300048913 Bacteria 851
477 Ga0501047_0299073 3300049581 Bacteria 1452
478 Ga0501068_0167668 3300049584 Bacteria 1385
479 Ga0501073_0372082 3300049589 Bacteria 987
480 Ga0501080_0882422 3300049742 Unclassified 780
481 Ga0501268_029867 3300049765 Unclassified 982
482 Ga0501044_0868897 3300049823 Bacteria 778
483 Ga0501084_1019009 3300054114 Bacteria 696
484 Ga0501084_1337201 3300054114 Unclassified 600
485 Ga0466962_0060524 3300061719 Bacteria 1808
486 Ga0466962_0231379 3300061719 Bacteria 906
487 Ga0466962_0399953 3300061719 Bacteria 688
488 Ga0466962_0418623 3300061719 Unclassified 672

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300054114 Ga0501084_1337201 Ga0501084_1337201_48_314 78
2 3300001990 JGI24737J22298_10044515 JGI24737J22298_100445153 80
3 3300005344 Ga0070661_100027889 Ga0070661_1000278893 80
4 3300005563 Ga0068855_100060863 Ga0068855_1000608633 80
5 3300005614 Ga0068856_100011210 Ga0068856_10001121010 80
6 3300005616 Ga0068852_100004297 Ga0068852_1000042973 80
7 3300013100 Ga0157373_10502625 Ga0157373_105026253 80
8 3300013102 Ga0157371_10102338 Ga0157371_101023383 80
9 3300013105 Ga0157369_10049843 Ga0157369_100498433 80
10 3300013307 Ga0157372_11307414 Ga0157372_113074143 80
11 3300025920 Ga0207649_10293073 Ga0207649_102930733 80
12 3300025949 Ga0207667_10179975 Ga0207667_101799754 80
13 3300026078 Ga0207702_10010126 Ga0207702_100101264 80
14 3300026142 Ga0207698_10016415 Ga0207698_100164157 80
15 3300025981 Ga0207640_12101708 Ga0207640_121017082 82
16 3300048913 Ga0496110_0794333 Ga0496110_0794333_322_582 86
17 3300005327 Ga0070658_11448319 Ga0070658_114483192 87
18 3300005335 Ga0070666_10172968 Ga0070666_101729684 87
19 3300005339 Ga0070660_100583485 Ga0070660_1005834852 87
20 3300005355 Ga0070671_100652246 Ga0070671_1006522461 87
21 3300005367 Ga0070667_100974004 Ga0070667_1009740042 87
22 3300005457 Ga0070662_100011566 Ga0070662_1000115662 87
23 3300005459 Ga0068867_100237885 Ga0068867_1002378852 87
24 3300005530 Ga0070679_100895212 Ga0070679_1008952122 87
25 3300005539 Ga0068853_100161067 Ga0068853_1001610672 87
26 3300005614 Ga0068856_102016211 Ga0068856_1020162111 87
27 3300005718 Ga0068866_10429425 Ga0068866_104294252 87
28 3300006237 Ga0097621_100035316 Ga0097621_1000353164 87
29 3300006237 Ga0097621_100872222 Ga0097621_1008722222 87
30 3300006881 Ga0068865_100400994 Ga0068865_1004009942 87
31 3300009177 Ga0105248_10047878 Ga0105248_100478785 87
32 3300013102 Ga0157371_10136268 Ga0157371_101362682 87
33 3300013306 Ga0163162_10075213 Ga0163162_100752132 87
34 3300013308 Ga0157375_11264244 Ga0157375_112642442 87
35 3300014969 Ga0157376_10301935 Ga0157376_103019352 87
36 3300017792 Ga0163161_10096122 Ga0163161_100961225 87
37 3300025931 Ga0207644_10090695 Ga0207644_100906952 87
38 3300025933 Ga0207706_10008288 Ga0207706_100082886 87
39 3300025938 Ga0207704_10531004 Ga0207704_105310042 87
40 3300025941 Ga0207711_11259197 Ga0207711_112591972 87
41 3300025986 Ga0207658_10190368 Ga0207658_101903682 87
42 3300026035 Ga0207703_10343372 Ga0207703_103433722 87
43 3300026041 Ga0207639_10665192 Ga0207639_106651922 87
44 3300026089 Ga0207648_10506441 Ga0207648_105064412 87
45 3300026142 Ga0207698_10896726 Ga0207698_108967262 87
46 3300031731 Ga0307405_10175013 Ga0307405_101750133 87
47 3300031731 Ga0307405_11204297 Ga0307405_112042972 87
48 3300031824 Ga0307413_11840992 Ga0307413_118409922 87
49 3300031852 Ga0307410_10045022 Ga0307410_100450224 87
50 3300031852 Ga0307410_10301071 Ga0307410_103010713 87
51 3300031852 Ga0307410_11318163 Ga0307410_113181632 87
52 3300031901 Ga0307406_10913687 Ga0307406_109136872 87
53 3300031903 Ga0307407_10102953 Ga0307407_101029534 87
54 3300031903 Ga0307407_10642707 Ga0307407_106427073 87
55 3300031995 Ga0307409_100114715 Ga0307409_1001147152 87
56 3300031995 Ga0307409_102035817 Ga0307409_1020358172 87
57 3300032002 Ga0307416_100088754 Ga0307416_1000887544 87
