F453671

General Info

Members Datasets Scaffolds Average Seq Length
488 225 469 172

Family's Representative Sequence

Representative Sequence 3300047472|Ga0495686_0074358|Ga0495686_0074358_1284_1892
Length 202
Sequence LHALPKPRRIRYPGHPALFSPTFYRLFTTDMSNDIPAAANAAPEEKLSHFDATGQAHMVDVGAKNETHRVAVAAGSIRMKPETLAIILAGTAKKGDVLGIARIAAIMASKRTSDLIPLCHPLALTRVTVDFETDPAHSKVHCKAQVETFGKTGVEMEALTAVQVGLLTIYDMCKAVDRGMVMSDVRVLEKHGGKSGDWTAAV

Samples

Sample ID Description Type Environment
1 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
2 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
3 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
4 2643221664 Massilia sp. Root418 Isolate Unclassified
5 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
6 2842711865 Duganella sp. R-73148 Isolate Unclassified
7 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
8 2857553236 Duganella sp. R-74557 Isolate Unclassified
9 2857558681 Duganella sp. R-74565 Isolate Unclassified
10 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
11 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
12 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
13 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
14 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
15 2904424332 Duganella sp. 1411 Isolate Rhizosphere
16 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
17 2919476304 Duganella sp. 3397 Isolate Unclassified
18 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
19 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
20 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
21 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
22 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
23 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
24 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
25 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
26 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
27 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
28 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
29 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
30 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
31 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
32 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
33 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
34 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
35 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
36 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
37 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
38 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
39 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
40 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
41 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
42 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
49 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
50 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
51 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
55 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
58 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
59 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
60 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
61 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
62 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
63 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
64 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
65 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
66 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
67 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
69 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
71 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
72 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
74 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
75 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
77 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
78 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
79 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
80 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
81 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
98 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
99 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
100 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
101 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
102 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
103 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
104 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
105 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
106 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
107 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
108 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
109 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
110 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
