F453640

General Info

Members Datasets Scaffolds Average Seq Length
488 259 976 142

Family's Representative Sequence

Representative Sequence 3300039447|Ga0436361_0785991|Ga0436361_0785991_8332_8862
Length 176
Sequence MHARSQSASAGFLHRGIYLAVAFLSLQFVSYGSFTMSIEKVLYRSHAHAVGGRDGRATVPEAKLDFKLTTPKELGGAGGEGANPEQLFAAGYSACFIGAMKFVAARDKIALPADVSIDGSVGIGVIPNGFGIEVELKISLPGMARDAAQALVDKAHIVCPYSNATRGNIDVTLTII

Samples

Sample ID Description Type Environment
1 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
6 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
7 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
12 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
13 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
14 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
15 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
16 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
17 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
18 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
19 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
32 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
33 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
34 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
35 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
36 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
37 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
38 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
39 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
40 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
41 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
42 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
43 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
44 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
45 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
46 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
47 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
48 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
49 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
50 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
51 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
52 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
53 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
54 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
55 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
56 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
57 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
58 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
61 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
62 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
63 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
64 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
65 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
67 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
68 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
69 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
71 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
72 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
89 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
90 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
91 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
92 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
93 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
94 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
95 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
96 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
97 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
98 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
99 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
100 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
101 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
102 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
103 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
104 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
105 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
106 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
107 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
108 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
109 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
110 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
111 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
112 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
113 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
114 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
115 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
116 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
117 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
118 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
119 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
120 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
121 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
122 3300044650 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4E Metagenome Unclassified
123 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
124 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
125 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
126 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
127 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
128 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
129 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
130 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
131 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
132 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
133 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
134 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
135 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
136 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
137 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
