F453634

General Info

Members Datasets Scaffolds Average Seq Length
488 268 461 373

Family's Representative Sequence

Representative Sequence 3300037418|Ga0395900_0001865|Ga0395900_0001865_9201_10376
Length 391
Sequence MMVGFRRGMVAMVLAGTIAGSANAATARRETFGTLPDGTPVEAVTLTGANGVSARIITLGATLQALNAPDRTGHIADVTLGYDDARSYFEHPNYWGQTIGRYANRIAGGRFTLDGKTYQLPLNDKTNSLHGGTVGFDKHVWQIVDVSDKGGPAKVALRMVSPAGDQGYPGNLTVTTTYALDDHGSLTIDMDATTDAPTVVNLTNHALFNLAGEGASGGALGHRMTVASHRYTPVDAALIPTGELRDVAGTPFDFTQGRVIGQVVRDGHDPQIVIGRGIDHNFVLDGGKTAEPKLAVRLEDPQSGRVLEVLTDQPGIQIYTGNFLDGTLIGKNRHVYRMGDGIALEPQVFPDTPNKPAFGSARVDPGKPYHHRMIYRLSVAGSSSASPERGQ

Samples

Sample ID Description Type Environment
1 2510917021 Novosphingobium sp. AP12 Isolate Rhizosphere
2 2524023250 Niveispirillum irakense DSM 11586 Isolate Unclassified
3 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
4 2643221588 Altererythrobacter sp. Root672 Isolate Unclassified
5 2738541275 Novosphingobium sp. GV027 Isolate Unclassified
6 2738541301 Novosphingobium sp. GV079 Isolate Unclassified
7 2738541304 Novosphingobium sp. GV061 Isolate Unclassified
8 2738543022 Novosphingobium sp. GV055 Isolate Unclassified
9 2738543033 Novosphingobium sp. GV064 Isolate Unclassified
10 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
11 2775507255 Sphingobium indicum B90A Isolate Rhizosphere
12 2808606401 Sphingobium sp. AEW010 Isolate Rhizosphere
13 2808606404 Sphingobium sp. AEW013 Isolate Rhizosphere
14 2808606405 Sphingobium sp. AEW001 Isolate Rhizosphere
15 2848297114 Croceibacterium ferulae EGI 63111 Isolate Unclassified
16 2880518877 Sphingobium sp. JAI105 Isolate Rhizosphere
17 2885429604 Sphingomonas sp. WZY 27 Isolate Rhizosphere
18 2919138771 Novosphingobium sp. 1748 Isolate Rhizosphere
19 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified
20 2928027323 Sphingomonas sp. 1185 Isolate Unclassified
21 2928100450 Novosphingobium sp. 1529 Isolate Rhizosphere
22 2928959182 Novosphingobium capsulatum 1057 Isolate Unclassified
23 2984555340 Sphingomonas sp. SORGH_AS789 Isolate Aerial Root
24 2984564862 Sphingomonas sp. SORGH_AS870 Isolate Aerial Root
25 2993356040 Sphingomonas sp. SORGH_AS742 Isolate Aerial Root
26 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
27 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
28 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
29 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
30 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
31 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
32 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
33 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
34 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
35 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
36 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
37 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
38 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
39 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
40 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
41 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
42 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
43 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
44 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
45 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
46 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
47 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
48 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
49 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
50 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
51 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
52 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
53 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
54 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
55 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
56 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
57 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
58 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
59 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
60 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
61 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
62 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
63 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
64 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
65 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
66 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
67 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
68 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
69 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
70 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
71 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
72 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
73 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
74 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
75 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
76 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
77 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
78 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
79 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
80 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
81 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
82 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
85 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
86 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
88 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
89 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
90 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
91 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
92 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
93 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
94 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
95 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
96 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
97 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
98 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
99 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
100 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
101 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
102 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
103 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
104 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
105 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
106 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
107 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
108 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
109 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
112 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
113 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
114 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
115 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
116 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
118 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
119 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
120 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
122 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
168 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
172 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
173 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
174 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
175 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
176 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
177 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
178 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
179 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
180 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
181 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
182 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
183 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
184 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
185 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
186 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
187 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
188 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
189 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
190 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
191 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
192 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
193 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
194 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
195 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
196 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
197 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
198 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
199 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
200 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
201 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
202 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
203 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
204 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
205 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
206 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
207 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
208 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
209 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
210 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
211 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
212 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
213 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
214 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
215 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
216 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
217 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
218 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
219 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
220 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
221 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
222 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
223 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
224 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
225 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
226 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
227 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
228 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
229 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
230 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
231 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
232 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
233 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
234 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
235 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
236 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
237 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
238 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
239 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
240 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
241 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
242 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
243 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
244 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
245 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
247 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
248 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
249 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
250 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
251 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
252 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
253 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
254 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
255 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
256 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
257 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
258 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
259 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
260 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
261 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
262 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
263 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
264 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
265 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
266 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
267 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere
268 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.47
Metatranscriptomes 0
Isolates 5.53