111 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
112 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
113 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
114 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
115 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
116 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
117 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
118 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
119 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
120 3300044661 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COC2E Metagenome Unclassified
121 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
122 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
123 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
124 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
125 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
126 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
127 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
128 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
129 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
130 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
131 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
132 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
133 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
134 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
135 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
136 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
137 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
138 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
139 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
140 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
141 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
142 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
143 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
144 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
145 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
146 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
147 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
148 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
149 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
150 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
151 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
152 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
153 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
154 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
155 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
156 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
157 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
158 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
159 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
160 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
161 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
162 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
163 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
164 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
165 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
166 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
167 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
168 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
169 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
170 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
171 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
172 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
173 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
174 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
175 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
176 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
177 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
178 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
179 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
180 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
181 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
182 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
183 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
184 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
185 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
186 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
187 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
188 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
189 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
190 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
191 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
192 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
193 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
194 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
195 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
196 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
197 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
198 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
199 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
200 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
201 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
202 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
203 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
204 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
205 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
206 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
207 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
208 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
209 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
210 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
211 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
212 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
213 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
215 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
216 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
217 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
218 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
219 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
220 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
221 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
222 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
223 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
224 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
225 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.67
Metatranscriptomes 1.43
Isolates 3.89

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.56
Nodule 1.23
Rhizoplane 3.07
Rhizosphere 77.66
Stem 0
Stem Tuber 0
Unclassified 11.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1000142 3300002704 Bacteria 33693
2 JGI25155J39150_1000395 3300002704 Bacteria 12272
3 JGI25156J39149_1001097 3300002705 Bacteria 12362
4 JGI25156J39149_1003611 3300002705 Bacteria 4988
5 JGI25162J39368_1004783 3300002737 Bacteria 2962
6 JGI25154J39366_1000269 3300002738 Bacteria 32398
7 JGI25154J39366_1000916 3300002738 Bacteria 12399
8 JGI25154J39366_1000927 3300002738 Bacteria 12255
9 JGI25157J39369_1000203 3300002741 Bacteria 49480
10 JGI25159J45721_1005685 3300002987 Bacteria 3867
11 rootL2_10015446 3300003322 Bacteria 3528
12 Ga0055532_1000005 3300003758 Bacteria 458107
13 Ga0055542_1005705 3300003762 Bacteria 2761
14 Ga0055526_1000856 3300003771 Bacteria 22650
15 Ga0055526_1001774 3300003771 Bacteria 14988
16 Ga0055537_1000496 3300003773 Bacteria 23957
17 Ga0055524_1000027 3300003775 Bacteria 213655
18 Ga0055524_1001883 3300003775 Bacteria 11402
19 Ga0055534_1000583 3300003784 Bacteria 19177
20 Ga0055528_1000686 3300003790 Bacteria 24151
21 Ga0055543_1002543 3300004625 Bacteria 5951
22 Ga0065165_1000298 3300005262 Bacteria 83243
23 Ga0065165_1042202 3300005262 Bacteria 1348
24 Ga0065714_10270173 3300005288 Bacteria 733
25 Ga0070658_10720144 3300005327 Bacteria 866
26 Ga0070683_101031234 3300005329 Bacteria 790
27 Ga0070670_101410085 3300005331 Bacteria 639
28 Ga0070660_100035030 3300005339 Bacteria 3797
29 Ga0070660_100733062 3300005339 Bacteria 829
30 Ga0070660_100812846 3300005339 Bacteria 786
31 Ga0070661_100011877 3300005344 Bacteria 6077
32 Ga0070659_100021256 3300005366 Bacteria 4938
33 Ga0070662_100172477 3300005457 Bacteria 1699
34 Ga0070662_100797626 3300005457 Bacteria 803
35 Ga0070664_100019392 3300005564 Bacteria 5596
36 Ga0070664_100031999 3300005564 Bacteria 4399
37 Ga0068854_100832314 3300005578 Bacteria 807
38 Ga0068856_100051505 3300005614 Bacteria 4059
39 Ga0068856_100594160 3300005614 Bacteria 1128
40 Ga0068852_100029429 3300005616 Bacteria 4512
41 Ga0068852_100152219 3300005616 Bacteria 2152
42 Ga0068852_100403907 3300005616 Bacteria 1344
43 Ga0079104_1012368 3300006946 Bacteria 2688
44 Ga0099826_10000003 3300006948 Bacteria 1067817
45 Ga0105251_10136420 3300009011 Bacteria 1111
46 Ga0105244_10003849 3300009036 Bacteria 10573
47 Ga0105244_10030050 3300009036 Bacteria 2895
48 Ga0105240_10014863 3300009093 Bacteria 10610
49 Ga0105240_10026065 3300009093 Bacteria 7675
50 Ga0105245_11307606 3300009098 Bacteria 774
51 Ga0105241_10018382 3300009174 Bacteria 5142
52 Ga0105241_10559476 3300009174 Bacteria 1028
53 Ga0105242_10057488 3300009176 Bacteria 3186
54 Ga0105238_10084913 3300009551 Bacteria 3155
55 Ga0157373_10091024 3300013100 Bacteria 2148
56 Ga0157371_10000399 3300013102 Bacteria 54380
57 Ga0157372_11524936 3300013307 Bacteria 770
58 Ga0182008_10002256 3300014497 Bacteria 12170
59 Ga0182008_10064164 3300014497 Bacteria 1808
60 Ga0182006_1000010 3300015261 Bacteria 413414
61 Ga0182006_1000055 3300015261 Bacteria 173139
62 Ga0182006_1002330 3300015261 Bacteria 10445
63 Ga0182007_10000030 3300015262 Bacteria 156866