138 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
139 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
140 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
141 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
142 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
143 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
144 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
145 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
146 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
147 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
148 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
149 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
150 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
151 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
152 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
153 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
154 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
155 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
156 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
157 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
158 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
159 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
160 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
161 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
162 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
163 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
164 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
165 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
166 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
167 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
168 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
169 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
170 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
171 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
172 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
173 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
174 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
175 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
176 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
177 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
178 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
179 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
180 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
181 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
182 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
183 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
184 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
185 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
186 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
187 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
188 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
189 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
190 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
191 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
192 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
193 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
194 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
195 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
196 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
197 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
198 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
199 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
200 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
201 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
202 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
203 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
204 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
205 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
206 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
207 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
208 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
209 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
210 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
211 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
212 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
213 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
214 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
215 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
216 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
217 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
218 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
219 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
220 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
221 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
222 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
223 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
224 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
225 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
226 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
227 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
228 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
229 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
230 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
231 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
232 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
233 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
234 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
235 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
236 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
237 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
238 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
239 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
240 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
241 3300049543 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
242 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
243 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
247 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
249 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
250 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
251 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
252 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
253 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
254 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
255 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
256 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
257 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
258 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
259 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.49
Metatranscriptomes 4.3
Isolates 0.2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.3
Nodule 0.2
Rhizoplane 8.61
Rhizosphere 67.62
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436361_0785991 3300039447 Bacteria 8883
2 JGI24739J22299_10099350 3300001989 Bacteria 879
3 JGI24737J22298_10110149 3300001990 Bacteria 815
4 JGI24735J21928_10000195 3300002067 Bacteria 21512
5 JGI24735J21928_10000311 3300002067 Bacteria 16866
6 JGI24738J21930_10002412 3300002075 Bacteria 4897
7 JGI25156J39149_1000631 3300002705 Bacteria 19296
8 JGI25151J46595_10000261 3300003187 Bacteria 61830
9 JGI25151J46595_10009971 3300003187 Bacteria 4453
10 rootH2_10148439 3300003320 Bacteria 5367
11 rootL2_10032981 3300003322 Bacteria 5650
12 rootL2_10101363 3300003322 Bacteria 5316
13 rootH1_10164740 3300003323 Bacteria 3900
14 rootH1_10323806 3300003323 Bacteria 3776
15 JGI25160J50197_1000099 3300003354 Bacteria 86777
16 JGI25160J50197_1000308 3300003354 Bacteria 34655
17 Ga0055533_1000514 3300003756 Bacteria 13996
18 Ga0055527_1008513 3300003760 Bacteria 1222
19 Ga0055524_1005606 3300003775 Bacteria 5575
20 Ga0055524_1009847 3300003775 Bacteria 3849
21 Ga0055524_1021747 3300003775 Bacteria 2115
22 Ga0055536_1006990 3300003781 Bacteria 5134
23 Ga0055536_1016338 3300003781 Bacteria 2486
24 Ga0055536_1070463 3300003781 Bacteria 692
25 Ga0055534_1015983 3300003784 Bacteria 1358
26 Ga0055531_10006737 3300003794 Bacteria 6421
27 Ga0055531_10010749 3300003794 Bacteria 4506
28 Ga0055531_10011056 3300003794 Bacteria 4404
29 Ga0055531_10011953 3300003794 Bacteria 4129
30 Ga0055531_10013395 3300003794 Bacteria 3780
31 Ga0065165_1000119 3300005262 Bacteria 134464
32 Ga0065165_1000326 3300005262 Bacteria 77686
33 Ga0070658_10196896 3300005327 Bacteria 1699
34 Ga0070658_10301107 3300005327 Bacteria 1367
35 Ga0070660_100015740 3300005339 Bacteria 5470
36 Ga0070660_100635514 3300005339 Bacteria 893
37 Ga0070668_101050891 3300005347 Bacteria 733
38 Ga0070673_100238623 3300005364 Bacteria 1580
39 Ga0070667_100018252 3300005367 Bacteria 5816
40 Ga0070714_101413465 3300005435 Bacteria 679
41 Ga0070663_100013777 3300005455 Bacteria 5171
42 Ga0070665_101513489 3300005548 Bacteria 679
43 Ga0068855_100014255 3300005563 Bacteria 9575
44 Ga0068852_100530669 3300005616 Bacteria 1175
45 Ga0068851_10467986 3300005834 Bacteria 751
46 Ga0068858_101426905 3300005842 Bacteria 682
47 Ga0075364_10030688 3300006051 Bacteria 3450
48 Ga0075364_10099446 3300006051 Bacteria 1936
49 Ga0075362_10278359 3300006177 Bacteria 827
50 Ga0099794_10311892 3300007265 Bacteria 815
51 Ga0105251_10314300 3300009011 Bacteria 711
52 Ga0105240_10085926 3300009093 Bacteria 3854
53 Ga0105240_10209188 3300009093 Bacteria 2281
54 Ga0105240_10668569 3300009093 Bacteria 1137
55 Ga0105240_11679768 3300009093 Bacteria 663
56 Ga0105245_10766047 3300009098 Bacteria 1002
57 Ga0105247_10097470 3300009101 Bacteria 1876
58 Ga0105241_10704366 3300009174 Bacteria 922
59 Ga0105248_10057017 3300009177 Bacteria 4384
60 Ga0105237_10106131 3300009545 Bacteria 2800
61 Ga0105238_10146266 3300009551 Bacteria 2340
62 Ga0105238_10345004 3300009551 Bacteria 1477
63 Ga0099796_10271042 3300010159 Bacteria 711
64 Ga0105239_10011546 3300010375 Bacteria 9853
65 Ga0105239_10054782 3300010375 Bacteria 4375
66 Ga0157327_1000523 3300012512 Bacteria 2092
67 Ga0157373_10000495 3300013100 Bacteria 31148
68 Ga0157370_10012484 3300013104 Bacteria 8805
69 Ga0157369_10000729 3300013105 Bacteria 42392
70 Ga0157369_10558697 3300013105 Bacteria 1183
71 Ga0157374_10000246 3300013296 Bacteria 50338
72 Ga0163162_10009968 3300013306 Bacteria 9242
73 Ga0157375_10007089 3300013308 Bacteria 9790
74 Ga0182008_10056663 3300014497 Bacteria 1936
75 Ga0157379_10058310 3300014968 Bacteria 3452
76 Ga0182006_1025410 3300015261 Bacteria 2433
77 Ga0163161_10002253 3300017792 Bacteria 13846
78 Ga0163161_10529297 3300017792 Bacteria 963
79 Ga0206350_10128317 3300020080 Bacteria 1016
80 Ga0213872_10003418 3300021361 Bacteria 8825
81 Ga0224712_10124153 3300022467 Bacteria 1121
82 Ga0209674_100113 3300025226 Bacteria 139708
83 Ga0209672_101573 3300025228 Bacteria 7737
84 Ga0207425_1001096 3300025245 Bacteria 12288
85 Ga0209759_1000113 3300025256 Bacteria 142453
86 Ga0209759_1002784 3300025256 Bacteria 7398
87 Ga0209759_1031268 3300025256 Bacteria 1039
88 Ga0209673_1074484 3300025273 Bacteria 797
89 Ga0209130_1002103 3300025284 Bacteria 10653
90 Ga0209130_1076439 3300025284 Bacteria 548
91 Ga0209675_1012189 3300025291 Bacteria 2787
92 Ga0209675_1020482 3300025291 Bacteria 1790
93 Ga0209676_1000540 3300025292 Bacteria 58505
94 Ga0209676_1005300 3300025292 Bacteria 6794
95 Ga0209676_1008673 3300025292 Bacteria 4496
96 Ga0209676_1010704 3300025292 Bacteria 3782
97 Ga0209025_1000006 3300025294 Bacteria 1153444
98 Ga0209025_1002051 3300025294 Bacteria 22947
99 Ga0209564_1009505 3300025295 Bacteria 4615
100 Ga0209564_1009715 3300025295 Bacteria 4532
101 Ga0209564_1029892 3300025295 Bacteria 1701
102 Ga0209758_1016636 3300025297 Bacteria 3721
103 Ga0209758_1017130 3300025297 Bacteria 3631
104 Ga0209758_1054141 3300025297 Bacteria 1372
105 Ga0209050_1000613 3300025298 Bacteria 56206
106 Ga0209050_1001343 3300025298 Bacteria 27249
107 Ga0209256_1001665 3300025299 Bacteria 21602
108 Ga0209256_1007773 3300025299 Bacteria 5177