Biome Distribution

Category Percentage (%)
Aerial Root 0.61
Bulb 0
Endosphere 10.86
Nodule 0.2
Rhizoplane 3.48
Rhizosphere 78.48
Stem 0
Stem Tuber 0
Unclassified 6.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1000104 3300001915 Bacteria 22114
2 JGI24740J21852_10005882 3300001979 Bacteria 5141
3 JGI24740J21852_10020245 3300001979 Bacteria 2325
4 JGI24739J22299_10016539 3300001989 Bacteria 2668
5 JGI24739J22299_10022422 3300001989 Bacteria 2240
6 JGI24737J22298_10001275 3300001990 Bacteria 8916
7 JGI24737J22298_10002134 3300001990 Bacteria 7049
8 JGI24735J21928_10000917 3300002067 Bacteria 10530
9 JGI24738J21930_10000323 3300002075 Bacteria 13182
10 JGI25150J39212_1000075 3300002774 Bacteria 60414
11 JGI25165J46597_1000053 3300003214 Bacteria 235857
12 JGI25153J46596_10000005 3300003215 Bacteria 492839
13 JGI25153J46596_10000043 3300003215 Bacteria 156407
14 Ga0055526_1004418 3300003771 Bacteria 8455
15 Ga0055537_1005375 3300003773 Bacteria 3446
16 Ga0055536_1009545 3300003781 Bacteria 3993
17 Ga0055540_1001312 3300003792 Bacteria 14998
18 Ga0055531_10035211 3300003794 Bacteria 1571
19 Ga0065165_1005599 3300005262 Bacteria 6963
20 Ga0065165_1013176 3300005262 Bacteria 3306
21 Ga0065165_1035124 3300005262 Bacteria 1543
22 Ga0070658_10176182 3300005327 Bacteria 1798
23 Ga0070676_10023742 3300005328 Bacteria 3448
24 Ga0070690_100055688 3300005330 Bacteria 2533
25 Ga0068869_100003144 3300005334 Bacteria 10073
26 Ga0070666_10001550 3300005335 Bacteria 13958
27 Ga0070666_10014729 3300005335 Bacteria 4982
28 Ga0070680_100012703 3300005336 Bacteria 6545
29 Ga0070680_100018854 3300005336 Bacteria 5458
30 Ga0070682_100014547 3300005337 Bacteria 4550
31 Ga0070682_100022382 3300005337 Bacteria 3743
32 Ga0068868_100033957 3300005338 Bacteria 3935
33 Ga0070660_100023962 3300005339 Bacteria 4526
34 Ga0070660_100032277 3300005339 Bacteria 3940
35 Ga0070660_100037091 3300005339 Bacteria 3695
36 Ga0070691_10053514 3300005341 Bacteria 1931
37 Ga0070661_100084804 3300005344 Bacteria 2340
38 Ga0070661_100145568 3300005344 Bacteria 1788
39 Ga0070668_100095822 3300005347 Bacteria 2344
40 Ga0070675_100034270 3300005354 Bacteria 4119
41 Ga0070675_100049402 3300005354 Bacteria 3453
42 Ga0070671_100067277 3300005355 Bacteria 2987
43 Ga0070671_100119476 3300005355 Bacteria 2218
44 Ga0070671_100232630 3300005355 Bacteria 1564
45 Ga0070671_100380424 3300005355 Bacteria 1206
46 Ga0070674_100007680 3300005356 Bacteria 6371
47 Ga0070674_100056443 3300005356 Bacteria 2723
48 Ga0070673_100001594 3300005364 Bacteria 13395
49 Ga0070673_100089390 3300005364 Bacteria 2514
50 Ga0070673_100192365 3300005364 Bacteria 1753
51 Ga0070659_100000810 3300005366 Bacteria 22806
52 Ga0070659_100030818 3300005366 Bacteria 4151
53 Ga0070659_100037750 3300005366 Bacteria 3766
54 Ga0070659_100058126 3300005366 Bacteria 3051
55 Ga0070667_100008009 3300005367 Bacteria 8764
56 Ga0070667_100043948 3300005367 Bacteria 3750
57 Ga0070714_100058853 3300005435 Bacteria 3293
58 Ga0070663_100006034 3300005455 Bacteria 7253
59 Ga0070678_100014009 3300005456 Bacteria 5043
60 Ga0070678_100167458 3300005456 Bacteria 1786
61 Ga0070662_100003743 3300005457 Bacteria 9518
62 Ga0070662_100009083 3300005457 Bacteria 6487
63 Ga0070662_100211984 3300005457 Bacteria 1542
64 Ga0070681_10033744 3300005458 Bacteria 5138
65 Ga0070681_10053570 3300005458 Bacteria 4021
66 Ga0070681_10108940 3300005458 Bacteria 2710
67 Ga0070681_10227390 3300005458 Bacteria 1780
68 Ga0070679_100013607 3300005530 Bacteria 7795
69 Ga0070679_100049280 3300005530 Bacteria 4195
70 Ga0070679_100164893 3300005530 Bacteria 2189
71 Ga0068853_100045333 3300005539 Bacteria 3765
72 Ga0068853_100284255 3300005539 Bacteria 1525
73 Ga0070665_100001794 3300005548 Bacteria 24393
74 Ga0070665_100021832 3300005548 Bacteria 6437
75 Ga0068855_100003804 3300005563 Bacteria 18453
76 Ga0068855_100004318 3300005563 Bacteria 17378
77 Ga0068855_100250475 3300005563 Bacteria 1976
78 Ga0070664_100010178 3300005564 Bacteria 7628
79 Ga0070664_100032868 3300005564 Bacteria 4341
80 Ga0070664_100148474 3300005564 Bacteria 2069
81 Ga0068857_100012254 3300005577 Bacteria 7459
82 Ga0068857_100040285 3300005577 Bacteria 4142
83 Ga0068854_100008085 3300005578 Bacteria 6746
84 Ga0068854_100016665 3300005578 Bacteria 4903
85 Ga0068856_100042885 3300005614 Bacteria 4452
86 Ga0068856_100091775 3300005614 Bacteria 3021
87 Ga0068852_100039807 3300005616 Bacteria 3960
88 Ga0068852_100084532 3300005616 Bacteria 2824
89 Ga0068852_100106947 3300005616 Bacteria 2537
90 Ga0068852_100138783 3300005616 Bacteria 2248
91 Ga0068852_100387902 3300005616 Bacteria 1371
92 Ga0068859_100058223 3300005617 Bacteria 3892
93 Ga0068859_100124832 3300005617 Bacteria 2642
94 Ga0068864_100057106 3300005618 Bacteria 3372
95 Ga0068864_100091197 3300005618 Bacteria 2688
96 Ga0068864_100095238 3300005618 Bacteria 2633
97 Ga0068864_100097186 3300005618 Bacteria 2607
98 Ga0068866_10010054 3300005718 Bacteria 4044
99 Ga0068851_10012730 3300005834 Bacteria 3973
100 Ga0068863_100001700 3300005841 Bacteria 21804
101 Ga0068858_100001656 3300005842 Bacteria 22765
102 Ga0068858_100004720 3300005842 Bacteria 13342
103 Ga0068860_100045818 3300005843 Bacteria 4170
104 Ga0068862_100258042 3300005844 Bacteria 1590
105 Ga0070717_10028469 3300006028 Bacteria 4473
106 Ga0068871_100117576 3300006358 Bacteria 2242
107 Ga0068871_100125661 3300006358 Bacteria 2171
108 Ga0097620_100058221 3300006931 Bacteria 3892
109 Ga0097620_100124840 3300006931 Bacteria 2642
110 Ga0105251_10008943 3300009011 Bacteria 5984
111 Ga0105240_10000927 3300009093 Bacteria 52195
112 Ga0105240_10005390 3300009093 Bacteria 19072
113 Ga0105240_10027381 3300009093 Bacteria 7462
114 Ga0105240_10172836 3300009093 Bacteria 2557
115 Ga0111539_10547919 3300009094 Bacteria 1347
116 Ga0105245_10001436 3300009098 Bacteria 21598
117 Ga0105245_10132075 3300009098 Bacteria 2343
118 Ga0105243_10073101 3300009148 Bacteria 2777
119 Ga0105243_10200757 3300009148 Bacteria 1749
120 Ga0105241_10009952 3300009174 Bacteria 6984
121 Ga0105242_10146899 3300009176 Bacteria 2052
122 Ga0105248_10002097 3300009177 Bacteria 22084
123 Ga0105237_10005557 3300009545 Bacteria 14218
124 Ga0105237_10006370 3300009545 Bacteria 13106
125 Ga0105237_10097494 3300009545 Bacteria 2930
126 Ga0105238_10004635 3300009551 Bacteria 13612
127 Ga0105238_10005550 3300009551 Bacteria 12458
128 Ga0105238_10054326 3300009551 Bacteria 4023
129 Ga0105148_100010 3300009978 Bacteria 31424
130 Ga0105239_10301261 3300010375 Bacteria 1805
131 Ga0105246_10000133 3300011119 Bacteria 34793
132 Ga0105246_10020541 3300011119 Bacteria 4238
133 Ga0157373_10030238 3300013100 Bacteria 3897
134 Ga0157373_10032334 3300013100 Bacteria 3766
135 Ga0157371_10017258 3300013102 Bacteria 5368
136 Ga0157371_10031511 3300013102 Bacteria 3820
137 Ga0157371_10154600 3300013102 Bacteria 1637
138 Ga0157371_10212292 3300013102 Bacteria 1389
139 Ga0157370_10004014 3300013104 Bacteria 17100
140 Ga0157370_10004125 3300013104 Bacteria 16843
141 Ga0157370_10051296 3300013104 Bacteria 3940
142 Ga0157370_10076877 3300013104 Bacteria 3144
143 Ga0157370_10114595 3300013104 Bacteria 2518
144 Ga0157370_10152729 3300013104 Bacteria 2148
145 Ga0157370_10324072 3300013104 Bacteria 1421
146 Ga0157369_10001967 3300013105 Bacteria 24776
147 Ga0157369_10020348 3300013105 Bacteria 7418
148 Ga0157369_10096962 3300013105 Bacteria 3145
149 Ga0157374_10001585 3300013296 Bacteria 19081