64 Ga0182007_10045067 3300015262 Bacteria 1462
65 Ga0182005_1000003 3300015265 Bacteria 683269
66 Ga0182005_1000009 3300015265 Bacteria 455334
67 Ga0163161_10013299 3300017792 Bacteria 5723
68 Ga0163161_10081316 3300017792 Bacteria 2385
69 Ga0163161_10110000 3300017792 Bacteria 2059
70 Ga0213872_10014596 3300021361 Bacteria 3662
71 Ga0209435_100004 3300025206 Bacteria 633417
72 Ga0209435_101309 3300025206 Bacteria 3249
73 Ga0209147_100011 3300025229 Bacteria 702140
74 Ga0209437_100084 3300025233 Bacteria 255423
75 Ga0209258_100677 3300025242 Bacteria 23853
76 Ga0209646_1000032 3300025246 Bacteria 375315
77 Ga0209646_1000104 3300025246 Bacteria 163824
78 Ga0209646_1000372 3300025246 Bacteria 29735
79 Ga0209026_1000062 3300025250 Bacteria 213298
80 Ga0209026_1001169 3300025250 Bacteria 12187
81 Ga0209026_1010266 3300025250 Bacteria 1759
82 Ga0209148_1000272 3300025254 Bacteria 81330
83 Ga0209759_1000126 3300025256 Bacteria 134208
84 Ga0209759_1001426 3300025256 Bacteria 13562
85 Ga0209565_1000006 3300025263 Bacteria 897294
86 Ga0209455_1001769 3300025272 Bacteria 9154
87 Ga0209673_1000004 3300025273 Bacteria 896155
88 Ga0209130_1000067 3300025284 Bacteria 184277
89 Ga0209675_1000006 3300025291 Bacteria 732267
90 Ga0209564_1000006 3300025295 Bacteria 1100927
91 Ga0209564_1000102 3300025295 Bacteria 222597
92 Ga0209564_1037282 3300025295 Bacteria 1373
93 Ga0209256_1000013 3300025299 Bacteria 689442
94 Ga0209256_1000037 3300025299 Bacteria 377661
95 Ga0207655_1003237 3300025728 Bacteria 12229
96 Ga0207705_10004801 3300025909 Bacteria 10175
97 Ga0207654_10028705 3300025911 Bacteria 3035
98 Ga0207654_10552261 3300025911 Bacteria 818
99 Ga0207695_10010353 3300025913 Bacteria 11414
100 Ga0207695_10045891 3300025913 Bacteria 4634
101 Ga0207657_10014498 3300025919 Bacteria 7690
102 Ga0207657_10325443 3300025919 Bacteria 1215
103 Ga0207649_10056149 3300025920 Bacteria 2457
104 Ga0207649_10759243 3300025920 Bacteria 755
105 Ga0207694_10105313 3300025924 Bacteria 2239
106 Ga0207694_10107858 3300025924 Bacteria 2213
107 Ga0207650_10033202 3300025925 Bacteria 3736
108 Ga0207687_10163670 3300025927 Bacteria 1710
109 Ga0207690_10645057 3300025932 Bacteria 867
110 Ga0207706_10460766 3300025933 Bacteria 1099
111 Ga0207686_10001803 3300025934 Bacteria 11906
112 Ga0207679_10023661 3300025945 Bacteria 4203
113 Ga0207667_10012547 3300025949 Bacteria 9752
114 Ga0207667_10634968 3300025949 Bacteria 1075
115 Ga0207702_10105331 3300026078 Bacteria 2498
116 Ga0207698_10255429 3300026142 Bacteria 1606
117 Ga0209281_1002340 3300027111 Bacteria 7848
118 Ga0209282_1000002 3300027666 Bacteria 1067825
119 Ga0307408_100000180 3300031548 Bacteria 70740
120 Ga0265314_10022091 3300031711 Bacteria 4878
121 Ga0307516_10268595 3300031730 Bacteria 1393
122 Ga0316577_10240330 3300031733 Bacteria 1024
123 Ga0307411_10409993 3300032005 Bacteria 1123
124 Ga0395899_0001205 3300037312 Bacteria 22711
125 Ga0395899_0009464 3300037312 Bacteria 7478
126 Ga0395899_0023657 3300037312 Bacteria 4650
127 Ga0395899_0231230 3300037312 Bacteria 1276
128 Ga0395900_0001494 3300037418 Bacteria 27808
129 Ga0395900_0003169 3300037418 Bacteria 17834
130 Ga0395900_0013160 3300037418 Bacteria 8456
131 Ga0395900_0051861 3300037418 Bacteria 4224
132 Ga0395900_0133567 3300037418 Bacteria 2542
133 Ga0395898_0060198 3300037466 Bacteria 3691
134 Ga0395898_0503857 3300037466 Bacteria 1151
135 Ga0395898_0979958 3300037466 Bacteria 782
136 Ga0395905_0000137 3300037471 Bacteria 120800
137 Ga0395905_0030165 3300037471 Bacteria 5111
138 Ga0395905_0030268 3300037471 Bacteria 5102
139 Ga0395905_0064404 3300037471 Bacteria 3430
140 Ga0395905_0269218 3300037471 Bacteria 1589
141 Ga0395901_0000307 3300038443 Bacteria 60012
142 Ga0395901_0003234 3300038443 Bacteria 16383
143 Ga0395901_0113572 3300038443 Bacteria 2844
144 Ga0395901_0341930 3300038443 Bacteria 1546
145 Ga0395901_0573862 3300038443 Bacteria 1140
146 Ga0436361_0458337 3300039447 Bacteria 9586
147 Ga0436361_0473376 3300039447 Bacteria 896
148 Ga0436361_0557562 3300039447 Bacteria 2186
149 Ga0436361_0679339 3300039447 Bacteria 13827
150 Ga0439465_0125793 3300041413 Bacteria 902
151 Ga0451807_1924016 3300041486 Bacteria 561
152 Ga0451853_1582642 3300041512 Bacteria 1218
153 Ga0439448_0003795 3300042005 Bacteria 4217
154 Ga0439449_0014769 3300042007 Bacteria 2934
155 Ga0439450_001845 3300042008 Bacteria 3202
156 Ga0439455_0005011 3300042012 Bacteria 2665
157 Ga0439462_0192366 3300042015 Bacteria 580
158 Ga0450911_039905 3300042115 Bacteria 610
159 Ga0466972_0000029 3300044658 Bacteria 165236
160 Ga0466972_0191332 3300044658 Bacteria 959
161 Ga0466972_0391260 3300044658 Bacteria 651
162 Ga0466975_0325147 3300044661 Bacteria 977
163 Ga0466965_0015972 3300044683 Bacteria 3567
164 Ga0466965_0036714 3300044683 Bacteria 2404
165 Ga0466965_0039372 3300044683 Bacteria 2323
166 Ga0466965_0039643 3300044683 Bacteria 2316
167 Ga0466966_0005719 3300044684 Bacteria 8185
168 Ga0466961_0046133 3300044693 Bacteria 2787