58 3300032002 Ga0307416_100730762 Ga0307416_1007307623 87
59 3300032005 Ga0307411_10287413 Ga0307411_102874132 87
60 3300032126 Ga0307415_100053997 Ga0307415_1000539975 87
61 3300032126 Ga0307415_100533547 Ga0307415_1005335472 87
62 3300037312 Ga0395899_0037068 Ga0395899_0037068_2594_2857 87
63 3300037418 Ga0395900_0001394 Ga0395900_0001394_4140_4403 87
64 3300037418 Ga0395900_0450727 Ga0395900_0450727_186_461 87
65 3300037418 Ga0395900_1927354 Ga0395900_1927354_92_355 87
66 3300037466 Ga0395898_0154932 Ga0395898_0154932_493_756 87
67 3300037466 Ga0395898_0695901 Ga0395898_0695901_135_398 87
68 3300037471 Ga0395905_0001106 Ga0395905_0001106_24431_24694 87
69 3300037471 Ga0395905_0107873 Ga0395905_0107873_1167_1442 87
70 3300038443 Ga0395901_0303822 Ga0395901_0303822_227_490 87
71 3300042438 Ga0439459_0087762 Ga0439459_0087762_75_338 87
72 3300044842 Ga0466957_0841745 Ga0466957_0841745_96_359 87
73 3300046528 Ga0495642_0372244 Ga0495642_0372244_326_589 87
74 3300046539 Ga0495621_0019365 Ga0495621_0019365_922_1185 87
75 3300048903 Ga0496100_0306453 Ga0496100_0306453_417_680 87
76 3300048912 Ga0496109_0875358 Ga0496109_0875358_48_311 87
77 3300061719 Ga0466962_0060524 Ga0466962_0060524_123_386 87
78 3300001979 JGI24740J21852_10112529 JGI24740J21852_101125292 88
79 3300001990 JGI24737J22298_10053363 JGI24737J22298_100533632 88
80 3300003323 rootH1_10049039 rootH1_100490392 88
81 3300005327 Ga0070658_10003471 Ga0070658_1000347111 88
82 3300005327 Ga0070658_10061266 Ga0070658_100612662 88
83 3300005327 Ga0070658_10102197 Ga0070658_101021971 88
84 3300005327 Ga0070658_10222541 Ga0070658_102225412 88
85 3300005327 Ga0070658_10406753 Ga0070658_104067533 88
86 3300005327 Ga0070658_10896471 Ga0070658_108964712 88
87 3300005327 Ga0070658_11380363 Ga0070658_113803632 88
88 3300005329 Ga0070683_100002165 Ga0070683_10000216511 88
89 3300005329 Ga0070683_100150197 Ga0070683_1001501972 88
90 3300005329 Ga0070683_101015834 Ga0070683_1010158341 88
91 3300005329 Ga0070683_101125936 Ga0070683_1011259362 88
92 3300005335 Ga0070666_10038626 Ga0070666_100386264 88
93 3300005336 Ga0070680_100000406 Ga0070680_1000004063 88
94 3300005336 Ga0070680_100014855 Ga0070680_1000148554 88
95 3300005336 Ga0070680_100065871 Ga0070680_1000658714 88
96 3300005336 Ga0070680_100255921 Ga0070680_1002559212 88
97 3300005337 Ga0070682_100717276 Ga0070682_1007172762 88
98 3300005338 Ga0068868_100213742 Ga0068868_1002137422 88
99 3300005339 Ga0070660_100039308 Ga0070660_1000393086 88
100 3300005339 Ga0070660_100142968 Ga0070660_1001429681 88
101 3300005339 Ga0070660_100174220 Ga0070660_1001742204 88
102 3300005339 Ga0070660_100186629 Ga0070660_1001866293 88
103 3300005339 Ga0070660_100423697 Ga0070660_1004236973 88
104 3300005344 Ga0070661_100012128 Ga0070661_1000121283 88
105 3300005344 Ga0070661_100123408 Ga0070661_1001234083 88
106 3300005344 Ga0070661_100164979 Ga0070661_1001649793 88
107 3300005344 Ga0070661_100287256 Ga0070661_1002872561 88
108 3300005345 Ga0070692_10043610 Ga0070692_100436103 88
109 3300005345 Ga0070692_10230543 Ga0070692_102305432 88
110 3300005345 Ga0070692_10386466 Ga0070692_103864662 88
111 3300005345 Ga0070692_10629429 Ga0070692_106294292 88
112 3300005347 Ga0070668_100788867 Ga0070668_1007888672 88
113 3300005355 Ga0070671_100160636 Ga0070671_1001606363 88
114 3300005364 Ga0070673_100522807 Ga0070673_1005228073 88
115 3300005366 Ga0070659_100007212 Ga0070659_1000072124 88
116 3300005366 Ga0070659_100104690 Ga0070659_1001046902 88
117 3300005366 Ga0070659_100137331 Ga0070659_1001373312 88
118 3300005366 Ga0070659_100173702 Ga0070659_1001737022 88
119 3300005366 Ga0070659_100619168 Ga0070659_1006191682 88
120 3300005366 Ga0070659_100711626 Ga0070659_1007116262 88
121 3300005366 Ga0070659_101152851 Ga0070659_1011528512 88
122 3300005366 Ga0070659_101153057 Ga0070659_1011530572 88
123 3300005366 Ga0070659_102094306 Ga0070659_1020943062 88
124 3300005367 Ga0070667_100302407 Ga0070667_1003024073 88