150 Ga0157374_10190256 3300013296 Bacteria 2007
151 Ga0157372_10029582 3300013307 Bacteria 5983
152 Ga0157372_10072333 3300013307 Bacteria 3886
153 Ga0157372_10098854 3300013307 Bacteria 3329
154 Ga0157375_10012152 3300013308 Bacteria 7630
155 Ga0157375_10104063 3300013308 Bacteria 2927
156 Ga0157375_10160444 3300013308 Bacteria 2390
157 Ga0163163_10024467 3300014325 Bacteria 5748
158 Ga0163163_10048029 3300014325 Bacteria 4196
159 Ga0157380_10047453 3300014326 Bacteria 3378
160 Ga0183363_1007 3300015690 Bacteria 315687
161 Ga0163161_10009060 3300017792 Bacteria 6884
162 Ga0213872_10000956 3300021361 Bacteria 20220
163 Ga0213872_10002549 3300021361 Bacteria 10616
164 Ga0213872_10014165 3300021361 Bacteria 3724
165 Ga0209674_103318 3300025226 Bacteria 3000
166 Ga0209147_101018 3300025229 Bacteria 11964
167 Ga0207425_1000047 3300025245 Bacteria 189158
168 Ga0209129_1000447 3300025258 Bacteria 30859
169 Ga0209233_1000119 3300025261 Bacteria 235924
170 Ga0209565_1000059 3300025263 Bacteria 189658
171 Ga0209673_1004498 3300025273 Bacteria 7429
172 Ga0209676_1013973 3300025292 Bacteria 3052
173 Ga0209025_1000150 3300025294 Bacteria 172834
174 Ga0209564_1001496 3300025295 Bacteria 23491
175 Ga0209758_1000001 3300025297 Bacteria 1981790
176 Ga0209758_1000009 3300025297 Bacteria 1123483
177 Ga0209050_1000005 3300025298 Bacteria 1557793
178 Ga0209050_1000127 3300025298 Bacteria 187951
179 Ga0209050_1000195 3300025298 Bacteria 136316
180 Ga0207426_1022147 3300025302 Bacteria 2186
181 Ga0209051_1000568 3300025303 Bacteria 44824
182 Ga0209257_1000740 3300025304 Bacteria 49424
183 Ga0209257_1000825 3300025304 Bacteria 44824
184 Ga0209257_1001346 3300025304 Bacteria 29799
185 Ga0207697_10011894 3300025315 Bacteria 3667
186 Ga0207656_10014196 3300025321 Bacteria 3063
187 Ga0207713_1008786 3300025735 Bacteria 5760
188 Ga0207688_10123280 3300025901 Bacteria 1514
189 Ga0207680_10000604 3300025903 Bacteria 16935
190 Ga0207647_10000522 3300025904 Bacteria 30685
191 Ga0207647_10004919 3300025904 Bacteria 9849
192 Ga0207647_10007464 3300025904 Bacteria 7897
193 Ga0207647_10015732 3300025904 Bacteria 5179
194 Ga0207645_10082008 3300025907 Bacteria 2067
195 Ga0207705_10026546 3300025909 Bacteria 4130
196 Ga0207705_10028276 3300025909 Bacteria 3997
197 Ga0207705_10043172 3300025909 Bacteria 3238
198 Ga0207654_10013187 3300025911 Bacteria 4247
199 Ga0207707_10000968 3300025912 Bacteria 27609
200 Ga0207707_10029222 3300025912 Bacteria 4819
201 Ga0207707_10157988 3300025912 Bacteria 1982
202 Ga0207695_10002577 3300025913 Bacteria 26604
203 Ga0207695_10005628 3300025913 Bacteria 16546
204 Ga0207695_10009139 3300025913 Bacteria 12301
205 Ga0207695_10036984 3300025913 Bacteria 5270
206 Ga0207695_10088080 3300025913 Bacteria 3126
207 Ga0207671_10001826 3300025914 Bacteria 23741
208 Ga0207671_10006503 3300025914 Bacteria 10393
209 Ga0207671_10054917 3300025914 Bacteria 2950
210 Ga0207660_10019904 3300025917 Bacteria 4495
211 Ga0207660_10026950 3300025917 Bacteria 3918
212 Ga0207660_10060222 3300025917 Bacteria 2728
213 Ga0207657_10002159 3300025919 Bacteria 21321
214 Ga0207657_10014216 3300025919 Bacteria 7783
215 Ga0207649_10006950 3300025920 Bacteria 6150
216 Ga0207649_10027599 3300025920 Bacteria 3334
217 Ga0207649_10102210 3300025920 Bacteria 1899
218 Ga0207694_10012608 3300025924 Bacteria 6371
219 Ga0207694_10034918 3300025924 Bacteria 3856
220 Ga0207694_10039322 3300025924 Bacteria 3640
221 Ga0207650_10055146 3300025925 Bacteria 2949
222 Ga0207687_10006357 3300025927 Bacteria 7807
223 Ga0207687_10074022 3300025927 Bacteria 2440
224 Ga0207664_10048164 3300025929 Bacteria 3351
225 Ga0207644_10001058 3300025931 Bacteria 17593
226 Ga0207644_10013605 3300025931 Bacteria 5431
227 Ga0207690_10000946 3300025932 Bacteria 18590
228 Ga0207690_10005839 3300025932 Bacteria 7283
229 Ga0207690_10122557 3300025932 Bacteria 1891
230 Ga0207690_10223706 3300025932 Bacteria 1441
231 Ga0207690_10231153 3300025932 Bacteria 1420
232 Ga0207706_10003751 3300025933 Bacteria 14492
233 Ga0207706_10008331 3300025933 Bacteria 9559
234 Ga0207706_10072036 3300025933 Bacteria 3040
235 Ga0207706_10083966 3300025933 Bacteria 2800
236 Ga0207709_10137465 3300025935 Bacteria 1675
237 Ga0207669_10000778 3300025937 Bacteria 13668
238 Ga0207669_10005131 3300025937 Bacteria 5839
239 Ga0207704_10009183 3300025938 Bacteria 4759
240 Ga0207691_10000954 3300025940 Bacteria 28639
241 Ga0207711_10000193 3300025941 Bacteria 65165
242 Ga0207711_10018614 3300025941 Bacteria 5774
243 Ga0207689_10011160 3300025942 Bacteria 7710
244 Ga0207661_10001837 3300025944 Bacteria 14511
245 Ga0207661_10107307 3300025944 Bacteria 2355
246 Ga0207679_10017609 3300025945 Bacteria 4769
247 Ga0207667_10001307 3300025949 Bacteria 31236
248 Ga0207667_10019314 3300025949 Bacteria 7613
249 Ga0207667_10059393 3300025949 Bacteria 4005
250 Ga0207667_10233450 3300025949 Bacteria 1883
251 Ga0207651_10000289 3300025960 Bacteria 21606
252 Ga0207651_10009931 3300025960 Bacteria 5242
253 Ga0207651_10035654 3300025960 Bacteria 3238
254 Ga0207640_10008796 3300025981 Bacteria 5618
255 Ga0207640_10019052 3300025981 Bacteria 4046
256 Ga0207658_10009801 3300025986 Bacteria 6505
257 Ga0207658_10034173 3300025986 Bacteria 3632
258 Ga0207658_10035874 3300025986 Bacteria 3553
259 Ga0207703_10001445 3300026035 Bacteria 21690
260 Ga0207703_10001551 3300026035 Bacteria 20833
261 Ga0207639_10004017 3300026041 Bacteria 9929
262 Ga0207639_10026649 3300026041 Bacteria 4200
263 Ga0207678_10002196 3300026067 Bacteria 17622
264 Ga0207678_10028787 3300026067 Bacteria 4850
265 Ga0207702_10005336 3300026078 Bacteria 11268
266 Ga0207702_10124565 3300026078 Bacteria 2311
267 Ga0207641_10073303 3300026088 Bacteria 2950
268 Ga0207641_10073794 3300026088 Bacteria 2941
269 Ga0207641_10075177 3300026088 Bacteria 2917
270 Ga0207676_10032430 3300026095 Bacteria 3936
271 Ga0207676_10104160 3300026095 Bacteria 2359
272 Ga0207676_10108063 3300026095 Bacteria 2322
273 Ga0207674_10000057 3300026116 Bacteria 113117
274 Ga0207674_10006986 3300026116 Bacteria 13208
275 Ga0207674_10044409 3300026116 Bacteria 4576
276 Ga0207674_10192642 3300026116 Bacteria 1988
277 Ga0207674_10321399 3300026116 Bacteria 1497
278 Ga0207683_10001453 3300026121 Bacteria 21380
279 Ga0207698_10009466 3300026142 Bacteria 6215
280 Ga0207698_10080307 3300026142 Bacteria 2627
281 Ga0209281_1006233 3300027111 Bacteria 3145
282 Ga0268266_10003656 3300028379 Bacteria 15198
283 Ga0268266_10027285 3300028379 Bacteria 4856
284 Ga0268265_10232566 3300028380 Bacteria 1621
285 Ga0268264_10231396 3300028381 Bacteria 1707
286 Ga0265331_10014131 3300031250 Bacteria 4264
287 Ga0307408_100002097 3300031548 Bacteria 14353
288 Ga0307508_10002299 3300031616 Bacteria 20297
289 Ga0307412_10011347 3300031911 Bacteria 5159
290 Ga0373943_0001412 3300035170 Bacteria 10822
291 Ga0373935_0027294 3300035692 Bacteria 3529
292 Ga0373927_0098671 3300035695 Bacteria 1899
293 Ga0373947_0002938 3300035725 Bacteria 10172
294 Ga0373925_0005490 3300037068 Bacteria 9437
295 Ga0395899_0052218 3300037312 Bacteria 3031
296 Ga0395899_0062593 3300037312 Bacteria 2740
297 Ga0395899_0185493 3300037312 Bacteria 1458
298 Ga0395900_0001865 3300037418 Bacteria 23995
299 Ga0395900_0008897 3300037418 Bacteria 10306
300 Ga0395900_0019236 3300037418 Bacteria 6963
301 Ga0395900_0025055 3300037418 Bacteria 6106
302 Ga0395900_0035250 3300037418 Bacteria 5154
303 Ga0395900_0174125 3300037418 Bacteria 2189
304 Ga0395898_0004872 3300037466 Bacteria 14575