169 Ga0466963_0180235 3300044694 Bacteria 1475
170 Ga0466964_0007359 3300044706 Bacteria 4115
171 Ga0466964_0012044 3300044706 Bacteria 3271
172 Ga0466971_0000925 3300044719 Bacteria 12051
173 Ga0466968_0012235 3300044735 Bacteria 3353
174 Ga0466968_0050065 3300044735 Bacteria 1781
175 Ga0466968_0055268 3300044735 Bacteria 1703
176 Ga0466968_0105893 3300044735 Bacteria 1260
177 Ga0466957_0004693 3300044842 Bacteria 7645
178 Ga0466957_0016698 3300044842 Bacteria 4294
179 Ga0466957_0540786 3300044842 Bacteria 811
180 Ga0466959_0057149 3300045049 Bacteria 2845
181 Ga0466958_0026209 3300045836 Bacteria 3444
182 Ga0466958_0033934 3300045836 Bacteria 3042
183 Ga0466958_0173371 3300045836 Bacteria 1366
184 Ga0466967_0025444 3300045976 Bacteria 4882
185 Ga0466967_0344147 3300045976 Bacteria 1442
186 Ga0466967_1024508 3300045976 Bacteria 822
187 Ga0495617_000189 3300046452 Bacteria 38970
188 Ga0495617_001998 3300046452 Bacteria 8498
189 Ga0495617_005256 3300046452 Bacteria 4607
190 Ga0495617_016745 3300046452 Bacteria 2479
191 Ga0495627_000065 3300046453 Bacteria 132414
192 Ga0495590_0000023 3300046457 Bacteria 196939
193 Ga0495590_0010408 3300046457 Bacteria 3499
194 Ga0495590_0024388 3300046457 Bacteria 2131
195 Ga0495638_0000067 3300046460 Bacteria 167869
196 Ga0495638_0016796 3300046460 Bacteria 4895
197 Ga0495638_0097989 3300046460 Bacteria 1757
198 Ga0495638_0128569 3300046460 Bacteria 1491
199 Ga0495653_0025786 3300046463 Bacteria 4717
200 Ga0495650_0000056 3300046471 Bacteria 307565
201 Ga0495650_0000263 3300046471 Bacteria 101749
202 Ga0495650_0002963 3300046471 Bacteria 12848
203 Ga0495650_0003947 3300046471 Bacteria 10451
204 Ga0495605_0000276 3300046474 Bacteria 57745
205 Ga0495605_0009182 3300046474 Bacteria 5560
206 Ga0495605_0249701 3300046474 Bacteria 759
207 Ga0495639_0002664 3300046475 Bacteria 7753
208 Ga0495639_0372808 3300046475 Bacteria 719
209 Ga0495584_0001049 3300046491 Bacteria 17218
210 Ga0495584_0005815 3300046491 Bacteria 6499
211 Ga0495584_0021950 3300046491 Bacteria 3241
212 Ga0495584_0054351 3300046491 Bacteria 2015
213 Ga0495584_0176953 3300046491 Bacteria 1084
214 Ga0495584_0278336 3300046491 Bacteria 850
215 Ga0495585_0000231 3300046492 Bacteria 57572
216 Ga0495585_0031084 3300046492 Bacteria 3034
217 Ga0495585_0071330 3300046492 Bacteria 1893
218 Ga0495596_0000167 3300046500 Bacteria 46189
219 Ga0495596_0052524 3300046500 Bacteria 1595
220 Ga0495607_0011135 3300046501 Bacteria 6005
221 Ga0495607_0016529 3300046501 Bacteria 4759
222 Ga0495607_0026695 3300046501 Bacteria 3581
223 Ga0495607_0028071 3300046501 Bacteria 3475
224 Ga0495607_0036845 3300046501 Bacteria 2943
225 Ga0495607_0045340 3300046501 Bacteria 2587
226 Ga0495607_0056481 3300046501 Bacteria 2254
227 Ga0495607_0088920 3300046501 Bacteria 1677
228 Ga0495583_0000004 3300046506 Bacteria 655287
229 Ga0495583_0001039 3300046506 Bacteria 31364
230 Ga0495583_0001894 3300046506 Bacteria 19369
231 Ga0495583_0033981 3300046506 Bacteria 2447
232 Ga0495583_0069729 3300046506 Bacteria 1547
233 Ga0495583_0187153 3300046506 Bacteria 845
234 Ga0495583_0350472 3300046506 Bacteria 582
235 Ga0495606_0003815 3300046507 Bacteria 15649
236 Ga0495606_0004147 3300046507 Bacteria 14690
237 Ga0495606_0005471 3300046507 Bacteria 12158
238 Ga0495606_0006376 3300046507 Bacteria 10904
239 Ga0495606_0006946 3300046507 Bacteria 10294
240 Ga0495606_0225127 3300046507 Bacteria 1054
241 Ga0495610_0003777 3300046512 Bacteria 11568
242 Ga0495610_0005340 3300046512 Bacteria 9169
243 Ga0495610_0015389 3300046512 Bacteria 4447
244 Ga0495610_0023355 3300046512 Bacteria 3365
245 Ga0495616_0001343 3300046513 Bacteria 17155
246 Ga0495616_0008057 3300046513 Bacteria 6275
247 Ga0495616_0013054 3300046513 Bacteria 4697
248 Ga0495616_0022213 3300046513 Bacteria 3427
249 Ga0495616_0067730 3300046513 Bacteria 1734
250 Ga0495616_0067879 3300046513 Bacteria 1732
251 Ga0495631_0011928 3300046518 Bacteria 4260
252 Ga0495631_0107258 3300046518 Bacteria 1201
253 Ga0495632_0017005 3300046519 Bacteria 4028
254 Ga0495632_0056040 3300046519 Bacteria 1928
255 Ga0495637_0003972 3300046520 Bacteria 7734
256 Ga0495637_0073982 3300046520 Bacteria 1369
257 Ga0495643_0001210 3300046522 Bacteria 24993
258 Ga0495643_0004013 3300046522 Bacteria 10513
259 Ga0495643_0004026 3300046522 Bacteria 10484
260 Ga0495643_0021580 3300046522 Bacteria 3692
261 Ga0495643_0025864 3300046522 Bacteria 3318
262 Ga0495643_0132841 3300046522 Bacteria 1248
263 Ga0495643_0352618 3300046522 Bacteria 659
264 Ga0495644_0007529 3300046523 Bacteria 4198
265 Ga0495644_0031876 3300046523 Bacteria 1992
266 Ga0495644_0126036 3300046523 Bacteria 975
267 Ga0495648_0000008 3300046524 Bacteria 336584
268 Ga0495648_0000305 3300046524 Bacteria 54610
269 Ga0495648_0001823 3300046524 Bacteria 20505
270 Ga0495648_0019633 3300046524 Bacteria 4742
271 Ga0495648_0026089 3300046524 Bacteria 3940
272 Ga0495663_0061663 3300046525 Bacteria 1180
273 Ga0495663_0109386 3300046525 Bacteria 917