125 3300005435 Ga0070714_100132585 Ga0070714_1001325854 88
126 3300005435 Ga0070714_100170620 Ga0070714_1001706205 88
127 3300005435 Ga0070714_100825545 Ga0070714_1008255452 88
128 3300005435 Ga0070714_101478539 Ga0070714_1014785392 88
129 3300005435 Ga0070714_101683676 Ga0070714_1016836762 88
130 3300005455 Ga0070663_100041359 Ga0070663_1000413595 88
131 3300005455 Ga0070663_100277031 Ga0070663_1002770313 88
132 3300005457 Ga0070662_100028062 Ga0070662_1000280625 88
133 3300005458 Ga0070681_10184695 Ga0070681_101846954 88
134 3300005458 Ga0070681_10385139 Ga0070681_103851391 88
135 3300005458 Ga0070681_10740196 Ga0070681_107401961 88
136 3300005458 Ga0070681_10960181 Ga0070681_109601812 88
137 3300005459 Ga0068867_100071155 Ga0068867_1000711553 88
138 3300005530 Ga0070679_100060072 Ga0070679_1000600723 88
139 3300005530 Ga0070679_100225644 Ga0070679_1002256443 88
140 3300005530 Ga0070679_100250873 Ga0070679_1002508733 88
141 3300005530 Ga0070679_102153650 Ga0070679_1021536501 88
142 3300005535 Ga0070684_100032970 Ga0070684_1000329704 88
143 3300005535 Ga0070684_100804699 Ga0070684_1008046992 88
144 3300005535 Ga0070684_101034588 Ga0070684_1010345881 88
145 3300005539 Ga0068853_100612475 Ga0068853_1006124752 88
146 3300005539 Ga0068853_101171866 Ga0068853_1011718662 88
147 3300005539 Ga0068853_101273152 Ga0068853_1012731521 88
148 3300005546 Ga0070696_101007458 Ga0070696_1010074581 88
149 3300005547 Ga0070693_100107599 Ga0070693_1001075994 88
150 3300005548 Ga0070665_101200268 Ga0070665_1012002682 88
151 3300005563 Ga0068855_100044730 Ga0068855_1000447304 88
152 3300005563 Ga0068855_100204771 Ga0068855_1002047713 88
153 3300005563 Ga0068855_100373268 Ga0068855_1003732682 88
154 3300005563 Ga0068855_100404542 Ga0068855_1004045423 88
155 3300005563 Ga0068855_100741020 Ga0068855_1007410202 88
156 3300005563 Ga0068855_100809089 Ga0068855_1008090892 88
157 3300005563 Ga0068855_100999816 Ga0068855_1009998162 88
158 3300005563 Ga0068855_101074476 Ga0068855_1010744762 88
159 3300005563 Ga0068855_101258928 Ga0068855_1012589283 88
160 3300005563 Ga0068855_101444957 Ga0068855_1014449572 88
161 3300005563 Ga0068855_101779553 Ga0068855_1017795532 88
162 3300005563 Ga0068855_102160479 Ga0068855_1021604792 88
163 3300005564 Ga0070664_100049737 Ga0070664_1000497373 88
164 3300005564 Ga0070664_100320616 Ga0070664_1003206161 88
165 3300005564 Ga0070664_100637911 Ga0070664_1006379113 88
166 3300005577 Ga0068857_100103545 Ga0068857_1001035454 88
167 3300005577 Ga0068857_100289045 Ga0068857_1002890453 88
168 3300005578 Ga0068854_100020244 Ga0068854_1000202444 88
169 3300005578 Ga0068854_100025501 Ga0068854_1000255014 88
170 3300005578 Ga0068854_100069812 Ga0068854_1000698122 88
171 3300005578 Ga0068854_100337153 Ga0068854_1003371533 88
172 3300005614 Ga0068856_100119339 Ga0068856_1001193392 88
173 3300005614 Ga0068856_100236350 Ga0068856_1002363502 88
174 3300005614 Ga0068856_100301739 Ga0068856_1003017393 88
175 3300005614 Ga0068856_100567228 Ga0068856_1005672281 88
176 3300005614 Ga0068856_101264728 Ga0068856_1012647282 88
177 3300005614 Ga0068856_102379741 Ga0068856_1023797412 88
178 3300005615 Ga0070702_101630616 Ga0070702_1016306161 88
179 3300005616 Ga0068852_100006103 Ga0068852_1000061034 88
180 3300005616 Ga0068852_100056586 Ga0068852_1000565864 88
181 3300005616 Ga0068852_100136113 Ga0068852_1001361132 88
182 3300005616 Ga0068852_100172570 Ga0068852_1001725704 88
183 3300005616 Ga0068852_100384523 Ga0068852_1003845232 88
184 3300005616 Ga0068852_100395434 Ga0068852_1003954343 88
185 3300005616 Ga0068852_100822797 Ga0068852_1008227973 88
186 3300005616 Ga0068852_101613827 Ga0068852_1016138272 88
187 3300005616 Ga0068852_101885481 Ga0068852_1018854812 88
188 3300005616 Ga0068852_102179321 Ga0068852_1021793212 88
189 3300005834 Ga0068851_10029382 Ga0068851_100293826 88
190 3300006028 Ga0070717_11571497 Ga0070717_115714971 88