109 Ga0209256_1010687 3300025299 Bacteria 3800
110 Ga0207426_1000004 3300025302 Bacteria 1047900
111 Ga0207426_1000215 3300025302 Bacteria 136757
112 Ga0209051_1061332 3300025303 Bacteria 1182
113 Ga0209257_1000133 3300025304 Bacteria 208808
114 Ga0209257_1000789 3300025304 Bacteria 46344
115 Ga0209257_1001855 3300025304 Bacteria 22930
116 Ga0209257_1006067 3300025304 Bacteria 8036
117 Ga0209257_1008547 3300025304 Bacteria 5779
118 Ga0209257_1013587 3300025304 Bacteria 3601
119 Ga0207713_1097312 3300025735 Bacteria 1022
120 Ga0207680_10044522 3300025903 Bacteria 2611
121 Ga0207680_10406713 3300025903 Bacteria 962
122 Ga0207647_10000048 3300025904 Bacteria 88742
123 Ga0207647_10028031 3300025904 Bacteria 3665
124 Ga0207705_10237318 3300025909 Bacteria 1388
125 Ga0207695_10003262 3300025913 Bacteria 23065
126 Ga0207695_10069480 3300025913 Bacteria 3604
127 Ga0207671_10143286 3300025914 Bacteria 1842
128 Ga0207657_10000509 3300025919 Bacteria 41128
129 Ga0207657_10138938 3300025919 Bacteria 1986
130 Ga0207711_10125388 3300025941 Bacteria 2296
131 Ga0207667_10004124 3300025949 Bacteria 17855
132 Ga0207651_10477436 3300025960 Bacteria 1074
133 Ga0207712_10095577 3300025961 Bacteria 2197
134 Ga0207668_10522837 3300025972 Bacteria 1024
135 Ga0207678_10025334 3300026067 Bacteria 5178
136 Ga0207698_10506677 3300026142 Bacteria 1176
137 Ga0307513_10314695 3300031456 Bacteria 1326
138 Ga0307518_10024232 3300031838 Bacteria 4376
139 Ga0307412_10000003 3300031911 Bacteria 659081
140 Ga0307414_10057788 3300032004 Bacteria 2729
141 Ga0373955_0265444 3300035172 Bacteria 1031
142 Ga0395899_0005156 3300037312 Bacteria 10163
143 Ga0395900_0183952 3300037418 Bacteria 2122
144 Ga0395898_0044036 3300037466 Bacteria 4396
145 Ga0395905_0000020 3300037471 Bacteria 337672
146 Ga0395901_0000034 3300038443 Bacteria 230365
147 Ga0436360_0849374 3300039438 Bacteria 1369
148 Ga0436361_0533168 3300039447 Bacteria 5869
149 Ga0436361_0540106 3300039447 Bacteria 1205
150 Ga0436361_1000865 3300039447 Bacteria 21851
151 Ga0436361_1004295 3300039447 Bacteria 632
152 Ga0439436_0008383 3300041404 Bacteria 3176
153 Ga0439438_004156 3300041405 Bacteria 5643
154 Ga0439447_017198 3300041407 Bacteria 1971
155 Ga0439466_0029952 3300041411 Bacteria 1869
156 Ga0451789_0222659 3300041443 Bacteria 637
157 Ga0451802_2177913 3300041460 Bacteria 1499
158 Ga0451806_737056 3300041462 Bacteria 3314
159 Ga0451845_0701233 3300041501 Bacteria 1409
160 Ga0439432_045341 3300042006 Bacteria 1383
161 Ga0439449_0098630 3300042007 Bacteria 1079
162 Ga0439452_006212 3300042010 Bacteria 3760
163 Ga0439454_085876 3300042011 Bacteria 576
164 Ga0439456_003244 3300042013 Bacteria 3288
165 Ga0439462_0073485 3300042015 Bacteria 930
166 Ga0450911_000015 3300042115 Bacteria 109635
167 Ga0450923_019191 3300042125 Bacteria 1315
168 Ga0450904_000002 3300042139 Bacteria 82376
169 Ga0439446_0000030 3300042156 Bacteria 23995
170 Ga0439446_0005900 3300042156 Bacteria 3170
171 Ga0439446_0205321 3300042156 Bacteria 666
172 Ga0450909_053061 3300042185 Bacteria 634
173 Ga0439434_0031956 3300042435 Bacteria 1601
174 Ga0439459_0004197 3300042438 Bacteria 2311
175 Ga0450916_008643 3300042530 Bacteria 1243
176 Ga0450893_0005761 3300042532 Bacteria 1996
177 Ga0466986_0000407 3300044650 Bacteria 13848
178 Ga0466969_0000797 3300044656 Bacteria 17155
179 Ga0466969_0003260 3300044656 Bacteria 8629
180 Ga0466969_0004425 3300044656 Bacteria 7472
181 Ga0466972_0079284 3300044658 Bacteria 1564
182 Ga0466972_0085036 3300044658 Bacteria 1504
183 Ga0466972_0096368 3300044658 Bacteria 1401
184 Ga0466965_0000094 3300044683 Bacteria 25653
185 Ga0466965_0099328 3300044683 Bacteria 1487
186 Ga0466965_0120307 3300044683 Bacteria 1355
187 Ga0466966_0000085 3300044684 Bacteria 58533
188 Ga0466966_0002581 3300044684 Bacteria 11874
189 Ga0466966_0013222 3300044684 Bacteria 5465
190 Ga0466966_0018925 3300044684 Bacteria 4537
191 Ga0466966_0020633 3300044684 Bacteria 4329
192 Ga0466966_0040707 3300044684 Bacteria 2990
193 Ga0466961_0020136 3300044693 Bacteria 4294
194 Ga0466961_0026026 3300044693 Bacteria 3761
195 Ga0466961_0033708 3300044693 Bacteria 3289
196 Ga0466963_0012710 3300044694 Bacteria 5156
197 Ga0466963_0216294 3300044694 Bacteria 1341
198 Ga0466964_0000461 3300044706 Bacteria 12469
199 Ga0466964_0004656 3300044706 Bacteria 5071
200 Ga0466964_0062802 3300044706 Bacteria 1549
201 Ga0466964_0228385 3300044706 Bacteria 907
202 Ga0466971_0000560 3300044719 Bacteria 14740
203 Ga0466971_0005909 3300044719 Bacteria 5324
204 Ga0466968_0029788 3300044735 Bacteria 2258
205 Ga0466968_0087868 3300044735 Bacteria 1373
206 Ga0466968_0208960 3300044735 Bacteria 916
207 Ga0466970_0002721 3300044765 Bacteria 8539
208 Ga0466970_0024025 3300044765 Bacteria 3186
209 Ga0466970_0113570 3300044765 Bacteria 1480
210 Ga0466957_0002417 3300044842 Bacteria 10029
211 Ga0466957_0002701 3300044842 Bacteria 9592
212 Ga0466957_0017339 3300044842 Bacteria 4216
213 Ga0466957_0040051 3300044842 Bacteria 2829
214 Ga0466957_0233917 3300044842 Bacteria 1217
215 Ga0466960_0084801 3300044901 Bacteria 1603
216 Ga0466960_0799453 3300044901 Bacteria 571
217 Ga0466959_0000028 3300045049 Bacteria 114144
218 Ga0466959_0001627 3300045049 Bacteria 13866
219 Ga0466959_0006882 3300045049 Bacteria 7934
220 Ga0466959_0023478 3300045049 Bacteria 4563
221 Ga0466958_0000408 3300045836 Bacteria 17657
222 Ga0466958_0091758 3300045836 Bacteria 1880
223 Ga0466958_0276041 3300045836 Bacteria 1077
224 Ga0466958_0368142 3300045836 Bacteria 926
225 Ga0495617_156410 3300046452 Bacteria 724
226 Ga0495603_0052631 3300046455 Bacteria 2416
227 Ga0495603_0116284 3300046455 Bacteria 1559
228 Ga0495590_0003093 3300046457 Bacteria 6808
229 Ga0495590_0035217 3300046457 Bacteria 1748
230 Ga0495629_0000212 3300046459 Bacteria 52191
231 Ga0495638_0007878 3300046460 Bacteria 7601
232 Ga0495638_0151047 3300046460 Bacteria 1347
233 Ga0495641_0262937 3300046461 Bacteria 776
234 Ga0495651_0278420 3300046462 Bacteria 1131
235 Ga0495653_0006841 3300046463 Bacteria 9368
236 Ga0495653_0228207 3300046463 Bacteria 1248