305 Ga0395898_0047196 3300037466 Bacteria 4227
306 Ga0395898_0077148 3300037466 Bacteria 3217
307 Ga0395898_0084091 3300037466 Bacteria 3067
308 Ga0395905_0001467 3300037471 Bacteria 28279
309 Ga0395905_0001585 3300037471 Bacteria 27082
310 Ga0395905_0002396 3300037471 Bacteria 20857
311 Ga0395905_0002981 3300037471 Bacteria 18370
312 Ga0395905_0006060 3300037471 Bacteria 12240
313 Ga0395905_0010509 3300037471 Bacteria 8998
314 Ga0395905_0014925 3300037471 Bacteria 7409
315 Ga0395905_0032916 3300037471 Bacteria 4873
316 Ga0395905_0035930 3300037471 Bacteria 4653
317 Ga0395905_0056150 3300037471 Bacteria 3684
318 Ga0395905_0073371 3300037471 Bacteria 3208
319 Ga0395905_0087791 3300037471 Bacteria 2915
320 Ga0395905_0168819 3300037471 Bacteria 2055
321 Ga0395905_0227331 3300037471 Bacteria 1745
322 Ga0395905_0284781 3300037471 Bacteria 1539
323 Ga0395901_0018547 3300038443 Bacteria 7104
324 Ga0395901_0039185 3300038443 Bacteria 4903
325 Ga0395901_0041201 3300038443 Bacteria 4785
326 Ga0395901_0045541 3300038443 Bacteria 4553
327 Ga0395901_0099054 3300038443 Bacteria 3056
328 Ga0395901_0163735 3300038443 Bacteria 2335
329 Ga0395901_0253156 3300038443 Bacteria 1834
330 Ga0436361_0387508 3300039447 Bacteria 11530
331 Ga0436361_0450656 3300039447 Bacteria 1804
332 Ga0436361_0478490 3300039447 Bacteria 50328
333 Ga0436361_0633763 3300039447 Bacteria 20601
334 Ga0436361_0809295 3300039447 Bacteria 1704
335 Ga0439462_0000049 3300042015 Bacteria 17203
336 Ga0439458_0000968 3300042157 Bacteria 7359
337 Ga0466969_0000708 3300044656 Bacteria 18046
338 Ga0466966_0006071 3300044684 Bacteria 7977
339 Ga0466966_0072746 3300044684 Bacteria 2151
340 Ga0466963_0043638 3300044694 Bacteria 2949
341 Ga0466963_0239266 3300044694 Bacteria 1273
342 Ga0466957_0222665 3300044842 Bacteria 1246
343 Ga0466959_0034115 3300045049 Bacteria 3766
344 Ga0466967_0064030 3300045976 Bacteria 3269
345 Ga0466967_0142994 3300045976 Bacteria 2229
346 Ga0495627_000024 3300046453 Bacteria 250480
347 Ga0495627_000124 3300046453 Bacteria 93651
348 Ga0495627_003215 3300046453 Bacteria 7352
349 Ga0495638_0000168 3300046460 Bacteria 101864
350 Ga0495650_0000158 3300046471 Bacteria 154681
351 Ga0495650_0000822 3300046471 Bacteria 37641
352 Ga0495584_0066552 3300046491 Bacteria 1812
353 Ga0495584_0137475 3300046491 Bacteria 1240
354 Ga0495585_0078715 3300046492 Bacteria 1788
355 Ga0495596_0003391 3300046500 Bacteria 8092
356 Ga0495607_0017764 3300046501 Bacteria 4554
357 Ga0495583_0002499 3300046506 Bacteria 15602
358 Ga0495583_0006584 3300046506 Bacteria 7559
359 Ga0495583_0012174 3300046506 Bacteria 4889
360 Ga0495606_0000279 3300046507 Bacteria 88805
361 Ga0495610_0000022 3300046512 Bacteria 317107
362 Ga0495610_0000247 3300046512 Bacteria 56834
363 Ga0495610_0006032 3300046512 Bacteria 8460
364 Ga0495616_0033618 3300046513 Bacteria 2670
365 Ga0495620_0015417 3300046515 Bacteria 3860
366 Ga0495632_0000533 3300046519 Bacteria 35890
367 Ga0495637_0003156 3300046520 Bacteria 8799
368 Ga0495643_0000110 3300046522 Bacteria 135600
369 Ga0495643_0005414 3300046522 Bacteria 8641
370 Ga0495643_0044671 3300046522 Bacteria 2406
371 Ga0495643_0070731 3300046522 Bacteria 1832
372 Ga0495643_0079028 3300046522 Bacteria 1716
373 Ga0495648_0000015 3300046524 Bacteria 285838
374 Ga0495648_0011621 3300046524 Bacteria 6615
375 Ga0495597_0011823 3300046542 Bacteria 4226
376 Ga0495622_0062499 3300046557 Bacteria 1723
377 Ga0495633_0000659 3300046558 Bacteria 31859
378 Ga0495633_0022557 3300046558 Bacteria 3131
379 Ga0495625_0000264 3300046660 Bacteria 81625
380 Ga0495625_0001426 3300046660 Bacteria 29178
381 Ga0495625_0037825 3300046660 Bacteria 3535
382 Ga0495625_0075713 3300046660 Bacteria 2354
383 Ga0495669_0000159 3300046684 Bacteria 43128
384 Ga0495670_0052757 3300046691 Bacteria 2036
385 Ga0495670_0061891 3300046691 Bacteria 1882
386 Ga0495671_0000004 3300046692 Bacteria 545630
387 Ga0495649_0025915 3300046694 Bacteria 3265
388 Ga0495683_0002461 3300047323 Bacteria 11177
389 Ga0495687_000089 3300047443 Bacteria 141448
390 Ga0495687_002076 3300047443 Bacteria 16834
391 Ga0495687_058468 3300047443 Bacteria 1599
392 Ga0495677_0005247 3300047445 Bacteria 4928
393 Ga0495673_0000021 3300047469 Bacteria 545523
394 Ga0495681_0000010 3300047470 Bacteria 203548
395 Ga0495681_0002818 3300047470 Bacteria 12302
396 Ga0495686_0025069 3300047472 Bacteria 3911
397 Ga0495615_0000055 3300048090 Bacteria 35425
398 Ga0495626_0001498 3300048091 Bacteria 18416
399 Ga0496100_0001163 3300048903 Bacteria 12794
400 Ga0496100_0156338 3300048903 Bacteria 1631
401 Ga0496101_0055299 3300048904 Bacteria 2867
402 Ga0496105_0188734 3300048908 Bacteria 1686
403 Ga0496105_0288637 3300048908 Bacteria 1321
404 Ga0496107_0003950 3300048910 Bacteria 9972
405 Ga0496108_0001452 3300048911 Bacteria 18729
406 Ga0496108_0127773 3300048911 Bacteria 2183
407 Ga0496109_0029421 3300048912 Bacteria 4919
408 Ga0496109_0047473 3300048912 Bacteria 3904
409 Ga0496110_0013681 3300048913 Bacteria 6720
410 Ga0496110_0044044 3300048913 Bacteria 3897
411 Ga0496111_0076888 3300048914 Bacteria 2433
412 Ga0496112_0004809 3300048915 Bacteria 11527
413 Ga0496112_0031626 3300048915 Bacteria 5134
414 Ga0496113_0022161 3300048916 Bacteria 4488
415 Ga0496116_0000311 3300048919 Bacteria 81431
416 Ga0496118_0077415 3300048921 Bacteria 2359
417 Ga0496118_0187182 3300048921 Bacteria 1243
418 Ga0496121_0002818 3300048924 Bacteria 25709
419 Ga0496121_0012070 3300048924 Bacteria 9493
420 Ga0496122_0004302 3300048925 Bacteria 17837
421 Ga0496122_0006448 3300048925 Bacteria 13464
422 Ga0496122_0032029 3300048925 Bacteria 4358
423 Ga0496123_0002107 3300048926 Bacteria 25546
424 Ga0496123_0004957 3300048926 Bacteria 13643
425 Ga0496124_0016588 3300048927 Bacteria 6990
426 Ga0496124_0019231 3300048927 Bacteria 6366
427 Ga0496124_0067053 3300048927 Bacteria 2987
428 Ga0496124_0239986 3300048927 Bacteria 1348
429 Ga0496125_0008563 3300048928 Bacteria 10683
430 Ga0496125_0042630 3300048928 Bacteria 3862
431 Ga0496126_0000077 3300048929 Bacteria 231592
432 Ga0496126_0057365 3300048929 Bacteria 3516
433 Ga0495678_047513 3300049459 Bacteria 1680
434 Ga0501047_0034198 3300049581 Bacteria 4908
435 Ga0501235_014748 3300049669 Bacteria 1722
436 Ga0501225_0001396 3300049705 Bacteria 7548
437 Ga0501245_002321 3300049708 Bacteria 2535
438 Ga0501264_002561 3300049761 Bacteria 1685
439 Ga0501035_0038275 3300049822 Bacteria 4343
440 Ga0501044_0021610 3300049823 Bacteria 6862
441 Ga0500610_0000192 3300053079 Bacteria 18481
442 Ga0500643_000800 3300053087 Bacteria 20343
443 Ga0500643_003665 3300053087 Bacteria 7255
444 Ga0500643_010408 3300053087 Bacteria 3464
445 Ga0500647_0064402 3300053091 Bacteria 1763
446 Ga0500641_0065385 3300053096 Bacteria 1521
447 Ga0500562_000698 3300053108 Bacteria 8192
448 Ga0500569_000929 3300053109 Bacteria 5275
449 Ga0500595_001586 3300053119 Bacteria 12000
450 Ga0500595_013490 3300053119 Bacteria 3130
451 Ga0500642_0001096 3300053130 Bacteria 7766
452 Ga0500658_0052735 3300053134 Bacteria 1666
453 Ga0500616_0116670 3300053153 Bacteria 1281
454 Ga0500622_0007252 3300053156 Bacteria 6312
455 Ga0500624_000020 3300053157 Bacteria 118392
456 Ga0500624_000059 3300053157 Bacteria 69605
457 Ga0500624_000277 3300053157 Bacteria 17671
458 Ga0500636_0002455 3300053177 Bacteria 10276
459 Ga0500637_0000813 3300053178 Bacteria 12444
460 Ga0500645_000008 3300053730 Bacteria 212254
461 Ga0500645_008825 3300053730 Bacteria 3416