191 3300009093 Ga0105240_10136153 Ga0105240_101361532 88
192 3300009093 Ga0105240_10262243 Ga0105240_102622432 88
193 3300009093 Ga0105240_10334650 Ga0105240_103346504 88
194 3300009093 Ga0105240_12291214 Ga0105240_122912141 88
195 3300009093 Ga0105240_12751697 Ga0105240_127516972 88
196 3300009545 Ga0105237_10360543 Ga0105237_103605432 88
197 3300009551 Ga0105238_10604791 Ga0105238_106047913 88
198 3300009551 Ga0105238_12316722 Ga0105238_123167222 88
199 3300010375 Ga0105239_10559244 Ga0105239_105592443 88
200 3300010375 Ga0105239_12885371 Ga0105239_128853712 88
201 3300013100 Ga0157373_10090777 Ga0157373_100907773 88
202 3300013100 Ga0157373_10093962 Ga0157373_100939622 88
203 3300013100 Ga0157373_10122994 Ga0157373_101229943 88
204 3300013100 Ga0157373_10239231 Ga0157373_102392312 88
205 3300013100 Ga0157373_10458750 Ga0157373_104587502 88
206 3300013100 Ga0157373_10557814 Ga0157373_105578142 88
207 3300013100 Ga0157373_11055080 Ga0157373_110550802 88
208 3300013102 Ga0157371_10065589 Ga0157371_100655894 88
209 3300013102 Ga0157371_10094652 Ga0157371_100946523 88
210 3300013102 Ga0157371_10102381 Ga0157371_101023812 88
211 3300013102 Ga0157371_10113752 Ga0157371_101137521 88
212 3300013102 Ga0157371_10128882 Ga0157371_101288824 88
213 3300013102 Ga0157371_10174954 Ga0157371_101749541 88
214 3300013102 Ga0157371_10482459 Ga0157371_104824593 88
215 3300013102 Ga0157371_10919220 Ga0157371_109192202 88
216 3300013102 Ga0157371_11414829 Ga0157371_114148292 88
217 3300013104 Ga0157370_10094507 Ga0157370_100945073 88
218 3300013104 Ga0157370_10099268 Ga0157370_100992682 88
219 3300013104 Ga0157370_10146191 Ga0157370_101461914 88
220 3300013104 Ga0157370_10846134 Ga0157370_108461342 88
221 3300013104 Ga0157370_10885916 Ga0157370_108859161 88
222 3300013104 Ga0157370_10887244 Ga0157370_108872441 88
223 3300013104 Ga0157370_11239386 Ga0157370_112393862 88
224 3300013104 Ga0157370_11417802 Ga0157370_114178022 88
225 3300013105 Ga0157369_10005054 Ga0157369_1000505411 88
226 3300013105 Ga0157369_10203373 Ga0157369_102033734 88
227 3300013105 Ga0157369_10276880 Ga0157369_102768802 88
228 3300013105 Ga0157369_10432286 Ga0157369_104322864 88
229 3300013105 Ga0157369_10720720 Ga0157369_107207202 88
230 3300013105 Ga0157369_10996497 Ga0157369_109964972 88
231 3300013105 Ga0157369_12316454 Ga0157369_123164542 88
232 3300013307 Ga0157372_10059383 Ga0157372_100593832 88
233 3300013307 Ga0157372_10421495 Ga0157372_104214954 88
234 3300013307 Ga0157372_10473895 Ga0157372_104738952 88
235 3300013307 Ga0157372_10747958 Ga0157372_107479582 88
236 3300013307 Ga0157372_12113336 Ga0157372_121133362 88
237 3300013307 Ga0157372_12305679 Ga0157372_123056792 88
238 3300013307 Ga0157372_13429403 Ga0157372_134294031 88
239 3300020082 Ga0206353_11339572 Ga0206353_113395724 88
240 3300025321 Ga0207656_10065913 Ga0207656_100659131 88
241 3300025901 Ga0207688_10177649 Ga0207688_101776492 88
242 3300025903 Ga0207680_10183538 Ga0207680_101835383 88
243 3300025904 Ga0207647_10008080 Ga0207647_100080802 88
244 3300025904 Ga0207647_10056487 Ga0207647_100564875 88
245 3300025904 Ga0207647_10099366 Ga0207647_100993664 88
246 3300025904 Ga0207647_10202700 Ga0207647_102027003 88
247 3300025907 Ga0207645_10032903 Ga0207645_100329035 88
248 3300025909 Ga0207705_10000151 Ga0207705_1000015124 88
249 3300025909 Ga0207705_10003327 Ga0207705_100033274 88
250 3300025909 Ga0207705_10011443 Ga0207705_100114432 88
251 3300025909 Ga0207705_10056365 Ga0207705_100563654 88
252 3300025909 Ga0207705_10134775 Ga0207705_101347753 88
253 3300025909 Ga0207705_10768412 Ga0207705_107684121 88
254 3300025909 Ga0207705_10969259 Ga0207705_109692591 88
255 3300025911 Ga0207654_11381392 Ga0207654_113813922 88
256 3300025912 Ga0207707_10160872 Ga0207707_101608722 88
257 3300025912 Ga0207707_10274616 Ga0207707_102746163 88
258 3300025912 Ga0207707_11647794 Ga0207707_116477941 88
259 3300025913 Ga0207695_10181081 Ga0207695_101810812 88