237 Ga0495650_0000141 3300046471 Bacteria 168676
238 Ga0495650_0000201 3300046471 Bacteria 130128
239 Ga0495650_0000717 3300046471 Bacteria 42281
240 Ga0495650_0064257 3300046471 Bacteria 1460
241 Ga0495650_0209223 3300046471 Bacteria 675
242 Ga0495580_0002074 3300046472 Bacteria 17593
243 Ga0495580_0002409 3300046472 Bacteria 16341
244 Ga0495580_0011697 3300046472 Bacteria 6782
245 Ga0495580_0013949 3300046472 Bacteria 6113
246 Ga0495605_0000043 3300046474 Bacteria 185216
247 Ga0495605_0002980 3300046474 Bacteria 10239
248 Ga0495605_0015531 3300046474 Bacteria 4138
249 Ga0495605_0022057 3300046474 Bacteria 3367
250 Ga0495605_0040220 3300046474 Bacteria 2337
251 Ga0495605_0304563 3300046474 Bacteria 674
252 Ga0495664_0170431 3300046477 Bacteria 1321
253 Ga0495584_0050347 3300046491 Bacteria 2098
254 Ga0495584_0189607 3300046491 Bacteria 1045
255 Ga0495585_0000407 3300046492 Bacteria 41654
256 Ga0495585_0013525 3300046492 Bacteria 4770
257 Ga0495585_0029711 3300046492 Bacteria 3110
258 Ga0495596_0001912 3300046500 Bacteria 11547
259 Ga0495596_0064243 3300046500 Bacteria 1428
260 Ga0495596_0064962 3300046500 Bacteria 1419
261 Ga0495596_0099380 3300046500 Bacteria 1130
262 Ga0495607_0008633 3300046501 Bacteria 6948
263 Ga0495607_0012256 3300046501 Bacteria 5668
264 Ga0495607_0069387 3300046501 Bacteria 1973
265 Ga0495607_0424191 3300046501 Bacteria 601
266 Ga0495583_0005165 3300046506 Bacteria 8990
267 Ga0495583_0072148 3300046506 Bacteria 1515
268 Ga0495583_0100167 3300046506 Bacteria 1237
269 Ga0495606_0042145 3300046507 Bacteria 3055
270 Ga0495606_0267280 3300046507 Bacteria 941
271 Ga0495610_0000027 3300046512 Bacteria 275273
272 Ga0495610_0004070 3300046512 Bacteria 10970
273 Ga0495616_0037145 3300046513 Bacteria 2508
274 Ga0495616_0078963 3300046513 Bacteria 1578
275 Ga0495620_0049878 3300046515 Bacteria 1788
276 Ga0495628_0002243 3300046516 Bacteria 17477
277 Ga0495628_0109320 3300046516 Bacteria 2127
278 Ga0495630_0118548 3300046517 Bacteria 2007
279 Ga0495637_0000058 3300046520 Bacteria 96841
280 Ga0495643_0002154 3300046522 Bacteria 16182
281 Ga0495643_0115698 3300046522 Bacteria 1359
282 Ga0495644_0184455 3300046523 Bacteria 803
283 Ga0495648_0024216 3300046524 Bacteria 4140
284 Ga0495648_0124296 3300046524 Bacteria 1381
285 Ga0495648_0299276 3300046524 Bacteria 754
286 Ga0495648_0465387 3300046524 Bacteria 549
287 Ga0495666_0059677 3300046526 Bacteria 1824
288 Ga0495666_0193284 3300046526 Bacteria 937
289 Ga0495642_0361907 3300046528 Bacteria 638
290 Ga0495652_0829099 3300046529 Bacteria 614
291 Ga0495654_0000022 3300046530 Bacteria 260104
292 Ga0495665_0043476 3300046531 Bacteria 2389
293 Ga0495665_0059895 3300046531 Bacteria 2010
294 Ga0495665_0104742 3300046531 Bacteria 1484
295 Ga0495609_0020177 3300046538 Bacteria 3080
296 Ga0495609_0173392 3300046538 Bacteria 910
297 Ga0495597_0233422 3300046542 Bacteria 727
298 Ga0495597_0246519 3300046542 Bacteria 703
299 Ga0495622_0026872 3300046557 Bacteria 2686
300 Ga0495622_0140551 3300046557 Bacteria 1096
301 Ga0495633_0002821 3300046558 Bacteria 12005
302 Ga0495656_0124068 3300046615 Bacteria 1222
303 Ga0495668_0000109 3300046616 Bacteria 132453
304 Ga0495668_0001526 3300046616 Bacteria 21990
305 Ga0495668_0001669 3300046616 Bacteria 20620
306 Ga0495611_0008173 3300046648 Bacteria 4439
307 Ga0495625_0002661 3300046660 Bacteria 19020
308 Ga0495625_0034926 3300046660 Bacteria 3708
309 Ga0495625_0043765 3300046660 Bacteria 3245
310 Ga0495625_0094934 3300046660 Bacteria 2057
311 Ga0495625_0475490 3300046660 Bacteria 768
312 Ga0495661_0026813 3300046665 Bacteria 3706
313 Ga0495661_0062080 3300046665 Bacteria 2215
314 Ga0495661_0160405 3300046665 Bacteria 1207
315 Ga0495661_0222090 3300046665 Bacteria 978
316 Ga0495588_0190231 3300046674 Bacteria 1084
317 Ga0495599_0361801 3300046678 Bacteria 869
318 Ga0495646_0000968 3300046680 Bacteria 16442
319 Ga0495646_0017165 3300046680 Bacteria 4595
320 Ga0495669_0030867 3300046684 Bacteria 2352
321 Ga0495669_0153830 3300046684 Bacteria 1090
322 Ga0495669_0228779 3300046684 Bacteria 892
323 Ga0495613_0165513 3300046689 Bacteria 1571
324 Ga0495624_0001413 3300046690 Bacteria 18717
325 Ga0495624_0007101 3300046690 Bacteria 7880
326 Ga0495670_0041608 3300046691 Bacteria 2293
327 Ga0495670_0052826 3300046691 Bacteria 2035
328 Ga0495671_0000226 3300046692 Bacteria 48869
329 Ga0495671_0022294 3300046692 Bacteria 3320
330 Ga0495671_0056729 3300046692 Bacteria 1939
331 Ga0495671_0063553 3300046692 Bacteria 1818
332 Ga0495671_0205400 3300046692 Bacteria 955
333 Ga0495649_0050599 3300046694 Bacteria 2254
334 Ga0495649_0060223 3300046694 Bacteria 2043
335 Ga0495649_0434118 3300046694 Bacteria 657
336 Ga0495589_0002002 3300046794 Bacteria 11540
337 Ga0495589_0083446 3300046794 Bacteria 1553
338 Ga0495589_0189895 3300046794 Bacteria 972
339 Ga0495589_0191018 3300046794 Bacteria 969
340 Ga0495660_0009430 3300046810 Bacteria 5693
341 Ga0495660_0135450 3300046810 Bacteria 1231
342 Ga0495604_0071714 3300047317 Bacteria 2619
343 Ga0495636_0019182 3300047318 Bacteria 2747
344 Ga0495674_0002317 3300047319 Bacteria 18690
345 Ga0495674_0005397 3300047319 Bacteria 12273
346 Ga0495674_0006401 3300047319 Bacteria 11291
347 Ga0495672_0008901 3300047320 Bacteria 7336
348 Ga0495672_0029754 3300047320 Bacteria 3434
349 Ga0495672_0197061 3300047320 Bacteria 1009
350 Ga0495676_0128811 3300047321 Bacteria 1830
351 Ga0495680_0013873 3300047322 Bacteria 7010
352 Ga0495683_0004970 3300047323 Bacteria 7444
353 Ga0495683_0006123 3300047323 Bacteria 6599
354 Ga0495683_0021826 3300047323 Bacteria 3298
355 Ga0495687_010750 3300047443 Bacteria 4989
356 Ga0495687_015796 3300047443 Bacteria 3823
357 Ga0495687_107669 3300047443 Bacteria 1032
358 Ga0495675_0146043 3300047444 Bacteria 1463
359 Ga0495679_000449 3300047446 Bacteria 30344
360 Ga0495673_0000009 3300047469 Bacteria 731993
361 Ga0495673_0008624 3300047469 Bacteria 5708
362 Ga0495673_0016146 3300047469 Bacteria 3825
363 Ga0495673_0034454 3300047469 Bacteria 2340
364 Ga0495684_0392865 3300047471 Bacteria 976
365 Ga0495686_0094118 3300047472 Bacteria 1816