274 Ga0495642_0001255 3300046528 Bacteria 11589
275 Ga0495642_0001811 3300046528 Bacteria 9165
276 Ga0495642_0031718 3300046528 Bacteria 2119
277 Ga0495642_0114741 3300046528 Bacteria 1153
278 Ga0495654_0010890 3300046530 Bacteria 4941
279 Ga0495654_0027988 3300046530 Bacteria 2885
280 Ga0495598_0042367 3300046537 Bacteria 1336
281 Ga0495609_0005634 3300046538 Bacteria 6531
282 Ga0495609_0006552 3300046538 Bacteria 5931
283 Ga0495609_0006566 3300046538 Bacteria 5924
284 Ga0495609_0026312 3300046538 Bacteria 2665
285 Ga0495609_0032208 3300046538 Bacteria 2382
286 Ga0495597_0002274 3300046542 Bacteria 12481
287 Ga0495597_0002612 3300046542 Bacteria 11210
288 Ga0495597_0015815 3300046542 Bacteria 3570
289 Ga0495597_0043792 3300046542 Bacteria 1992
290 Ga0495597_0048174 3300046542 Bacteria 1885
291 Ga0495597_0070428 3300046542 Bacteria 1507
292 Ga0495645_0636655 3300046543 Bacteria 653
293 Ga0495622_0000959 3300046557 Bacteria 15474
294 Ga0495622_0134743 3300046557 Bacteria 1123
295 Ga0495622_0183198 3300046557 Bacteria 938
296 Ga0495633_0000226 3300046558 Bacteria 69863
297 Ga0495633_0002413 3300046558 Bacteria 13209
298 Ga0495633_0004432 3300046558 Bacteria 8935
299 Ga0495633_0005974 3300046558 Bacteria 7313
300 Ga0495633_0006349 3300046558 Bacteria 7030
301 Ga0495656_0228623 3300046615 Bacteria 933
302 Ga0495656_0443836 3300046615 Bacteria 683
303 Ga0495668_0000008 3300046616 Bacteria 498364
304 Ga0495668_0000347 3300046616 Bacteria 61748
305 Ga0495668_0007806 3300046616 Bacteria 6780
306 Ga0495668_0125038 3300046616 Bacteria 1407
307 Ga0495611_0005101 3300046648 Bacteria 5630
308 Ga0495611_0012290 3300046648 Bacteria 3640
309 Ga0495611_0020794 3300046648 Bacteria 2828
310 Ga0495611_0028585 3300046648 Bacteria 2442
311 Ga0495611_0034284 3300046648 Bacteria 2243
312 Ga0495625_0001253 3300046660 Bacteria 32028
313 Ga0495625_0003583 3300046660 Bacteria 15308
314 Ga0495625_0007426 3300046660 Bacteria 9539
315 Ga0495625_0011500 3300046660 Bacteria 7212
316 Ga0495625_0017353 3300046660 Bacteria 5637
317 Ga0495625_0034572 3300046660 Bacteria 3729
318 Ga0495625_0036805 3300046660 Bacteria 3594
319 Ga0495659_0000738 3300046664 Bacteria 11742
320 Ga0495659_0001117 3300046664 Bacteria 9336
321 Ga0495659_0008182 3300046664 Bacteria 3325
322 Ga0495659_0061991 3300046664 Bacteria 1383
323 Ga0495659_0294514 3300046664 Bacteria 684
324 Ga0495661_0007102 3300046665 Bacteria 7819
325 Ga0495661_0007181 3300046665 Bacteria 7773
326 Ga0495661_0014887 3300046665 Bacteria 5201
327 Ga0495661_0082168 3300046665 Bacteria 1855
328 Ga0495661_0091451 3300046665 Bacteria 1730
329 Ga0495661_0098191 3300046665 Bacteria 1653
330 Ga0495661_0161448 3300046665 Bacteria 1202
331 Ga0495661_0161673 3300046665 Bacteria 1201
332 Ga0495661_0504637 3300046665 Bacteria 576
333 Ga0495588_0000070 3300046674 Bacteria 227611
334 Ga0495588_0080422 3300046674 Bacteria 1701
335 Ga0495623_0016901 3300046679 Bacteria 4712
336 Ga0495669_0002033 3300046684 Bacteria 8292
337 Ga0495669_0022247 3300046684 Bacteria 2753
338 Ga0495670_0002896 3300046691 Bacteria 8452
339 Ga0495670_0007367 3300046691 Bacteria 5408
340 Ga0495670_0032355 3300046691 Bacteria 2601
341 Ga0495670_0036305 3300046691 Bacteria 2455
342 Ga0495670_0082481 3300046691 Bacteria 1639
343 Ga0495670_0316620 3300046691 Bacteria 837
344 Ga0495671_0001726 3300046692 Bacteria 14180
345 Ga0495671_0011653 3300046692 Bacteria 4825
346 Ga0495671_0025444 3300046692 Bacteria 3076
347 Ga0495649_0003538 3300046694 Bacteria 10497
348 Ga0495649_0006786 3300046694 Bacteria 7088
349 Ga0495649_0007681 3300046694 Bacteria 6550
350 Ga0495649_0015847 3300046694 Bacteria 4284
351 Ga0495589_0000175 3300046794 Bacteria 57368
352 Ga0495589_0066121 3300046794 Bacteria 1771
353 Ga0495589_0217962 3300046794 Bacteria 897
354 Ga0495589_0221778 3300046794 Bacteria 888
355 Ga0495660_0000113 3300046810 Bacteria 86593
356 Ga0495660_0001117 3300046810 Bacteria 19163
357 Ga0495660_0002300 3300046810 Bacteria 12251
358 Ga0495660_0003758 3300046810 Bacteria 9312
359 Ga0495660_0021310 3300046810 Bacteria 3712
360 Ga0495660_0096965 3300046810 Bacteria 1523
361 Ga0495636_0000408 3300047318 Bacteria 15998
362 Ga0495636_0048686 3300047318 Bacteria 1771
363 Ga0495636_0111740 3300047318 Bacteria 1203
364 Ga0495636_0316663 3300047318 Bacteria 732
365 Ga0495672_0000035 3300047320 Bacteria 290329
366 Ga0495672_0000708 3300047320 Bacteria 36671
367 Ga0495672_0001524 3300047320 Bacteria 22682
368 Ga0495672_0023241 3300047320 Bacteria 4016
369 Ga0495672_0034391 3300047320 Bacteria 3132
370 Ga0495672_0055040 3300047320 Bacteria 2322
371 Ga0495672_0290457 3300047320 Bacteria 778
372 Ga0495683_0008229 3300047323 Bacteria 5591
373 Ga0495683_0012354 3300047323 Bacteria 4485
374 Ga0495683_0016554 3300047323 Bacteria 3828
375 Ga0495687_000186 3300047443 Bacteria 90747
376 Ga0495687_001662 3300047443 Bacteria 19944
377 Ga0495687_002621 3300047443 Bacteria 14113
378 Ga0495687_003801 3300047443 Bacteria 10651