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044684 Ga0466966_0072746 Ga0466966_0072746_972_1949 324
2 3300009176 Ga0105242_10146899 Ga0105242_101468992 329
3 3300046453 Ga0495627_003215 Ga0495627_003215_1489_2661 331
4 3300045976 Ga0466967_0064030 Ga0466967_0064030_24_1040 337
5 3300048090 Ga0495615_0000055 Ga0495615_0000055_23371_24522 339
6 3300048925 Ga0496122_0006448 Ga0496122_0006448_11035_12186 339
7 3300048926 Ga0496123_0004957 Ga0496123_0004957_1597_2748 339
8 3300048927 Ga0496124_0067053 Ga0496124_0067053_1696_2847 339
9 3300027111 Ga0209281_1006233 Ga0209281_10062332 340
10 3300005457 Ga0070662_100003743 Ga0070662_1000037434 341
11 3300011119 Ga0105246_10000133 Ga0105246_1000013314 341
12 3300013100 Ga0157373_10030238 Ga0157373_100302382 341
13 3300013308 Ga0157375_10160444 Ga0157375_101604442 341
14 3300025933 Ga0207706_10008331 Ga0207706_100083315 341
15 3300046491 Ga0495584_0137475 Ga0495584_0137475_195_1220 341
16 3300044684 Ga0466966_0006071 Ga0466966_0006071_4637_5758 342
17 3300053087 Ga0500643_000800 Ga0500643_000800_7989_9062 343
18 3300031911 Ga0307412_10011347 Ga0307412_100113473 345
19 3300005577 Ga0068857_100040285 Ga0068857_1000402854 346
20 3300005844 Ga0068862_100258042 Ga0068862_1002580422 346
21 3300026116 Ga0207674_10044409 Ga0207674_100444094 346
22 3300028380 Ga0268265_10232566 Ga0268265_102325662 346
23 3300044842 Ga0466957_0222665 Ga0466957_0222665_64_1158 346
24 3300045049 Ga0466959_0034115 Ga0466959_0034115_180_1319 346
25 3300048903 Ga0496100_0001163 Ga0496100_0001163_50_1093 346
26 3300002774 JGI25150J39212_1000075 JGI25150J39212_100007526 347
27 3300003215 JGI25153J46596_10000043 JGI25153J46596_10000043115 347
28 3300025245 Ga0207425_1000047 Ga0207425_100004736 347
29 3300025258 Ga0209129_1000447 Ga0209129_100044714 347
30 3300025294 Ga0209025_1000150 Ga0209025_1000150115 347
31 3300025297 Ga0209758_1000009 Ga0209758_1000009763 347
32 3300003781 Ga0055536_1009545 Ga0055536_10095453 348
33 3300003792 Ga0055540_1001312 Ga0055540_10013123 348
34 3300025292 Ga0209676_1013973 Ga0209676_10139732 348
35 3300025298 Ga0209050_1000005 Ga0209050_1000005406 348
36 3300025298 Ga0209050_1000127 Ga0209050_1000127103 348
37 3300025298 Ga0209050_1000195 Ga0209050_100019578 348
38 3300025303 Ga0209051_1000568 Ga0209051_10005683 348
39 3300025304 Ga0209257_1000825 Ga0209257_100082526 348
40 3300025304 Ga0209257_1001346 Ga0209257_100134617 348
41 3300039447 Ga0436361_0809295 Ga0436361_0809295_417_1550 351
42 3300001979 JGI24740J21852_10020245 JGI24740J21852_100202452 352
43 3300005336 Ga0070680_100012703 Ga0070680_1000127034 352
44 3300005339 Ga0070660_100023962 Ga0070660_1000239624 352
45 3300005458 Ga0070681_10108940 Ga0070681_101089402 352
46 3300005614 Ga0068856_100091775 Ga0068856_1000917752 352
47 3300013307 Ga0157372_10029582 Ga0157372_100295823 352
48 3300025912 Ga0207707_10157988 Ga0207707_101579882 352
49 3300025919 Ga0207657_10002159 Ga0207657_1000215912 352
50 3300025944 Ga0207661_10107307 Ga0207661_101073072 352
51 3300005334 Ga0068869_100003144 Ga0068869_10000314410 353
52 3300025942 Ga0207689_10011160 Ga0207689_1001116010 353
53 3300005337 Ga0070682_100022382 Ga0070682_1000223822 354
54 3300013100 Ga0157373_10032334 Ga0157373_100323343 354
55 3300025909 Ga0207705_10026546 Ga0207705_100265463 354
56 3300025981 Ga0207640_10019052 Ga0207640_100190522 354
57 3300026116 Ga0207674_10006986 Ga0207674_100069864 354
58 3300026142 Ga0207698_10009466 Ga0207698_100094664 354
59 3300037471 Ga0395905_0056150 Ga0395905_0056150_1569_2690 354
60 3300037471 Ga0395905_0073371 Ga0395905_0073371_2065_3192 356
61 3300046492 Ga0495585_0078715 Ga0495585_0078715_268_1422 356
62 3300048921 Ga0496118_0187182 Ga0496118_0187182_19_1134 358
63 3300005435 Ga0070714_100058853 Ga0070714_1000588533 359
64 3300025929 Ga0207664_10048164 Ga0207664_100481644 359
65 3300026116 Ga0207674_10192642 Ga0207674_101926422 359
66 3300046660 Ga0495625_0037825 Ga0495625_0037825_684_1817 359
67 3300049459 Ga0495678_047513 Ga0495678_047513_279_1424 359
68 iso_pu_bacteria 2524023250 2524612667 359
69 3300003773 Ga0055537_1005375 Ga0055537_10053753 360
70 3300005262 Ga0065165_1035124 Ga0065165_10351241 360
71 3300025263 Ga0209565_1000059 Ga0209565_100005930 360
72 3300025302 Ga0207426_1022147 Ga0207426_10221472 360
73 3300025920 Ga0207649_10006950 Ga0207649_100069503 360
74 3300025932 Ga0207690_10005839 Ga0207690_100058394 360
75 iso_pu_bacteria 2928027323 2928030143 360
76 3300046500 Ga0495596_0003391 Ga0495596_0003391_6555_7709 361
77 3300046512 Ga0495610_0006032 Ga0495610_0006032_6766_7920 361
78 3300046522 Ga0495643_0070731 Ga0495643_0070731_551_1705 361
79 3300046557 Ga0495622_0062499 Ga0495622_0062499_26_1111 361
80 3300048091 Ga0495626_0001498 Ga0495626_0001498_487_1641 361
81 3300005564 Ga0070664_100010178 Ga0070664_1000101784 362
82 3300005577 Ga0068857_100012254 Ga0068857_1000122545 362
83 3300005578 Ga0068854_100008085 Ga0068854_1000080853 362
84 3300025904 Ga0207647_10000522 Ga0207647_100005223 362
85 3300025913 Ga0207695_10005628 Ga0207695_1000562812 362
86 3300025924 Ga0207694_10034918 Ga0207694_100349182 362
87 3300025945 Ga0207679_10017609 Ga0207679_100176093 362
88 3300025949 Ga0207667_10059393 Ga0207667_100593932 362
89 3300026041 Ga0207639_10026649 Ga0207639_100266494 362
90 3300009093 Ga0105240_10172836 Ga0105240_101728362 363
91 3300009098 Ga0105245_10132075 Ga0105245_101320754 363
92 3300009148 Ga0105243_10200757 Ga0105243_102007572 363
93 3300009177 Ga0105248_10002097 Ga0105248_100020975 363
94 3300009551 Ga0105238_10054326 Ga0105238_100543263 363
95 3300010375 Ga0105239_10301261 Ga0105239_103012612 363
96 3300013102 Ga0157371_10017258 Ga0157371_100172589 363
97 3300013105 Ga0157369_10001967 Ga0157369_100019678 363
98 3300013105 Ga0157369_10096962 Ga0157369_100969623 363
99 3300013308 Ga0157375_10104063 Ga0157375_101040632 363
100 3300028381 Ga0268264_10231396 Ga0268264_102313961 363
101 3300035170 Ga0373943_0001412 Ga0373943_0001412_5916_7010 363
102 3300035692 Ga0373935_0027294 Ga0373935_0027294_1104_2198 363
103 3300035695 Ga0373927_0098671 Ga0373927_0098671_332_1426 363
104 3300035725 Ga0373947_0002938 Ga0373947_0002938_1750_2844 363
105 3300037068 Ga0373925_0005490 Ga0373925_0005490_346_1440 363
106 3300037418 Ga0395900_0019236 Ga0395900_0019236_3129_4223 363
107 3300037466 Ga0395898_0077148 Ga0395898_0077148_757_1851 363
108 3300037471 Ga0395905_0032916 Ga0395905_0032916_3466_4560 363
109 3300046691 Ga0495670_0052757 Ga0495670_0052757_364_1458 363
110 3300048904 Ga0496101_0055299 Ga0496101_0055299_914_2008 363
111 3300048910 Ga0496107_0003950 Ga0496107_0003950_2715_3809 363
112 3300048911 Ga0496108_0001452 Ga0496108_0001452_826_1920 363
113 3300048912 Ga0496109_0047473 Ga0496109_0047473_861_1955 363
114 3300048913 Ga0496110_0013681 Ga0496110_0013681_4541_5635 363
115 3300048915 Ga0496112_0004809 Ga0496112_0004809_4104_5198 363
116 3300053108 Ga0500562_000698 Ga0500562_000698_4299_5399 363
117 3300053156 Ga0500622_0007252 Ga0500622_0007252_3102_4202 363
118 3300053730 Ga0500645_008825 Ga0500645_008825_1534_2634 363
119 3300021361 Ga0213872_10014165 Ga0213872_100141654 364
120 3300037471 Ga0395905_0168819 Ga0395905_0168819_460_1587 364
121 3300039447 Ga0436361_0387508 Ga0436361_0387508_2378_3526 364
122 3300053157 Ga0500624_000020 Ga0500624_000020_103638_104732 364
123 3300053178 Ga0500637_0000813 Ga0500637_0000813_321_1415 364
124 3300009174 Ga0105241_10009952 Ga0105241_100099522 365
125 3300013102 Ga0157371_10031511 Ga0157371_100315113 365
126 3300009551 Ga0105238_10004635 Ga0105238_100046358 366
127 3300025226 Ga0209674_103318 Ga0209674_1033182 366
128 3300025917 Ga0207660_10019904 Ga0207660_100199042 366
129 3300053119 Ga0500595_013490 Ga0500595_013490_1015_2124 366
130 iso_pu_bacteria 2643221588 2643948446 366
131 3300009098 Ga0105245_10001436 Ga0105245_1000143610 368
132 3300009148 Ga0105243_10073101 Ga0105243_100731012 368
133 3300046558 Ga0495633_0000659 Ga0495633_0000659_20894_22000 368
134 3300046694 Ga0495649_0025915 Ga0495649_0025915_1547_2704 368
135 3300049581 Ga0501047_0034198 Ga0501047_0034198_1299_2453 368
136 3300049822 Ga0501035_0038275 Ga0501035_0038275_1620_2774 368
137 3300049823 Ga0501044_0021610 Ga0501044_0021610_3338_4492 368
138 3300009011 Ga0105251_10008943 Ga0105251_100089433 369
139 3300013102 Ga0157371_10154600 Ga0157371_101546002 369
140 3300013296 Ga0157374_10001585 Ga0157374_100015855 369
141 3300017792 Ga0163161_10009060 Ga0163161_100090603 369
142 3300025735 Ga0207713_1008786 Ga0207713_10087863 369
143 3300037471 Ga0395905_0035930 Ga0395905_0035930_828_1970 369
144 3300038443 Ga0395901_0163735 Ga0395901_0163735_315_1457 369
145 3300047470 Ga0495681_0002818 Ga0495681_0002818_4667_5824 369
146 3300048903 Ga0496100_0156338 Ga0496100_0156338_141_1253 369
147 3300048908 Ga0496105_0188734 Ga0496105_0188734_235_1347 369
148 3300048908 Ga0496105_0288637 Ga0496105_0288637_98_1255 369
149 3300048911 Ga0496108_0127773 Ga0496108_0127773_814_1926 369
150 3300048919 Ga0496116_0000311 Ga0496116_0000311_61272_62423 369
151 3300048921 Ga0496118_0077415 Ga0496118_0077415_479_1630 369
152 3300048924 Ga0496121_0012070 Ga0496121_0012070_7169_8320 369
153 3300048925 Ga0496122_0004302 Ga0496122_0004302_14255_15406 369
154 3300048925 Ga0496122_0032029 Ga0496122_0032029_889_2046 369
155 3300048926 Ga0496123_0002107 Ga0496123_0002107_17172_18323 369
156 3300048927 Ga0496124_0016588 Ga0496124_0016588_4515_5672 369
157 3300048927 Ga0496124_0019231 Ga0496124_0019231_130_1281 369
158 3300048927 Ga0496124_0239986 Ga0496124_0239986_148_1299 369
159 3300048928 Ga0496125_0008563 Ga0496125_0008563_7024_8175 369
160 3300048928 Ga0496125_0042630 Ga0496125_0042630_757_1914 369
161 3300048929 Ga0496126_0000077 Ga0496126_0000077_209680_210831 369
162 3300048929 Ga0496126_0057365 Ga0496126_0057365_1158_2315 369