366 Ga0495686_0211157 3300047472 Bacteria 1109
367 Ga0495593_0225298 3300047673 Bacteria 940
368 Ga0495626_0046343 3300048091 Bacteria 2026
369 Ga0495626_0082100 3300048091 Bacteria 1430
370 Ga0496100_0000078 3300048903 Bacteria 54410
371 Ga0496100_0000474 3300048903 Bacteria 19245
372 Ga0496100_0161108 3300048903 Bacteria 1608
373 Ga0496100_0438053 3300048903 Bacteria 1000
374 Ga0496101_0000131 3300048904 Bacteria 69805
375 Ga0496101_0000205 3300048904 Bacteria 45101
376 Ga0496101_0031484 3300048904 Bacteria 3729
377 Ga0496101_0109128 3300048904 Bacteria 2081
378 Ga0496101_0236408 3300048904 Bacteria 1421
379 Ga0496102_0000165 3300048905 Bacteria 89141
380 Ga0496102_0000550 3300048905 Bacteria 40359
381 Ga0496102_0010971 3300048905 Bacteria 7808
382 Ga0496102_0119947 3300048905 Bacteria 2456
383 Ga0496102_0634953 3300048905 Bacteria 991
384 Ga0496103_0001056 3300048906 Bacteria 19218
385 Ga0496103_0001139 3300048906 Bacteria 18481
386 Ga0496103_0077101 3300048906 Bacteria 2092
387 Ga0496104_0050180 3300048907 Bacteria 3937
388 Ga0496104_0298355 3300048907 Bacteria 1523
389 Ga0496104_0432177 3300048907 Bacteria 1228
390 Ga0496104_0548886 3300048907 Bacteria 1066
391 Ga0496105_0030488 3300048908 Bacteria 4419
392 Ga0496105_0391470 3300048908 Bacteria 1104
393 Ga0496105_0481294 3300048908 Bacteria 976
394 Ga0496106_0000005 3300048909 Bacteria 273394
395 Ga0496106_0288613 3300048909 Bacteria 1315
396 Ga0496106_0361247 3300048909 Bacteria 1166
397 Ga0496107_0054639 3300048910 Bacteria 2882
398 Ga0496107_0228802 3300048910 Bacteria 1383
399 Ga0496107_0297546 3300048910 Bacteria 1201
400 Ga0496110_0302487 3300048913 Bacteria 1457
401 Ga0496112_0026367 3300048915 Bacteria 5590
402 Ga0496112_0035653 3300048915 Bacteria 4848
403 Ga0496112_0415072 3300048915 Bacteria 1285
404 Ga0496113_0002047 3300048916 Bacteria 11586
405 Ga0496113_0037515 3300048916 Bacteria 3557
406 Ga0496115_0118062 3300048918 Bacteria 2182
407 Ga0496115_0205930 3300048918 Bacteria 1625
408 Ga0496115_0220779 3300048918 Bacteria 1564
409 Ga0496116_0032090 3300048919 Bacteria 3749
410 Ga0496117_0000506 3300048920 Bacteria 64332
411 Ga0496117_0000707 3300048920 Bacteria 52889
412 Ga0496117_0014896 3300048920 Bacteria 6669
413 Ga0496117_0036367 3300048920 Bacteria 3685
414 Ga0496117_0159125 3300048920 Bacteria 1326
415 Ga0496118_0000123 3300048921 Bacteria 136618
416 Ga0496118_0000283 3300048921 Bacteria 89206
417 Ga0496118_0023670 3300048921 Bacteria 5326
418 Ga0496118_0055383 3300048921 Bacteria 2993
419 Ga0496118_0112124 3300048921 Bacteria 1806
420 Ga0496118_0112919 3300048921 Bacteria 1797
421 Ga0496119_0095680 3300048922 Bacteria 1677
422 Ga0496119_0287882 3300048922 Bacteria 814
423 Ga0496120_0257540 3300048923 Bacteria 816
424 Ga0496121_0000083 3300048924 Bacteria 226816
425 Ga0496121_0001277 3300048924 Bacteria 43346
426 Ga0496121_0001382 3300048924 Bacteria 41101
427 Ga0496121_0001776 3300048924 Bacteria 34991
428 Ga0496121_0019868 3300048924 Bacteria 6690
429 Ga0496121_0027111 3300048924 Bacteria 5372
430 Ga0496121_0049159 3300048924 Bacteria 3580
431 Ga0496122_0013022 3300048925 Bacteria 8194
432 Ga0496122_0038520 3300048925 Bacteria 3829
433 Ga0496122_0070900 3300048925 Bacteria 2486
434 Ga0496122_0228541 3300048925 Bacteria 1060
435 Ga0496122_0583652 3300048925 Bacteria 526
436 Ga0496123_0031294 3300048926 Bacteria 3874
437 Ga0496123_0085742 3300048926 Bacteria 1893
438 Ga0496124_0011296 3300048927 Bacteria 8939
439 Ga0496124_0167366 3300048927 Bacteria 1707
440 Ga0496124_0537174 3300048927 Bacteria 775
441 Ga0496124_0674563 3300048927 Bacteria 659
442 Ga0496125_0000798 3300048928 Bacteria 51397
443 Ga0496126_0039558 3300048929 Bacteria 4375
444 Ga0496126_0047745 3300048929 Bacteria 3918
445 Ga0496126_0067149 3300048929 Bacteria 3205
446 Ga0496126_0075239 3300048929 Bacteria 2997
447 Ga0496126_0131384 3300048929 Bacteria 2163
448 Ga0496126_0716454 3300048929 Bacteria 776
449 Ga0496126_0781681 3300048929 Bacteria 734
450 Ga0496126_1072924 3300048929 Bacteria 600
451 Ga0501308_003327 3300049128 Bacteria 1482
452 Ga0501309_007927 3300049129 Bacteria 1326
453 Ga0501310_006143 3300049130 Bacteria 1253
454 Ga0501304_021066 3300049160 Bacteria 646
455 Ga0501305_010874 3300049161 Bacteria 1222
456 Ga0501307_050094 3300049162 Bacteria 626
457 Ga0495678_155747 3300049459 Bacteria 734
458 Ga0495682_0003688 3300049460 Bacteria 6748
459 Ga0495682_0073768 3300049460 Bacteria 1227
460 Ga0501312_007919 3300049528 Bacteria 1366
461 Ga0501313_013518 3300049529 Bacteria 959
462 Ga0501314_001347 3300049530 Bacteria 1762
463 Ga0501315_006243 3300049531 Bacteria 1320
464 Ga0501320_069692 3300049536 Bacteria 507
465 Ga0501322_002353 3300049538 Bacteria 1154
466 Ga0501327_09681 3300049543 Bacteria 627
467 Ga0501033_0180141 3300049570 Bacteria 1515
468 Ga0501034_0141327 3300049571 Bacteria 2387
469 Ga0501034_0165914 3300049571 Bacteria 2177
470 Ga0501046_0727031 3300049580 Bacteria 698
471 Ga0501047_0162751 3300049581 Bacteria 2103
472 Ga0501035_0899135 3300049822 Bacteria 701
473 Ga0501044_1044110 3300049823 Bacteria 688
474 Ga0501204_005302 3300049850 Bacteria 1411
475 Ga0501226_000010 3300049853 Bacteria 180094
476 nmdc:mga00v17_106190_c1 3300050491 Bacteria 1777
477 Ga0500618_003310 3300053125 Bacteria 5584
478 Ga0500618_026027 3300053125 Bacteria 1399
479 Ga0587085_071572 3300059506 Bacteria 679
480 Ga0587088_016603 3300059508 Bacteria 1176
481 Ga0587090_066912 3300059510 Bacteria 694
482 Ga0587091_046953 3300059511 Bacteria 873
483 Ga0587094_064628 3300059513 Bacteria 647
484 Ga0587102_022080 3300059649 Bacteria 726
485 Ga0466962_0000574 3300061719 Bacteria 16166
486 Ga0466962_0010430 3300061719 Bacteria 4467
487 Ga0466962_0015662 3300061719 Bacteria 3655
488 2856347743 2856342000 Bacteria 7176905
489 Ga0436361_0785991
490 JGI24739J22299_10099350
491 JGI24737J22298_10110149
492 JGI24735J21928_10000195
493 JGI24735J21928_10000311
494 JGI24738J21930_10002412
495 JGI25156J39149_1000631
496 JGI25151J46595_10000261
497 JGI25151J46595_10009971
498 rootH2_10148439
499 rootL2_10032981
500 rootL2_10101363