379 Ga0495687_008618 3300047443 Bacteria 5814
380 Ga0495687_199890 3300047443 Bacteria 635
381 Ga0495675_0114712 3300047444 Bacteria 1680
382 Ga0495677_0002517 3300047445 Bacteria 7174
383 Ga0495677_0030673 3300047445 Bacteria 1956
384 Ga0495679_026461 3300047446 Bacteria 1926
385 Ga0495685_000004 3300047447 Bacteria 115775
386 Ga0495685_071477 3300047447 Bacteria 1161
387 Ga0495673_0000034 3300047469 Bacteria 326920
388 Ga0495681_0002957 3300047470 Bacteria 11975
389 Ga0495681_0003979 3300047470 Bacteria 10171
390 Ga0495681_0029086 3300047470 Bacteria 2833
391 Ga0495681_0119099 3300047470 Bacteria 1135
392 Ga0495686_0000722 3300047472 Bacteria 44277
393 Ga0495686_0001474 3300047472 Bacteria 25598
394 Ga0495686_0007392 3300047472 Bacteria 8242
395 Ga0495686_0042992 3300047472 Bacteria 2868
396 Ga0495686_0074358 3300047472 Bacteria 2085
397 Ga0495686_0124399 3300047472 Bacteria 1534
398 Ga0495626_0001112 3300048091 Bacteria 22702
399 Ga0495626_0387571 3300048091 Bacteria 541
400 Ga0496102_0002399 3300048905 Bacteria 15993
401 Ga0496102_0098615 3300048905 Bacteria 2711
402 Ga0496103_0002408 3300048906 Bacteria 11768
403 Ga0496104_0187061 3300048907 Bacteria 1982
404 Ga0496104_0306061 3300048907 Bacteria 1502
405 Ga0496106_0007599 3300048909 Bacteria 8018
406 Ga0496107_0161297 3300048910 Bacteria 1662
407 Ga0496108_0421892 3300048911 Bacteria 1165
408 Ga0496110_0440482 3300048913 Bacteria 1187
409 Ga0496114_0030524 3300048917 Bacteria 4435
410 Ga0496114_0039752 3300048917 Bacteria 3893
411 Ga0496114_0089957 3300048917 Bacteria 2606
412 Ga0496115_0528917 3300048918 Bacteria 945
413 Ga0496116_0009678 3300048919 Bacteria 8195
414 Ga0496117_0000010 3300048920 Bacteria 611954
415 Ga0496117_0318494 3300048920 Bacteria 816
416 Ga0496118_0000009 3300048921 Bacteria 611954
417 Ga0496118_0130365 3300048921 Bacteria 1616
418 Ga0496121_0006620 3300048924 Bacteria 14278
419 Ga0496121_0010080 3300048924 Bacteria 10722
420 Ga0496121_0021716 3300048924 Bacteria 6273
421 Ga0496121_0022000 3300048924 Bacteria 6211
422 Ga0496121_0066027 3300048924 Bacteria 2940
423 Ga0496122_0001689 3300048925 Bacteria 34233
424 Ga0496122_0003978 3300048925 Bacteria 18853
425 Ga0496122_0014909 3300048925 Bacteria 7481
426 Ga0496123_0000145 3300048926 Bacteria 144475
427 Ga0496123_0004651 3300048926 Bacteria 14248
428 Ga0496123_0103539 3300048926 Bacteria 1648
429 Ga0496124_0076620 3300048927 Bacteria 2760
430 Ga0496125_0028116 3300048928 Bacteria 5084
431 Ga0496125_0034011 3300048928 Bacteria 4499
432 Ga0496125_0044618 3300048928 Bacteria 3745
433 Ga0496125_0108812 3300048928 Bacteria 2014
434 Ga0496125_0156074 3300048928 Bacteria 1559
435 Ga0496125_0186775 3300048928 Bacteria 1373
436 Ga0496126_1003012 3300048929 Bacteria 626
437 Ga0501305_081685 3300049161 Bacteria 582
438 Ga0501305_086496 3300049161 Bacteria 569
439 Ga0495678_000001 3300049459 Bacteria 1060340
440 Ga0495678_002234 3300049459 Bacteria 13498
441 Ga0495678_002857 3300049459 Bacteria 11183
442 Ga0495678_003464 3300049459 Bacteria 9776
443 Ga0495678_007755 3300049459 Bacteria 5528
444 Ga0495678_021044 3300049459 Bacteria 2878
445 Ga0495678_142237 3300049459 Bacteria 784
446 Ga0495678_181419 3300049459 Bacteria 660
447 Ga0495682_0002105 3300049460 Bacteria 9698
448 Ga0495682_0002400 3300049460 Bacteria 8874
449 Ga0495682_0005412 3300049460 Bacteria 5308
450 Ga0495682_0036855 3300049460 Bacteria 1799
451 Ga0495682_0041707 3300049460 Bacteria 1682
452 Ga0495682_0043275 3300049460 Bacteria 1649
453 Ga0495682_0319692 3300049460 Bacteria 547
454 Ga0501249_000460 3300049679 Bacteria 10157
455 Ga0501269_000228 3300049766 Bacteria 16443
456 Ga0501279_015103 3300049775 Bacteria 1067
457 Ga0501035_0024716 3300049822 Bacteria 5507
458 Ga0501044_0302112 3300049823 Bacteria 1529
459 nmdc:mga03683_5244_c1 3300050489 Bacteria 4365
460 nmdc:mga0rr50_507326_c1 3300050513 Bacteria 1026
461 Ga0500594_0001548 3300053118 Bacteria 5010
462 Ga0500586_000320 3300053145 Bacteria 9536
463 Ga0500622_0070718 3300053156 Bacteria 1764
464 Ga0587080_003513 3300059503 Unclassified 1959
465 Ga0587083_0009959 3300059505 Unclassified 1527
466 Ga0587067_000709 3300059640 Bacteria 3166
467 Ga0587075_033488 3300059644 Bacteria 830
468 Ga0587107_034816 3300059652 Bacteria 786
469 Ga0466962_0041068 3300061719 Bacteria 2213

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037312 Ga0395899_0231230 Ga0395899_0231230_615_1172 160
2 3300037418 Ga0395900_0133567 Ga0395900_0133567_1235_1792 160
3 3300037466 Ga0395898_0503857 Ga0395898_0503857_486_1043 160
4 3300037471 Ga0395905_0064404 Ga0395905_0064404_2528_3085 160
5 3300037471 Ga0395905_0269218 Ga0395905_0269218_246_797 160
6 3300038443 Ga0395901_0113572 Ga0395901_0113572_103_654 160
7 3300045836 Ga0466958_0033934 Ga0466958_0033934_2238_2789 160
8 3300045976 Ga0466967_1024508 Ga0466967_1024508_215_772 160
9 3300046491 Ga0495584_0005815 Ga0495584_0005815_5336_5887 160
10 3300046507 Ga0495606_0004147 Ga0495606_0004147_6847_7398 160