163 3300053096 Ga0500641_0065385 Ga0500641_0065385_383_1492 369
164 3300005341 Ga0070691_10053514 Ga0070691_100535142 370
165 3300046691 Ga0495670_0061891 Ga0495670_0061891_114_1226 370
166 3300009545 Ga0105237_10005557 Ga0105237_100055576 371
167 3300013104 Ga0157370_10051296 Ga0157370_100512963 371
168 3300025911 Ga0207654_10013187 Ga0207654_100131872 371
169 3300025913 Ga0207695_10036984 Ga0207695_100369842 371
170 3300025949 Ga0207667_10233450 Ga0207667_102334502 371
171 3300026116 Ga0207674_10321399 Ga0207674_103213991 371
172 3300046460 Ga0495638_0000168 Ga0495638_0000168_81049_82167 371
173 iso_pu_bacteria 2885429604 2885430908 371
174 3300005327 Ga0070658_10176182 Ga0070658_101761822 372
175 3300005330 Ga0070690_100055688 Ga0070690_1000556884 372
176 3300005338 Ga0068868_100033957 Ga0068868_1000339576 372
177 3300005339 Ga0070660_100032277 Ga0070660_1000322773 372
178 3300005344 Ga0070661_100084804 Ga0070661_1000848042 372
179 3300005354 Ga0070675_100034270 Ga0070675_1000342702 372
180 3300005355 Ga0070671_100067277 Ga0070671_1000672771 372
181 3300005364 Ga0070673_100001594 Ga0070673_1000015949 372
182 3300005364 Ga0070673_100089390 Ga0070673_1000893903 372
183 3300005366 Ga0070659_100000810 Ga0070659_10000081010 372
184 3300005366 Ga0070659_100037750 Ga0070659_1000377503 372
185 3300005367 Ga0070667_100043948 Ga0070667_1000439482 372
186 3300005456 Ga0070678_100014009 Ga0070678_1000140092 372
187 3300005456 Ga0070678_100167458 Ga0070678_1001674581 372
188 3300005457 Ga0070662_100009083 Ga0070662_1000090839 372
189 3300005458 Ga0070681_10227390 Ga0070681_102273902 372
190 3300005530 Ga0070679_100164893 Ga0070679_1001648932 372
191 3300005548 Ga0070665_100021832 Ga0070665_1000218325 372
192 3300005564 Ga0070664_100148474 Ga0070664_1001484741 372
193 3300005614 Ga0068856_100042885 Ga0068856_1000428852 372
194 3300005616 Ga0068852_100039807 Ga0068852_1000398073 372
195 3300005616 Ga0068852_100106947 Ga0068852_1001069473 372
196 3300005616 Ga0068852_100387902 Ga0068852_1003879022 372
197 3300005617 Ga0068859_100058223 Ga0068859_1000582236 372
198 3300005617 Ga0068859_100124832 Ga0068859_1001248322 372
199 3300005618 Ga0068864_100095238 Ga0068864_1000952382 372
200 3300005718 Ga0068866_10010054 Ga0068866_100100543 372
201 3300005834 Ga0068851_10012730 Ga0068851_100127306 372
202 3300005842 Ga0068858_100004720 Ga0068858_1000047205 372
203 3300005843 Ga0068860_100045818 Ga0068860_1000458182 372
204 3300006028 Ga0070717_10028469 Ga0070717_100284692 372
205 3300006358 Ga0068871_100117576 Ga0068871_1001175762 372
206 3300006931 Ga0097620_100058221 Ga0097620_1000582212 372
207 3300006931 Ga0097620_100124840 Ga0097620_1001248403 372
208 3300013104 Ga0157370_10004014 Ga0157370_100040149 372
209 3300013104 Ga0157370_10152729 Ga0157370_101527292 372
210 3300013307 Ga0157372_10098854 Ga0157372_100988543 372
211 3300013308 Ga0157375_10012152 Ga0157375_100121522 372
212 3300025315 Ga0207697_10011894 Ga0207697_100118944 372
213 3300025321 Ga0207656_10014196 Ga0207656_100141962 372
214 3300025901 Ga0207688_10123280 Ga0207688_101232802 372
215 3300025903 Ga0207680_10000604 Ga0207680_1000060418 372
216 3300025909 Ga0207705_10028276 Ga0207705_100282765 372
217 3300025920 Ga0207649_10027599 Ga0207649_100275993 372
218 3300025924 Ga0207694_10039322 Ga0207694_100393223 372
219 3300025931 Ga0207644_10001058 Ga0207644_100010583 372
220 3300025931 Ga0207644_10013605 Ga0207644_100136053 372
221 3300025932 Ga0207690_10000946 Ga0207690_1000094610 372
222 3300025932 Ga0207690_10122557 Ga0207690_101225572 372
223 3300025933 Ga0207706_10003751 Ga0207706_100037513 372
224 3300025935 Ga0207709_10137465 Ga0207709_101374652 372
225 3300025937 Ga0207669_10005131 Ga0207669_100051313 372
226 3300025938 Ga0207704_10009183 Ga0207704_100091836 372
227 3300025940 Ga0207691_10000954 Ga0207691_1000095433 372
228 3300025941 Ga0207711_10000193 Ga0207711_1000019368 372
229 3300025941 Ga0207711_10018614 Ga0207711_100186149 372
230 3300025944 Ga0207661_10001837 Ga0207661_100018378 372
231 3300025960 Ga0207651_10000289 Ga0207651_100002893 372
232 3300025960 Ga0207651_10009931 Ga0207651_100099314 372
233 3300025960 Ga0207651_10035654 Ga0207651_100356542 372
234 3300025986 Ga0207658_10009801 Ga0207658_100098016 372
235 3300025986 Ga0207658_10034173 Ga0207658_100341732 372
236 3300025986 Ga0207658_10035874 Ga0207658_100358742 372
237 3300026035 Ga0207703_10001445 Ga0207703_100014459 372
238 3300026067 Ga0207678_10028787 Ga0207678_100287873 372
239 3300026078 Ga0207702_10124565 Ga0207702_101245651 372
240 3300026088 Ga0207641_10073303 Ga0207641_100733034 372
241 3300026088 Ga0207641_10075177 Ga0207641_100751773 372
242 3300026095 Ga0207676_10104160 Ga0207676_101041602 372
243 3300026121 Ga0207683_10001453 Ga0207683_1000145328 372
244 3300026142 Ga0207698_10080307 Ga0207698_100803072 372
245 3300028379 Ga0268266_10027285 Ga0268266_100272854 372
246 3300037418 Ga0395900_0025055 Ga0395900_0025055_3370_4521 372
247 3300037418 Ga0395900_0174125 Ga0395900_0174125_405_1556 372
248 3300037466 Ga0395898_0004872 Ga0395898_0004872_3817_4968 372
249 3300037466 Ga0395898_0047196 Ga0395898_0047196_3060_4211 372
250 3300037466 Ga0395898_0084091 Ga0395898_0084091_1231_2382 372
251 3300037471 Ga0395905_0002396 Ga0395905_0002396_19049_20200 372
252 3300037471 Ga0395905_0010509 Ga0395905_0010509_126_1277 372
253 3300037471 Ga0395905_0014925 Ga0395905_0014925_86_1237 372
254 3300037471 Ga0395905_0087791 Ga0395905_0087791_344_1495 372
255 3300037471 Ga0395905_0227331 Ga0395905_0227331_518_1669 372
256 3300038443 Ga0395901_0018547 Ga0395901_0018547_4924_6075 372
257 3300038443 Ga0395901_0041201 Ga0395901_0041201_2536_3687 372
258 3300038443 Ga0395901_0253156 Ga0395901_0253156_325_1476 372
259 3300042157 Ga0439458_0000968 Ga0439458_0000968_2722_3873 372
260 3300044694 Ga0466963_0043638 Ga0466963_0043638_842_1963 372
261 3300045976 Ga0466967_0142994 Ga0466967_0142994_721_1842 372
262 3300005578 Ga0068854_100016665 Ga0068854_1000166653 373
263 3300025981 Ga0207640_10008796 Ga0207640_100087963 373
264 3300013102 Ga0157371_10212292 Ga0157371_102122921 374
265 3300013104 Ga0157370_10076877 Ga0157370_100768773 374
266 3300037312 Ga0395899_0052218 Ga0395899_0052218_950_2077 374
267 3300037418 Ga0395900_0035250 Ga0395900_0035250_1565_2692 374
268 3300039447 Ga0436361_0450656 Ga0436361_0450656_36_1211 374
269 3300042015 Ga0439462_0000049 Ga0439462_0000049_12504_13640 374
270 iso_pu_bacteria 2599185354 2600203071 374
271 iso_pu_bacteria 2738541275 2738709473 374
272 iso_pu_bacteria 2738541301 2738847898 374
273 iso_pu_bacteria 2738541304 2738863627 374
274 iso_pu_bacteria 2738543022 2739296145 374
275 iso_pu_bacteria 2738543033 2739357823 374
276 iso_pu_bacteria 2919138771 2919140475 374
277 iso_pu_bacteria 2928100450 2928102608 374
278 iso_pu_bacteria 2928959182 2928959305 374
279 iso_pu_bacteria 8057101203 8057102536 374
280 3300005616 Ga0068852_100084532 Ga0068852_1000845322 375
281 3300009094 Ga0111539_10547919 Ga0111539_105479192 375
282 3300013104 Ga0157370_10324072 Ga0157370_103240721 375
283 3300046522 Ga0495643_0000110 Ga0495643_0000110_53170_54300 375
284 3300049708 Ga0501245_002321 Ga0501245_002321_253_1380 375
285 3300053087 Ga0500643_010408 Ga0500643_010408_564_1697 375
286 3300009093 Ga0105240_10005390 Ga0105240_100053907 376
287 3300009545 Ga0105237_10097494 Ga0105237_100974942 376
288 3300009551 Ga0105238_10005550 Ga0105238_100055503 376
289 3300013104 Ga0157370_10004125 Ga0157370_100041259 376
290 3300013105 Ga0157369_10020348 Ga0157369_100203482 376
291 3300013296 Ga0157374_10190256 Ga0157374_101902561 376
292 3300013307 Ga0157372_10072333 Ga0157372_100723332 376
293 3300044656 Ga0466969_0000708 Ga0466969_0000708_9592_10725 376
294 3300003214 JGI25165J46597_1000053 JGI25165J46597_100005345 377
295 3300005548 Ga0070665_100001794 Ga0070665_10000179410 377
296 3300005563 Ga0068855_100003804 Ga0068855_1000038042 377
297 3300005563 Ga0068855_100250475 Ga0068855_1002504752 377
298 3300005842 Ga0068858_100001656 Ga0068858_10000165610 377
299 3300009093 Ga0105240_10000927 Ga0105240_1000092727 377
300 3300009545 Ga0105237_10006370 Ga0105237_100063704 377
301 3300025261 Ga0209233_1000119 Ga0209233_1000119187 377
302 3300025913 Ga0207695_10002577 Ga0207695_1000257710 377
303 3300025914 Ga0207671_10001826 Ga0207671_1000182612 377
304 3300025914 Ga0207671_10006503 Ga0207671_100065037 377
305 3300025927 Ga0207687_10006357 Ga0207687_100063572 377
306 3300025949 Ga0207667_10001307 Ga0207667_100013076 377
307 3300026035 Ga0207703_10001551 Ga0207703_100015516 377
308 3300028379 Ga0268266_10003656 Ga0268266_100036564 377
309 3300031616 Ga0307508_10002299 Ga0307508_1000229915 377
310 3300046522 Ga0495643_0079028 Ga0495643_0079028_225_1358 377
311 3300047472 Ga0495686_0025069 Ga0495686_0025069_337_1473 377
312 3300048924 Ga0496121_0002818 Ga0496121_0002818_24425_25573 377
313 3300053134 Ga0500658_0052735 Ga0500658_0052735_26_1162 377
314 3300053153 Ga0500616_0116670 Ga0500616_0116670_115_1251 377
315 iso_pu_bacteria 2751185897 2753766615 377
316 iso_pu_bacteria 2919709256 2919709475 377
317 3300001990 JGI24737J22298_10002134 JGI24737J22298_100021343 378
318 3300005335 Ga0070666_10001550 Ga0070666_100015506 378
319 3300005335 Ga0070666_10014729 Ga0070666_100147293 378
320 3300005354 Ga0070675_100049402 Ga0070675_1000494023 378
321 3300005355 Ga0070671_100232630 Ga0070671_1002326301 378
322 3300005355 Ga0070671_100380424 Ga0070671_1003804241 378
323 3300005356 Ga0070674_100056443 Ga0070674_1000564432 378
324 3300005364 Ga0070673_100192365 Ga0070673_1001923652 378
325 3300005366 Ga0070659_100058126 Ga0070659_1000581262 378
326 3300005367 Ga0070667_100008009 Ga0070667_1000080096 378
327 3300005539 Ga0068853_100045333 Ga0068853_1000453333 378