260 3300025913 Ga0207695_10592609 Ga0207695_105926093 88
261 3300025913 Ga0207695_10676261 Ga0207695_106762613 88
262 3300025914 Ga0207671_10762927 Ga0207671_107629271 88
263 3300025916 Ga0207663_11430481 Ga0207663_114304811 88
264 3300025917 Ga0207660_10000515 Ga0207660_100005157 88
265 3300025917 Ga0207660_10003161 Ga0207660_100031612 88
266 3300025917 Ga0207660_10013286 Ga0207660_100132864 88
267 3300025917 Ga0207660_10061262 Ga0207660_100612623 88
268 3300025919 Ga0207657_10039431 Ga0207657_100394313 88
269 3300025919 Ga0207657_10059875 Ga0207657_100598753 88
270 3300025919 Ga0207657_10135110 Ga0207657_101351102 88
271 3300025919 Ga0207657_10236534 Ga0207657_102365342 88
272 3300025919 Ga0207657_10342456 Ga0207657_103424563 88
273 3300025919 Ga0207657_10528351 Ga0207657_105283513 88
274 3300025920 Ga0207649_10007523 Ga0207649_100075233 88
275 3300025920 Ga0207649_10010370 Ga0207649_100103708 88
276 3300025920 Ga0207649_10363101 Ga0207649_103631012 88
277 3300025921 Ga0207652_10129994 Ga0207652_101299944 88
278 3300025921 Ga0207652_10191918 Ga0207652_101919183 88
279 3300025921 Ga0207652_10277644 Ga0207652_102776444 88
280 3300025921 Ga0207652_10365920 Ga0207652_103659202 88
281 3300025921 Ga0207652_11508389 Ga0207652_115083892 88
282 3300025929 Ga0207664_10969612 Ga0207664_109696122 88
283 3300025929 Ga0207664_11053171 Ga0207664_110531713 88
284 3300025932 Ga0207690_10009076 Ga0207690_100090766 88
285 3300025932 Ga0207690_10011217 Ga0207690_100112174 88
286 3300025932 Ga0207690_10120864 Ga0207690_101208642 88
287 3300025932 Ga0207690_10170640 Ga0207690_101706403 88
288 3300025932 Ga0207690_10259607 Ga0207690_102596073 88
289 3300025932 Ga0207690_10622090 Ga0207690_106220902 88
290 3300025932 Ga0207690_10673501 Ga0207690_106735012 88
291 3300025933 Ga0207706_10025496 Ga0207706_100254967 88
292 3300025933 Ga0207706_10061204 Ga0207706_100612047 88
293 3300025933 Ga0207706_10465600 Ga0207706_104656002 88
294 3300025941 Ga0207711_11562030 Ga0207711_115620302 88
295 3300025944 Ga0207661_10067204 Ga0207661_100672042 88
296 3300025944 Ga0207661_10520481 Ga0207661_105204812 88
297 3300025944 Ga0207661_10571281 Ga0207661_105712812 88
298 3300025944 Ga0207661_11508767 Ga0207661_115087672 88
299 3300025945 Ga0207679_10019082 Ga0207679_100190828 88
300 3300025945 Ga0207679_10956974 Ga0207679_109569743 88
301 3300025949 Ga0207667_10030235 Ga0207667_100302354 88
302 3300025949 Ga0207667_10037667 Ga0207667_100376673 88
303 3300025949 Ga0207667_10084658 Ga0207667_100846583 88
304 3300025949 Ga0207667_10102242 Ga0207667_101022421 88
305 3300025949 Ga0207667_10183168 Ga0207667_101831682 88
306 3300025949 Ga0207667_10241774 Ga0207667_102417742 88
307 3300025949 Ga0207667_10354690 Ga0207667_103546902 88
308 3300025949 Ga0207667_10471357 Ga0207667_104713572 88
309 3300025949 Ga0207667_12083404 Ga0207667_120834041 88
310 3300025981 Ga0207640_10034110 Ga0207640_100341106 88
311 3300025981 Ga0207640_10087890 Ga0207640_100878903 88
312 3300025981 Ga0207640_10507068 Ga0207640_105070683 88
313 3300025981 Ga0207640_10915205 Ga0207640_109152052 88
314 3300025986 Ga0207658_10461961 Ga0207658_104619613 88
315 3300026041 Ga0207639_10256540 Ga0207639_102565402 88
316 3300026041 Ga0207639_10496425 Ga0207639_104964253 88
317 3300026041 Ga0207639_10740535 Ga0207639_107405352 88
318 3300026041 Ga0207639_10969074 Ga0207639_109690742 88
319 3300026067 Ga0207678_10023177 Ga0207678_100231775 88
320 3300026067 Ga0207678_10080669 Ga0207678_100806694 88
321 3300026067 Ga0207678_10897043 Ga0207678_108970432 88
322 3300026067 Ga0207678_11489586 Ga0207678_114895861 88
323 3300026078 Ga0207702_10030457 Ga0207702_100304577 88
324 3300026078 Ga0207702_10083747 Ga0207702_100837474 88
325 3300026078 Ga0207702_10219750 Ga0207702_102197502 88
326 3300026078 Ga0207702_10254474 Ga0207702_102544742 88
327 3300026078 Ga0207702_10314673 Ga0207702_103146732 88