501 rootH1_10164740
502 rootH1_10323806
503 JGI25160J50197_1000099
504 JGI25160J50197_1000308
505 Ga0055533_1000514
506 Ga0055527_1008513
507 Ga0055524_1005606
508 Ga0055524_1009847
509 Ga0055524_1021747
510 Ga0055536_1006990
511 Ga0055536_1016338
512 Ga0055536_1070463
513 Ga0055534_1015983
514 Ga0055531_10006737
515 Ga0055531_10010749
516 Ga0055531_10011056
517 Ga0055531_10011953
518 Ga0055531_10013395
519 Ga0065165_1000119
520 Ga0065165_1000326
521 Ga0070658_10196896
522 Ga0070658_10301107
523 Ga0070660_100015740
524 Ga0070660_100635514
525 Ga0070668_101050891
526 Ga0070673_100238623
527 Ga0070667_100018252
528 Ga0070714_101413465
529 Ga0070663_100013777
530 Ga0070665_101513489
531 Ga0068855_100014255
532 Ga0068852_100530669
533 Ga0068851_10467986
534 Ga0068858_101426905
535 Ga0075364_10030688
536 Ga0075364_10099446
537 Ga0075362_10278359
538 Ga0099794_10311892
539 Ga0105251_10314300
540 Ga0105240_10085926
541 Ga0105240_10209188
542 Ga0105240_10668569
543 Ga0105240_11679768
544 Ga0105245_10766047
545 Ga0105247_10097470
546 Ga0105241_10704366
547 Ga0105248_10057017
548 Ga0105237_10106131
549 Ga0105238_10146266
550 Ga0105238_10345004
551 Ga0099796_10271042
552 Ga0105239_10011546
553 Ga0105239_10054782
554 Ga0157327_1000523
555 Ga0157373_10000495
556 Ga0157370_10012484
557 Ga0157369_10000729
558 Ga0157369_10558697
559 Ga0157374_10000246
560 Ga0163162_10009968
561 Ga0157375_10007089
562 Ga0182008_10056663
563 Ga0157379_10058310
564 Ga0182006_1025410
565 Ga0163161_10002253
566 Ga0163161_10529297
567 Ga0206350_10128317
568 Ga0213872_10003418
569 Ga0224712_10124153
570 Ga0209674_100113
571 Ga0209672_101573
572 Ga0207425_1001096
573 Ga0209759_1000113
574 Ga0209759_1002784
575 Ga0209759_1031268
576 Ga0209673_1074484
577 Ga0209130_1002103
578 Ga0209130_1076439
579 Ga0209675_1012189
580 Ga0209675_1020482
581 Ga0209676_1000540
582 Ga0209676_1005300
583 Ga0209676_1008673
584 Ga0209676_1010704
585 Ga0209025_1000006
586 Ga0209025_1002051
587 Ga0209564_1009505
588 Ga0209564_1009715
589 Ga0209564_1029892
590 Ga0209758_1016636
591 Ga0209758_1017130
592 Ga0209758_1054141
593 Ga0209050_1000613
594 Ga0209050_1001343
595 Ga0209256_1001665
596 Ga0209256_1007773
597 Ga0209256_1010687
598 Ga0207426_1000004
599 Ga0207426_1000215
600 Ga0209051_1061332
601 Ga0209257_1000133
602 Ga0209257_1000789
603 Ga0209257_1001855
604 Ga0209257_1006067
605 Ga0209257_1008547
606 Ga0209257_1013587
607 Ga0207713_1097312
608 Ga0207680_10044522
609 Ga0207680_10406713
610 Ga0207647_10000048
611 Ga0207647_10028031
612 Ga0207705_10237318
613 Ga0207695_10003262
614 Ga0207695_10069480
615 Ga0207671_10143286
616 Ga0207657_10000509
617 Ga0207657_10138938
618 Ga0207711_10125388
619 Ga0207667_10004124
620 Ga0207651_10477436
621 Ga0207712_10095577
622 Ga0207668_10522837
623 Ga0207678_10025334
624 Ga0207698_10506677
625 Ga0307513_10314695
626 Ga0307518_10024232
627 Ga0307412_10000003
628 Ga0307414_10057788
629 Ga0373955_0265444
630 Ga0395899_0005156
631 Ga0395900_0183952
632 Ga0395898_0044036
633 Ga0395905_0000020
634 Ga0395901_0000034
635 Ga0436360_0849374
636 Ga0436361_0533168
637 Ga0436361_0540106
638 Ga0436361_1000865
639 Ga0436361_1004295
640 Ga0439436_0008383
641 Ga0439438_004156
642 Ga0439447_017198
643 Ga0439466_0029952
644 Ga0451789_0222659
645 Ga0451802_2177913
646 Ga0451806_737056
647 Ga0451845_0701233
648 Ga0439432_045341
649 Ga0439449_0098630
650 Ga0439452_006212
651 Ga0439454_085876
652 Ga0439456_003244
653 Ga0439462_0073485
654 Ga0450911_000015
655 Ga0450923_019191
656 Ga0450904_000002
657 Ga0439446_0000030
658 Ga0439446_0005900
659 Ga0439446_0205321
660 Ga0450909_053061
661 Ga0439434_0031956
662 Ga0439459_0004197
663 Ga0450916_008643
664 Ga0450893_0005761
665 Ga0466986_0000407
666 Ga0466969_0000797
667 Ga0466969_0003260
668 Ga0466969_0004425
669 Ga0466972_0079284
670 Ga0466972_0085036
671 Ga0466972_0096368
672 Ga0466965_0000094
673 Ga0466965_0099328
674 Ga0466965_0120307
675 Ga0466966_0000085
676 Ga0466966_0002581
677 Ga0466966_0013222
678 Ga0466966_0018925
679 Ga0466966_0020633
680 Ga0466966_0040707
681 Ga0466961_0020136
682 Ga0466961_0026026
683 Ga0466961_0033708
684 Ga0466963_0012710
685 Ga0466963_0216294
686 Ga0466964_0000461
687 Ga0466964_0004656
688 Ga0466964_0062802
689 Ga0466964_0228385
690 Ga0466971_0000560
691 Ga0466971_0005909
692 Ga0466968_0029788
693 Ga0466968_0087868
694 Ga0466968_0208960
695 Ga0466970_0002721
696 Ga0466970_0024025
697 Ga0466970_0113570
698 Ga0466957_0002417
699 Ga0466957_0002701
700 Ga0466957_0017339
701 Ga0466957_0040051
702 Ga0466957_0233917
703 Ga0466960_0084801
704 Ga0466960_0799453
705 Ga0466959_0000028
706 Ga0466959_0001627
707 Ga0466959_0006882
708 Ga0466959_0023478
709 Ga0466958_0000408
710 Ga0466958_0091758
711 Ga0466958_0276041
712 Ga0466958_0368142
713 Ga0495617_156410
714 Ga0495603_0052631
715 Ga0495603_0116284
716 Ga0495590_0003093
717 Ga0495590_0035217
718 Ga0495629_0000212
719 Ga0495638_0007878
720 Ga0495638_0151047
721 Ga0495641_0262937
722 Ga0495651_0278420
723 Ga0495653_0006841
724 Ga0495653_0228207
725 Ga0495650_0000141
726 Ga0495650_0000201
727 Ga0495650_0000717
728 Ga0495650_0064257
729 Ga0495650_0209223
730 Ga0495580_0002074
731 Ga0495580_0002409
732 Ga0495580_0011697
733 Ga0495580_0013949
734 Ga0495605_0000043
735 Ga0495605_0002980
736 Ga0495605_0015531
737 Ga0495605_0022057
738 Ga0495605_0040220
739 Ga0495605_0304563
740 Ga0495664_0170431
741 Ga0495584_0050347
742 Ga0495584_0189607
743 Ga0495585_0000407
744 Ga0495585_0013525
745 Ga0495585_0029711
746 Ga0495596_0001912
747 Ga0495596_0064243
748 Ga0495596_0064962
749 Ga0495596_0099380
750 Ga0495607_0008633
751 Ga0495607_0012256
752 Ga0495607_0069387
753 Ga0495607_0424191
754 Ga0495583_0005165
755 Ga0495583_0072148
756 Ga0495583_0100167
757 Ga0495606_0042145
758 Ga0495606_0267280
759 Ga0495610_0000027
760 Ga0495610_0004070
761 Ga0495616_0037145
762 Ga0495616_0078963
763 Ga0495620_0049878
764 Ga0495628_0002243
765 Ga0495628_0109320
766 Ga0495630_0118548
767 Ga0495637_0000058
768 Ga0495643_0002154
769 Ga0495643_0115698
770 Ga0495644_0184455
771 Ga0495648_0024216
772 Ga0495648_0124296