328 3300005616 Ga0068852_100138783 Ga0068852_1001387832 378
329 3300005618 Ga0068864_100091197 Ga0068864_1000911972 378
330 3300005841 Ga0068863_100001700 Ga0068863_10000170015 378
331 3300011119 Ga0105246_10020541 Ga0105246_100205412 378
332 3300013104 Ga0157370_10114595 Ga0157370_101145951 378
333 3300014325 Ga0163163_10024467 Ga0163163_100244675 378
334 3300015690 Ga0183363_1007 Ga0183363_100798 378
335 3300025904 Ga0207647_10015732 Ga0207647_100157324 378
336 3300025909 Ga0207705_10043172 Ga0207705_100431722 378
337 3300025925 Ga0207650_10055146 Ga0207650_100551462 378
338 3300025927 Ga0207687_10074022 Ga0207687_100740222 378
339 3300025932 Ga0207690_10231153 Ga0207690_102311532 378
340 3300026095 Ga0207676_10108063 Ga0207676_101080632 378
341 3300026116 Ga0207674_10000057 Ga0207674_1000005766 378
342 3300037312 Ga0395899_0062593 Ga0395899_0062593_195_1364 378
343 3300037312 Ga0395899_0185493 Ga0395899_0185493_83_1252 378
344 3300037418 Ga0395900_0008897 Ga0395900_0008897_8404_9573 378
345 3300037471 Ga0395905_0001585 Ga0395905_0001585_6650_7819 378
346 3300037471 Ga0395905_0006060 Ga0395905_0006060_4107_5276 378
347 3300038443 Ga0395901_0045541 Ga0395901_0045541_2209_3378 378
348 3300047443 Ga0495687_058468 Ga0495687_058468_237_1376 378
349 3300048912 Ga0496109_0029421 Ga0496109_0029421_1253_2392 378
350 3300048914 Ga0496111_0076888 Ga0496111_0076888_389_1528 378
351 3300048915 Ga0496112_0031626 Ga0496112_0031626_1580_2719 378
352 3300048916 Ga0496113_0022161 Ga0496113_0022161_1582_2721 378
353 iso_pu_bacteria 2808606401 2809062635 378
354 iso_pu_bacteria 2808606404 2809078681 378
355 iso_pu_bacteria 2808606405 2809083024 378
356 iso_pu_bacteria 2848297114 2848298377 378
357 iso_pu_bacteria 2880518877 2880521559 378
358 iso_pu_bacteria 2984555340 2984556850 378
359 iso_pu_bacteria 2984564862 2984564990 378
360 iso_pu_bacteria 2993356040 2993356054 378
361 3300021361 Ga0213872_10002549 Ga0213872_100025492 379
362 3300037471 Ga0395905_0284781 Ga0395905_0284781_359_1501 379
363 3300039447 Ga0436361_0633763 Ga0436361_0633763_8504_9643 379
364 iso_pu_bacteria 8054302542 8054305630 379
365 3300003794 Ga0055531_10035211 Ga0055531_100352112 380
366 3300005262 Ga0065165_1013176 Ga0065165_10131762 380
367 3300005355 Ga0070671_100119476 Ga0070671_1001194762 380
368 3300005618 Ga0068864_100097186 Ga0068864_1000971862 380
369 3300009093 Ga0105240_10027381 Ga0105240_100273813 380
370 3300021361 Ga0213872_10000956 Ga0213872_100009566 380
371 3300025304 Ga0209257_1000740 Ga0209257_100074020 380
372 3300025913 Ga0207695_10088080 Ga0207695_100880801 380
373 3300037418 Ga0395900_0001865 Ga0395900_0001865_9201_10376 380
374 3300037471 Ga0395905_0001467 Ga0395905_0001467_25163_26335 380
375 3300037471 Ga0395905_0002981 Ga0395905_0002981_14472_15647 380
376 3300038443 Ga0395901_0039185 Ga0395901_0039185_2521_3696 380
377 3300038443 Ga0395901_0099054 Ga0395901_0099054_1559_2731 380
378 3300039447 Ga0436361_0478490 Ga0436361_0478490_11630_12772 380
379 3300048913 Ga0496110_0044044 Ga0496110_0044044_353_1510 380
380 iso_pu_bacteria 2510917021 2511126078 380
381 3300003771 Ga0055526_1004418 Ga0055526_10044183 381
382 3300005262 Ga0065165_1005599 Ga0065165_10055995 381
383 3300005618 Ga0068864_100057106 Ga0068864_1000571061 381
384 3300014325 Ga0163163_10048029 Ga0163163_100480294 381
385 3300025229 Ga0209147_101018 Ga0209147_1010189 381
386 3300025273 Ga0209673_1004498 Ga0209673_10044985 381
387 3300025295 Ga0209564_1001496 Ga0209564_100149615 381
388 3300026088 Ga0207641_10073794 Ga0207641_100737942 381
389 3300026095 Ga0207676_10032430 Ga0207676_100324302 381
390 3300046453 Ga0495627_000024 Ga0495627_000024_174779_175924 381
391 3300046501 Ga0495607_0017764 Ga0495607_0017764_3021_4169 381
392 3300046524 Ga0495648_0011621 Ga0495648_0011621_4091_5236 381
393 3300046542 Ga0495597_0011823 Ga0495597_0011823_1161_2309 381
394 3300053109 Ga0500569_000929 Ga0500569_000929_722_1870 381
395 3300053157 Ga0500624_000059 Ga0500624_000059_36345_37490 381
396 iso_pu_bacteria 2775507255 2778123359 381
397 3300003215 JGI25153J46596_10000005 JGI25153J46596_10000005133 382
398 3300025297 Ga0209758_1000001 Ga0209758_1000001133 382
399 3300046506 Ga0495583_0002499 Ga0495583_0002499_6500_7648 382
400 3300046524 Ga0495648_0000015 Ga0495648_0000015_182586_183734 382
401 3300046558 Ga0495633_0022557 Ga0495633_0022557_299_1447 382
402 3300046692 Ga0495671_0000004 Ga0495671_0000004_533483_534631 382
403 3300047469 Ga0495673_0000021 Ga0495673_0000021_533483_534631 382
404 3300053087 Ga0500643_003665 Ga0500643_003665_513_1661 382
405 3300053157 Ga0500624_000277 Ga0500624_000277_3887_5035 382
406 3300001989 JGI24739J22299_10016539 JGI24739J22299_100165392 383
407 3300005328 Ga0070676_10023742 Ga0070676_100237422 383
408 3300005336 Ga0070680_100018854 Ga0070680_1000188542 383
409 3300005347 Ga0070668_100095822 Ga0070668_1000958223 383
410 3300005356 Ga0070674_100007680 Ga0070674_1000076803 383
411 3300005457 Ga0070662_100211984 Ga0070662_1002119841 383
412 3300005458 Ga0070681_10033744 Ga0070681_100337442 383
413 3300005530 Ga0070679_100049280 Ga0070679_1000492802 383
414 3300006358 Ga0068871_100125661 Ga0068871_1001256611 383
415 3300025904 Ga0207647_10004919 Ga0207647_100049197 383
416 3300025907 Ga0207645_10082008 Ga0207645_100820082 383
417 3300025912 Ga0207707_10029222 Ga0207707_100292222 383
418 3300025917 Ga0207660_10026950 Ga0207660_100269502 383
419 3300025933 Ga0207706_10072036 Ga0207706_100720362 383
420 3300025937 Ga0207669_10000778 Ga0207669_1000077812 383
421 3300031250 Ga0265331_10014131 Ga0265331_100141313 383
422 3300046453 Ga0495627_000124 Ga0495627_000124_71149_72300 383
423 3300046471 Ga0495650_0000158 Ga0495650_0000158_34837_35994 383
424 3300046471 Ga0495650_0000822 Ga0495650_0000822_15014_16165 383
425 3300046491 Ga0495584_0066552 Ga0495584_0066552_220_1377 383
426 3300046506 Ga0495583_0006584 Ga0495583_0006584_2460_3617 383
427 3300046506 Ga0495583_0012174 Ga0495583_0012174_1509_2666 383
428 3300046507 Ga0495606_0000279 Ga0495606_0000279_38946_40103 383
429 3300046512 Ga0495610_0000022 Ga0495610_0000022_237170_238321 383
430 3300046512 Ga0495610_0000247 Ga0495610_0000247_50498_51652 383
431 3300046513 Ga0495616_0033618 Ga0495616_0033618_159_1385 383
432 3300046515 Ga0495620_0015417 Ga0495620_0015417_879_2030 383
433 3300046519 Ga0495632_0000533 Ga0495632_0000533_11638_12789 383
434 3300046520 Ga0495637_0003156 Ga0495637_0003156_3514_4671 383
435 3300046522 Ga0495643_0005414 Ga0495643_0005414_573_1730 383
436 3300046660 Ga0495625_0000264 Ga0495625_0000264_42530_43687 383
437 3300046660 Ga0495625_0075713 Ga0495625_0075713_926_2083 383
438 3300046684 Ga0495669_0000159 Ga0495669_0000159_11767_12924 383
439 3300047323 Ga0495683_0002461 Ga0495683_0002461_6629_7786 383
440 3300047443 Ga0495687_000089 Ga0495687_000089_23962_25119 383
441 3300047443 Ga0495687_002076 Ga0495687_002076_3218_4375 383
442 3300047445 Ga0495677_0005247 Ga0495677_0005247_678_1835 383
443 3300047470 Ga0495681_0000010 Ga0495681_0000010_18267_19418 383
444 3300053079 Ga0500610_0000192 Ga0500610_0000192_13712_14869 383
445 3300053091 Ga0500647_0064402 Ga0500647_0064402_57_1214 383
446 3300053119 Ga0500595_001586 Ga0500595_001586_2498_3655 383
447 3300053130 Ga0500642_0001096 Ga0500642_0001096_502_1659 383
448 3300053177 Ga0500636_0002455 Ga0500636_0002455_6035_7192 383
449 3300053730 Ga0500645_000008 Ga0500645_000008_17082_18239 383
450 3300005337 Ga0070682_100014547 Ga0070682_1000145473 384
451 3300005458 Ga0070681_10053570 Ga0070681_100535703 384
452 3300005530 Ga0070679_100013607 Ga0070679_1000136074 384
453 3300005563 Ga0068855_100004318 Ga0068855_1000043187 384
454 3300025912 Ga0207707_10000968 Ga0207707_1000096813 384
455 3300025913 Ga0207695_10009139 Ga0207695_100091397 384
456 3300025914 Ga0207671_10054917 Ga0207671_100549173 384
457 3300025917 Ga0207660_10060222 Ga0207660_100602222 384
458 3300025924 Ga0207694_10012608 Ga0207694_100126083 384
459 3300025949 Ga0207667_10019314 Ga0207667_100193144 384
460 3300044694 Ga0466963_0239266 Ga0466963_0239266_12_1190 384
461 3300046522 Ga0495643_0044671 Ga0495643_0044671_1091_2248 384
462 3300046660 Ga0495625_0001426 Ga0495625_0001426_27497_28654 384
463 3300001915 JGI24741J21665_1000104 JGI24741J21665_10001048 385
464 3300001979 JGI24740J21852_10005882 JGI24740J21852_100058825 385
465 3300001989 JGI24739J22299_10022422 JGI24739J22299_100224222 385
466 3300001990 JGI24737J22298_10001275 JGI24737J22298_100012752 385
467 3300002067 JGI24735J21928_10000917 JGI24735J21928_100009177 385
468 3300002075 JGI24738J21930_10000323 JGI24738J21930_1000032313 385
469 3300005339 Ga0070660_100037091 Ga0070660_1000370911 385
470 3300005344 Ga0070661_100145568 Ga0070661_1001455682 385
471 3300005366 Ga0070659_100030818 Ga0070659_1000308184 385
472 3300005455 Ga0070663_100006034 Ga0070663_1000060342 385
473 3300005539 Ga0068853_100284255 Ga0068853_1002842551 385
474 3300005564 Ga0070664_100032868 Ga0070664_1000328682 385
475 3300009978 Ga0105148_100010 Ga0105148_10001010 385
476 3300014326 Ga0157380_10047453 Ga0157380_100474533 385
477 3300025904 Ga0207647_10007464 Ga0207647_100074642 385
478 3300025919 Ga0207657_10014216 Ga0207657_100142166 385
479 3300025920 Ga0207649_10102210 Ga0207649_101022102 385
480 3300025932 Ga0207690_10223706 Ga0207690_102237062 385
481 3300025933 Ga0207706_10083966 Ga0207706_100839662 385
482 3300026041 Ga0207639_10004017 Ga0207639_1000401710 385
483 3300026067 Ga0207678_10002196 Ga0207678_1000219610 385
484 3300026078 Ga0207702_10005336 Ga0207702_100053369 385
485 3300031548 Ga0307408_100002097 Ga0307408_10000209710 385
486 3300049669 Ga0501235_014748 Ga0501235_014748_168_1325 385
487 3300049705 Ga0501225_0001396 Ga0501225_0001396_5947_7104 385
488 3300049761 Ga0501264_002561 Ga0501264_002561_307_1464 385