328 3300026078 Ga0207702_10593124 Ga0207702_105931242 88
329 3300026078 Ga0207702_10822671 Ga0207702_108226712 88
330 3300026078 Ga0207702_10835549 Ga0207702_108355492 88
331 3300026078 Ga0207702_10842827 Ga0207702_108428272 88
332 3300026078 Ga0207702_12147528 Ga0207702_121475282 88
333 3300026089 Ga0207648_10061057 Ga0207648_100610576 88
334 3300026116 Ga0207674_10132233 Ga0207674_101322333 88
335 3300026116 Ga0207674_10315053 Ga0207674_103150533 88
336 3300026142 Ga0207698_10005763 Ga0207698_100057633 88
337 3300026142 Ga0207698_10059662 Ga0207698_100596624 88
338 3300026142 Ga0207698_10079117 Ga0207698_100791173 88
339 3300026142 Ga0207698_11211283 Ga0207698_112112832 88
340 3300026142 Ga0207698_11243091 Ga0207698_112430912 88
341 3300026142 Ga0207698_11810767 Ga0207698_118107672 88
342 3300028379 Ga0268266_11108710 Ga0268266_111087102 88
343 3300031548 Ga0307408_100441036 Ga0307408_1004410362 88
344 3300031731 Ga0307405_10202811 Ga0307405_102028111 88
345 3300031731 Ga0307405_10209212 Ga0307405_102092122 88
346 3300031731 Ga0307405_11217383 Ga0307405_112173832 88
347 3300031824 Ga0307413_10012230 Ga0307413_100122303 88
348 3300031824 Ga0307413_10396669 Ga0307413_103966693 88
349 3300031824 Ga0307413_10679535 Ga0307413_106795352 88
350 3300031852 Ga0307410_10073374 Ga0307410_100733743 88
351 3300031852 Ga0307410_10118807 Ga0307410_101188072 88
352 3300031901 Ga0307406_10268967 Ga0307406_102689672 88
353 3300031911 Ga0307412_10082449 Ga0307412_100824492 88
354 3300031911 Ga0307412_10608669 Ga0307412_106086691 88
355 3300031995 Ga0307409_100117826 Ga0307409_1001178262 88
356 3300031995 Ga0307409_100135292 Ga0307409_1001352922 88
357 3300031995 Ga0307409_100311558 Ga0307409_1003115582 88
358 3300031995 Ga0307409_100954809 Ga0307409_1009548092 88
359 3300031995 Ga0307409_102481244 Ga0307409_1024812442 88
360 3300032002 Ga0307416_100008744 Ga0307416_1000087442 88
361 3300032002 Ga0307416_100277672 Ga0307416_1002776723 88
362 3300032002 Ga0307416_100325149 Ga0307416_1003251492 88
363 3300032002 Ga0307416_102248541 Ga0307416_1022485412 88
364 3300032004 Ga0307414_10275426 Ga0307414_102754262 88
365 3300032004 Ga0307414_10327780 Ga0307414_103277802 88
366 3300032004 Ga0307414_10872510 Ga0307414_108725102 88
367 3300032005 Ga0307411_10084871 Ga0307411_100848714 88
368 3300032005 Ga0307411_10277099 Ga0307411_102770993 88
369 3300032005 Ga0307411_10424126 Ga0307411_104241263 88
370 3300032005 Ga0307411_10838973 Ga0307411_108389731 88
371 3300032126 Ga0307415_100043806 Ga0307415_1000438067 88
372 3300032126 Ga0307415_100230747 Ga0307415_1002307473 88
373 3300032126 Ga0307415_100545555 Ga0307415_1005455553 88
374 3300032126 Ga0307415_101021828 Ga0307415_1010218282 88
375 3300037312 Ga0395899_0001656 Ga0395899_0001656_16822_17088 88
376 3300037312 Ga0395899_0011524 Ga0395899_0011524_3336_3605 88
377 3300037312 Ga0395899_0050080 Ga0395899_0050080_537_803 88
378 3300037312 Ga0395899_0053012 Ga0395899_0053012_2457_2723 88
379 3300037312 Ga0395899_0060377 Ga0395899_0060377_515_781 88
380 3300037312 Ga0395899_0076150 Ga0395899_0076150_1585_1851 88
381 3300037312 Ga0395899_0114907 Ga0395899_0114907_1342_1611 88
382 3300037312 Ga0395899_0146065 Ga0395899_0146065_901_1170 88
383 3300037312 Ga0395899_0259876 Ga0395899_0259876_746_1021 88
384 3300037312 Ga0395899_0328907 Ga0395899_0328907_33_302 88
385 3300037312 Ga0395899_0343866 Ga0395899_0343866_165_431 88
386 3300037312 Ga0395899_0367587 Ga0395899_0367587_302_574 88
387 3300037312 Ga0395899_0408094 Ga0395899_0408094_417_683 88
388 3300037312 Ga0395899_0563362 Ga0395899_0563362_219_485 88
389 3300037418 Ga0395900_0000336 Ga0395900_0000336_36978_37244 88
390 3300037418 Ga0395900_0002890 Ga0395900_0002890_15332_15598 88
391 3300037418 Ga0395900_0033844 Ga0395900_0033844_1085_1351 88
392 3300037418 Ga0395900_0055140 Ga0395900_0055140_3735_4001 88
393 3300037418 Ga0395900_0075837 Ga0395900_0075837_1324_1590 88