773 Ga0495648_0299276
774 Ga0495648_0465387
775 Ga0495666_0059677
776 Ga0495666_0193284
777 Ga0495642_0361907
778 Ga0495652_0829099
779 Ga0495654_0000022
780 Ga0495665_0043476
781 Ga0495665_0059895
782 Ga0495665_0104742
783 Ga0495609_0020177
784 Ga0495609_0173392
785 Ga0495597_0233422
786 Ga0495597_0246519
787 Ga0495622_0026872
788 Ga0495622_0140551
789 Ga0495633_0002821
790 Ga0495656_0124068
791 Ga0495668_0000109
792 Ga0495668_0001526
793 Ga0495668_0001669
794 Ga0495611_0008173
795 Ga0495625_0002661
796 Ga0495625_0034926
797 Ga0495625_0043765
798 Ga0495625_0094934
799 Ga0495625_0475490
800 Ga0495661_0026813
801 Ga0495661_0062080
802 Ga0495661_0160405
803 Ga0495661_0222090
804 Ga0495588_0190231
805 Ga0495599_0361801
806 Ga0495646_0000968
807 Ga0495646_0017165
808 Ga0495669_0030867
809 Ga0495669_0153830
810 Ga0495669_0228779
811 Ga0495613_0165513
812 Ga0495624_0001413
813 Ga0495624_0007101
814 Ga0495670_0041608
815 Ga0495670_0052826
816 Ga0495671_0000226
817 Ga0495671_0022294
818 Ga0495671_0056729
819 Ga0495671_0063553
820 Ga0495671_0205400
821 Ga0495649_0050599
822 Ga0495649_0060223
823 Ga0495649_0434118
824 Ga0495589_0002002
825 Ga0495589_0083446
826 Ga0495589_0189895
827 Ga0495589_0191018
828 Ga0495660_0009430
829 Ga0495660_0135450
830 Ga0495604_0071714
831 Ga0495636_0019182
832 Ga0495674_0002317
833 Ga0495674_0005397
834 Ga0495674_0006401
835 Ga0495672_0008901
836 Ga0495672_0029754
837 Ga0495672_0197061
838 Ga0495676_0128811
839 Ga0495680_0013873
840 Ga0495683_0004970
841 Ga0495683_0006123
842 Ga0495683_0021826
843 Ga0495687_010750
844 Ga0495687_015796
845 Ga0495687_107669
846 Ga0495675_0146043
847 Ga0495679_000449
848 Ga0495673_0000009
849 Ga0495673_0008624
850 Ga0495673_0016146
851 Ga0495673_0034454
852 Ga0495684_0392865
853 Ga0495686_0094118
854 Ga0495686_0211157
855 Ga0495593_0225298
856 Ga0495626_0046343
857 Ga0495626_0082100
858 Ga0496100_0000078
859 Ga0496100_0000474
860 Ga0496100_0161108
861 Ga0496100_0438053
862 Ga0496101_0000131
863 Ga0496101_0000205
864 Ga0496101_0031484
865 Ga0496101_0109128
866 Ga0496101_0236408
867 Ga0496102_0000165
868 Ga0496102_0000550
869 Ga0496102_0010971
870 Ga0496102_0119947
871 Ga0496102_0634953
872 Ga0496103_0001056
873 Ga0496103_0001139
874 Ga0496103_0077101
875 Ga0496104_0050180
876 Ga0496104_0298355
877 Ga0496104_0432177
878 Ga0496104_0548886
879 Ga0496105_0030488
880 Ga0496105_0391470
881 Ga0496105_0481294
882 Ga0496106_0000005
883 Ga0496106_0288613
884 Ga0496106_0361247
885 Ga0496107_0054639
886 Ga0496107_0228802
887 Ga0496107_0297546
888 Ga0496110_0302487
889 Ga0496112_0026367
890 Ga0496112_0035653
891 Ga0496112_0415072
892 Ga0496113_0002047
893 Ga0496113_0037515
894 Ga0496115_0118062
895 Ga0496115_0205930
896 Ga0496115_0220779
897 Ga0496116_0032090
898 Ga0496117_0000506
899 Ga0496117_0000707
900 Ga0496117_0014896
901 Ga0496117_0036367
902 Ga0496117_0159125
903 Ga0496118_0000123
904 Ga0496118_0000283
905 Ga0496118_0023670
906 Ga0496118_0055383
907 Ga0496118_0112124
908 Ga0496118_0112919
909 Ga0496119_0095680
910 Ga0496119_0287882
911 Ga0496120_0257540
912 Ga0496121_0000083
913 Ga0496121_0001277
914 Ga0496121_0001382
915 Ga0496121_0001776
916 Ga0496121_0019868
917 Ga0496121_0027111
918 Ga0496121_0049159
919 Ga0496122_0013022
920 Ga0496122_0038520
921 Ga0496122_0070900
922 Ga0496122_0228541
923 Ga0496122_0583652
924 Ga0496123_0031294
925 Ga0496123_0085742
926 Ga0496124_0011296
927 Ga0496124_0167366
928 Ga0496124_0537174
929 Ga0496124_0674563
930 Ga0496125_0000798
931 Ga0496126_0039558
932 Ga0496126_0047745
933 Ga0496126_0067149
934 Ga0496126_0075239
935 Ga0496126_0131384
936 Ga0496126_0716454
937 Ga0496126_0781681
938 Ga0496126_1072924
939 Ga0501308_003327
940 Ga0501309_007927
941 Ga0501310_006143
942 Ga0501304_021066
943 Ga0501305_010874
944 Ga0501307_050094
945 Ga0495678_155747
946 Ga0495682_0003688
947 Ga0495682_0073768
948 Ga0501312_007919
949 Ga0501313_013518
950 Ga0501314_001347
951 Ga0501315_006243
952 Ga0501320_069692
953 Ga0501322_002353
954 Ga0501327_09681
955 Ga0501033_0180141
956 Ga0501034_0141327
957 Ga0501034_0165914
958 Ga0501046_0727031
959 Ga0501047_0162751
960 Ga0501035_0899135
961 Ga0501044_1044110
962 Ga0501204_005302
963 Ga0501226_000010
964 nmdc:mga00v17_106190_c1
965 Ga0500618_003310
966 Ga0500618_026027
967 Ga0587085_071572
968 Ga0587088_016603
969 Ga0587090_066912
970 Ga0587091_046953
971 Ga0587094_064628
972 Ga0587102_022080
973 Ga0466962_0000574
974 Ga0466962_0010430
975 Ga0466962_0015662
976 2856347743

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02566

OsmC

OsmC-like protein

76

174

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
1n2f-assembly1.cif.gz_B crystal structure of p. aeruginosa ohr 0.9797 1 141
6ed0-assembly1.cif.gz_B "ohra (organic hydroperoxide resistance protein) mutant (c61s) in the ""open conformation"" from chromobacterium violaceum" 0.9765 1 141
6ed0-assembly1.cif.gz_A "ohra (organic hydroperoxide resistance protein) mutant (c61s) in the ""open conformation"" from chromobacterium violaceum" 0.9763 2 141
4noz-assembly1.cif.gz_A crystal structure of an organic hydroperoxide resistance protein from burkholderia cenocepacia 0.9762 1 141
1n2f-assembly1.cif.gz_B crystal structure of p. aeruginosa ohr 0.9729 1 141
ID Description Score Start End Superfamily
4xx2A02 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.9677 48 141 3.30.300.20
6mjnB02 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.9583 48 141 3.30.300.20
4xx2A02 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.9576 48 141 3.30.300.20
6mjnB02 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.9294 48 141 3.30.300.20
4nozB01 Mainly Beta;Single Sheet;N-terminal domain of TfIIb; 0.9063 1 47 2.20.25.10
ID Description Score Start End GO Terms
AF-A0A426SWX4-F1-model_v4 deleted 1 50 141
AF-A0A1I5XH41-F1-model_v4 Peroxiredoxin, Ohr subfamily 0.9996 35 141 GO:0006979
AF-A0A7U6GTM4-F1-model_v4 deleted 0.9987 1 141
AF-A0A0P9ULJ2-F1-model_v4 Organic hydroperoxide resistance protein 0.9961 47 141 GO:0006979
AF-A0A4R6EP02-F1-model_v4 Ohr subfamily peroxiredoxin 0.996 42 141 GO:0006979

Map