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01263

Aldose_epim

Aldose 1-epimerase

42

376

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
1so0-assembly4.cif.gz_D crystal structure of human galactose mutarotase complexed with galactose 0.9701 30 382
4rnl-assembly1.cif.gz_A the crystal structure of a possible galactose mutarotase from streptomyces platensis subsp. rosaceus 0.9638 28 383
1so0-assembly4.cif.gz_D crystal structure of human galactose mutarotase complexed with galactose 0.9618 30 382
4rnl-assembly1.cif.gz_A the crystal structure of a possible galactose mutarotase from streptomyces platensis subsp. rosaceus 0.9582 28 383
1nsu-assembly1.cif.gz_A crystal structure of galactose mutarotase from lactococcus lactis mutant h96n complexed with galactose 0.9559 31 384
ID Description Score Start End Superfamily
af_Q66HG4_1_342_2.70.98.10 Mainly Beta;Distorted Sandwich;Beta-galactosidase; Chain A, domain 5; 0.9717 30 382 2.70.98.10
4rnlC00 Mainly Beta;Distorted Sandwich;Beta-galactosidase; Chain A, domain 5; 0.9635 30 383 2.70.98.10
af_Q66HG4_1_342_2.70.98.10 Mainly Beta;Distorted Sandwich;Beta-galactosidase; Chain A, domain 5; 0.9633 30 382 2.70.98.10
af_Q33AZ5_28_362_2.70.98.10 Mainly Beta;Distorted Sandwich;Beta-galactosidase; Chain A, domain 5; 0.963 48 382 2.70.98.10
af_I1KJ59_42_349_2.70.98.10 Mainly Beta;Distorted Sandwich;Beta-galactosidase; Chain A, domain 5; 0.9605 76 382 2.70.98.10
ID Description Score Start End GO Terms
AF-T0H0Y2-F1-model_v4 Aldose 1-epimerase (EC 5.1.3.3) 0.9958 40 384 GO:0004034
GO:0005737
GO:0006006
GO:0030246
GO:0033499
AF-A0A520J9B2-F1-model_v4 Galactose mutarotase 0.9925 162 384 GO:0004034
GO:0005737
GO:0006006
GO:0030246
GO:0033499
AF-A0A519Q3T9-F1-model_v4 Galactose mutarotase 0.9918 103 384 GO:0004034
GO:0005737
GO:0006006
GO:0030246
GO:0033499
AF-T0H0Y2-F1-model_v4 Aldose 1-epimerase (EC 5.1.3.3) 0.9901 40 384 GO:0004034
GO:0005737
GO:0006006
GO:0030246
GO:0033499
AF-A0A519Q3T9-F1-model_v4 Galactose mutarotase 0.9884 103 384 GO:0004034
GO:0005737
GO:0006006
GO:0030246
GO:0033499

Feature Viewer

pLDDT pTM Quality
90.07 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map