394 3300037418 Ga0395900_0090514 Ga0395900_0090514_2739_3005 88
395 3300037418 Ga0395900_0098145 Ga0395900_0098145_883_1149 88
396 3300037418 Ga0395900_0120394 Ga0395900_0120394_2005_2271 88
397 3300037418 Ga0395900_0215443 Ga0395900_0215443_1208_1483 88
398 3300037418 Ga0395900_0260164 Ga0395900_0260164_377_646 88
399 3300037418 Ga0395900_0264197 Ga0395900_0264197_966_1235 88
400 3300037418 Ga0395900_0293007 Ga0395900_0293007_1247_1519 88
401 3300037418 Ga0395900_0334101 Ga0395900_0334101_340_606 88
402 3300037418 Ga0395900_0499748 Ga0395900_0499748_478_744 88
403 3300037418 Ga0395900_0579933 Ga0395900_0579933_558_824 88
404 3300037418 Ga0395900_0902404 Ga0395900_0902404_440_706 88
405 3300037418 Ga0395900_1302525 Ga0395900_1302525_262_528 88
406 3300037418 Ga0395900_1908472 Ga0395900_1908472_55_324 88
407 3300037466 Ga0395898_0005813 Ga0395898_0005813_3247_3516 88
408 3300037466 Ga0395898_0043323 Ga0395898_0043323_3348_3614 88
409 3300037466 Ga0395898_0102346 Ga0395898_0102346_1375_1647 88
410 3300037466 Ga0395898_0133757 Ga0395898_0133757_266_532 88
411 3300037466 Ga0395898_0205035 Ga0395898_0205035_454_720 88
412 3300037466 Ga0395898_0517435 Ga0395898_0517435_498_767 88
413 3300037466 Ga0395898_0643695 Ga0395898_0643695_26_292 88
414 3300037466 Ga0395898_1473911 Ga0395898_1473911_200_475 88
415 3300037471 Ga0395905_0005930 Ga0395905_0005930_1486_1752 88
416 3300037471 Ga0395905_0018444 Ga0395905_0018444_5803_6072 88
417 3300037471 Ga0395905_0020753 Ga0395905_0020753_2687_2953 88
418 3300037471 Ga0395905_0029534 Ga0395905_0029534_105_371 88
419 3300037471 Ga0395905_0057730 Ga0395905_0057730_1361_1627 88
420 3300037471 Ga0395905_0096797 Ga0395905_0096797_2306_2581 88
421 3300037471 Ga0395905_0253280 Ga0395905_0253280_200_466 88
422 3300037471 Ga0395905_0448127 Ga0395905_0448127_569_835 88
423 3300037471 Ga0395905_0508653 Ga0395905_0508653_801_1067 88
424 3300037471 Ga0395905_0540374 Ga0395905_0540374_460_726 88
425 3300037471 Ga0395905_0562541 Ga0395905_0562541_690_959 88
426 3300037471 Ga0395905_0616994 Ga0395905_0616994_304_570 88
427 3300037471 Ga0395905_1015994 Ga0395905_1015994_424_690 88
428 3300037471 Ga0395905_1130674 Ga0395905_1130674_373_645 88
429 3300037471 Ga0395905_1561485 Ga0395905_1561485_180_446 88
430 3300037471 Ga0395905_1637767 Ga0395905_1637767_83_352 88
431 3300037471 Ga0395905_1785659 Ga0395905_1785659_25_291 88
432 3300038443 Ga0395901_0000770 Ga0395901_0000770_18409_18675 88
433 3300038443 Ga0395901_0028509 Ga0395901_0028509_4602_4871 88
434 3300038443 Ga0395901_0057025 Ga0395901_0057025_1240_1506 88
435 3300038443 Ga0395901_0083360 Ga0395901_0083360_1504_1773 88
436 3300038443 Ga0395901_0083426 Ga0395901_0083426_2224_2490 88
437 3300038443 Ga0395901_0110392 Ga0395901_0110392_2022_2288 88
438 3300038443 Ga0395901_0146486 Ga0395901_0146486_504_770 88
439 3300038443 Ga0395901_0151409 Ga0395901_0151409_2069_2341 88
440 3300038443 Ga0395901_0186600 Ga0395901_0186600_637_912 88
441 3300038443 Ga0395901_0540852 Ga0395901_0540852_726_995 88
442 3300038443 Ga0395901_1317091 Ga0395901_1317091_382_648 88
443 3300038443 Ga0395901_1517650 Ga0395901_1517650_331_597 88
444 3300038443 Ga0395901_1627893 Ga0395901_1627893_162_428 88
445 3300042004 Ga0439445_0008474 Ga0439445_0008474_1282_1548 88
446 3300042006 Ga0439432_010454 Ga0439432_010454_1539_1805 88
447 3300044656 Ga0466969_0420909 Ga0466969_0420909_99_380 88
448 3300044693 Ga0466961_0105155 Ga0466961_0105155_1109_1375 88
449 3300044693 Ga0466961_0651193 Ga0466961_0651193_310_591 88
450 3300044694 Ga0466963_0024100 Ga0466963_0024100_1487_1753 88
451 3300044694 Ga0466963_0052565 Ga0466963_0052565_2191_2460 88
452 3300044694 Ga0466963_0054733 Ga0466963_0054733_2196_2462 88
453 3300044694 Ga0466963_0062146 Ga0466963_0062146_411_680 88
454 3300044694 Ga0466963_0073077 Ga0466963_0073077_1023_1292 88
455 3300044719 Ga0466971_0025965 Ga0466971_0025965_1782_2051 88
456 3300044719 Ga0466971_0054324 Ga0466971_0054324_823_1089 88
457 3300044719 Ga0466971_0152639 Ga0466971_0152639_430_696 88
458 3300044765 Ga0466970_0055232 Ga0466970_0055232_1195_1461 88
459 3300044765 Ga0466970_0231261 Ga0466970_0231261_385_666 88
460 3300044842 Ga0466957_0015168 Ga0466957_0015168_3003_3269 88
461 3300044842 Ga0466957_0162462 Ga0466957_0162462_141_410 88
462 3300044842 Ga0466957_1198930 Ga0466957_1198930_254_532 88
463 3300044901 Ga0466960_0007103 Ga0466960_0007103_285_551 88
464 3300044901 Ga0466960_0672063 Ga0466960_0672063_298_564 88
465 3300045049 Ga0466959_0065414 Ga0466959_0065414_1041_1307 88
466 3300045836 Ga0466958_0023831 Ga0466958_0023831_1358_1624 88
467 3300045836 Ga0466958_0088031 Ga0466958_0088031_110_388 88
468 3300045836 Ga0466958_0472173 Ga0466958_0472173_405_671 88
469 3300045976 Ga0466967_0003430 Ga0466967_0003430_700_978 88
470 3300045976 Ga0466967_0005288 Ga0466967_0005288_6937_7206 88
471 3300045976 Ga0466967_0024994 Ga0466967_0024994_2295_2561 88
472 3300045976 Ga0466967_0035860 Ga0466967_0035860_1332_1601 88
473 3300045976 Ga0466967_0058604 Ga0466967_0058604_2414_2692 88
474 3300045976 Ga0466967_0061476 Ga0466967_0061476_1095_1373 88
475 3300045976 Ga0466967_0415938 Ga0466967_0415938_811_1080 88
476 3300045976 Ga0466967_0688042 Ga0466967_0688042_526_795 88
477 3300045976 Ga0466967_0855523 Ga0466967_0855523_284_556 88
478 3300045976 Ga0466967_0876677 Ga0466967_0876677_244_510 88
479 3300049581 Ga0501047_0299073 Ga0501047_0299073_71_337 88
480 3300049584 Ga0501068_0167668 Ga0501068_0167668_1018_1293 88
481 3300049589 Ga0501073_0372082 Ga0501073_0372082_634_900 88
482 3300049742 Ga0501080_0882422 Ga0501080_0882422_10_276 88
483 3300049765 Ga0501268_029867 Ga0501268_029867_343_609 88
484 3300049823 Ga0501044_0868897 Ga0501044_0868897_159_425 88
485 3300054114 Ga0501084_1019009 Ga0501084_1019009_138_404 88
486 3300061719 Ga0466962_0231379 Ga0466962_0231379_181_450 88
487 3300061719 Ga0466962_0399953 Ga0466962_0399953_408_674 88
488 3300061719 Ga0466962_0418623 Ga0466962_0418623_317_589 88

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF19447

DUF5985

Family of unknown function (DUF5985)

3

85

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3r2q-assembly1.cif.gz_A-2 crystal structure analysis of yibf from e. coli 0.7193 3 59
8fbi-assembly1.cif.gz_A-3 improving the secretion of designed protein assemblies through negative design of cryptic transmembrane domains 0.6809 8 73
5jjf-assembly1.cif.gz_B "structure of the srii/htrii complex in i212121 space group (""u"" shape) - m state" 0.6735 1 56
7qho-assembly1.cif.gz_T cytochrome bcc-aa3 supercomplex (respiratory supercomplex iii2/iv2) from corynebacterium glutamicum (as isolated) 0.6578 8 61
5jje-assembly1.cif.gz_B "structure of the srii/htrii complex in i212121 space group (""u"" shape)" 0.6192 1 58
ID Description Score Start End Superfamily
af_Q8T4G7_1_285_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.878 2 46 1.20.1250.20
af_I1JA85_1_208_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.8321 1 49 1.20.1070.10
2yfbA02 Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins); 0.776 3 62 1.20.1440.210
af_A0A0R0FWV5_59_180_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.7296 7 71 1.20.140.150
af_W6RQY2_8_928_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.7263 2 50 1.25.10.10
ID Description Score Start End GO Terms
AF-A0A5C5VUC3-F1-model_v4 Chaperone protein DnaJ 0.9298 1 58 GO:0016020
GO:0036503
GO:0051087
GO:0051787
AF-V2UF25-F1-model_v4 Uncharacterized protein 0.9147 7 61 GO:0016020
AF-A0A6N4TJS4-F1-model_v4 Uncharacterized protein 0.9134 5 80 GO:0016020
AF-A0A525KFY1-F1-model_v4 Uncharacterized protein 0.8454 2 61 GO:0016020
AF-A0A1F6G7Q8-F1-model_v4 Excalibur calcium-binding domain-containing protein 0.8416 2 68

Feature Viewer

pLDDT pTM Quality
75.11 0.52 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map