11 3300046513 Ga0495616_0013054 Ga0495616_0013054_1012_1563 160
12 3300046528 Ga0495642_0001255 Ga0495642_0001255_7893_8444 160
13 3300046665 Ga0495661_0007181 Ga0495661_0007181_5391_5942 160
14 3300046674 Ga0495588_0000070 Ga0495588_0000070_213349_213900 160
15 3300047443 Ga0495687_001662 Ga0495687_001662_6497_7048 160
16 3300048909 Ga0496106_0007599 Ga0496106_0007599_6435_6986 160
17 3300002987 JGI25159J45721_1005685 JGI25159J45721_10056852 161
18 3300003771 Ga0055526_1000856 Ga0055526_100085610 161
19 3300003773 Ga0055537_1000496 Ga0055537_100049618 161
20 3300003775 Ga0055524_1001883 Ga0055524_10018833 161
21 3300003784 Ga0055534_1000583 Ga0055534_100058312 161
22 3300003790 Ga0055528_1000686 Ga0055528_100068611 161
23 3300004625 Ga0055543_1002543 Ga0055543_10025432 161
24 3300005262 Ga0065165_1000298 Ga0065165_100029873 161
25 3300025263 Ga0209565_1000006 Ga0209565_1000006527 161
26 3300025273 Ga0209673_1000004 Ga0209673_1000004302 161
27 3300025284 Ga0209130_1000067 Ga0209130_1000067129 161
28 3300025291 Ga0209675_1000006 Ga0209675_1000006526 161
29 3300025295 Ga0209564_1000102 Ga0209564_100010211 161
30 3300025299 Ga0209256_1000037 Ga0209256_1000037145 161
31 3300046457 Ga0495590_0024388 Ga0495590_0024388_13_501 161
32 3300046460 Ga0495638_0097989 Ga0495638_0097989_80_568 161
33 3300046491 Ga0495584_0054351 Ga0495584_0054351_1019_1507 161
34 3300046501 Ga0495607_0011135 Ga0495607_0011135_5247_5735 161
35 3300046506 Ga0495583_0350472 Ga0495583_0350472_33_521 161
36 3300046513 Ga0495616_0008057 Ga0495616_0008057_3337_3825 161
37 3300046525 Ga0495663_0109386 Ga0495663_0109386_383_871 161
38 3300046538 Ga0495609_0005634 Ga0495609_0005634_5273_5761 161
39 3300046542 Ga0495597_0043792 Ga0495597_0043792_332_820 161
40 3300046615 Ga0495656_0443836 Ga0495656_0443836_128_616 161
41 3300046616 Ga0495668_0000008 Ga0495668_0000008_213428_213916 161
42 3300046616 Ga0495668_0125038 Ga0495668_0125038_163_651 161
43 3300046660 Ga0495625_0001253 Ga0495625_0001253_2973_3461 161
44 3300046664 Ga0495659_0008182 Ga0495659_0008182_1605_2093 161
45 3300046665 Ga0495661_0007102 Ga0495661_0007102_5202_5690 161
46 3300046684 Ga0495669_0002033 Ga0495669_0002033_4595_5083 161
47 3300046794 Ga0495589_0221778 Ga0495589_0221778_16_504 161
48 3300046810 Ga0495660_0096965 Ga0495660_0096965_747_1235 161
49 3300047318 Ga0495636_0048686 Ga0495636_0048686_1222_1710 161
50 3300047443 Ga0495687_199890 Ga0495687_199890_14_502 161
51 3300047445 Ga0495677_0030673 Ga0495677_0030673_551_1039 161
52 3300047446 Ga0495679_026461 Ga0495679_026461_64_552 161
53 3300047447 Ga0495685_071477 Ga0495685_071477_399_887 161
54 3300047470 Ga0495681_0002957 Ga0495681_0002957_7055_7543 161
55 3300047472 Ga0495686_0007392 Ga0495686_0007392_5377_5865 161
56 3300049459 Ga0495678_181419 Ga0495678_181419_148_636 161
57 iso_pu_bacteria 2919476304 2919479011 161
58 3300003775 Ga0055524_1000027 Ga0055524_100002712 162
59 3300005262 Ga0065165_1042202 Ga0065165_10422022 162
60 3300006948 Ga0099826_10000003 Ga0099826_10000003788 162
61 3300021361 Ga0213872_10014596 Ga0213872_100145962 162
62 3300025295 Ga0209564_1037282 Ga0209564_10372822 162
63 3300025299 Ga0209256_1000013 Ga0209256_1000013402 162
64 3300027666 Ga0209282_1000002 Ga0209282_1000002219 162
65 3300031730 Ga0307516_10268595 Ga0307516_102685952 162
66 3300039447 Ga0436361_0458337 Ga0436361_0458337_5689_6222 162
67 3300039447 Ga0436361_0473376 Ga0436361_0473376_100_591 162
68 3300039447 Ga0436361_0557562 Ga0436361_0557562_1026_1559 162
69 3300039447 Ga0436361_0679339 Ga0436361_0679339_5993_6484 162
70 3300041512 Ga0451853_1582642 Ga0451853_1582642_48_539 162
71 3300042015 Ga0439462_0192366 Ga0439462_0192366_77_565 162
72 3300046474 Ga0495605_0249701 Ga0495605_0249701_177_674 162
73 3300046674 Ga0495588_0080422 Ga0495588_0080422_54_542 162
74 3300047470 Ga0495681_0029086 Ga0495681_0029086_2292_2783 162
75 3300048905 Ga0496102_0002399 Ga0496102_0002399_6890_7387 162
76 iso_pu_bacteria 2643221664 2644359534 162
77 3300031711 Ga0265314_10022091 Ga0265314_100220915 163
78 3300041486 Ga0451807_1924016 Ga0451807_1924016_41_550 163
79 3300046471 Ga0495650_0000056 Ga0495650_0000056_34521_35015 163
80 3300046471 Ga0495650_0000263 Ga0495650_0000263_46148_46642 163
81 3300046471 Ga0495650_0003947 Ga0495650_0003947_56_550 163
82 3300046507 Ga0495606_0005471 Ga0495606_0005471_8906_9400 163
83 3300047318 Ga0495636_0316663 Ga0495636_0316663_74_574 163
84 3300047472 Ga0495686_0000722 Ga0495686_0000722_13167_13661 163
85 iso_pu_bacteria 2600255292 2601670333 163
86 iso_pu_bacteria 2842711865 2842713766 163
87 iso_pu_bacteria 2857547612 2857548331 163
88 iso_pu_bacteria 2857558681 2857562266 163
89 iso_pu_bacteria 2885080285 2885083551 163
90 iso_pu_bacteria 2904424332 2904429811 163
91 iso_pu_bacteria 2904601388 2904601832 163
92 iso_pu_bacteria 2932410948 2932412931 163
93 iso_pu_bacteria 2932416698 2932420446 163
94 3300003322 rootL2_10015446 rootL2_100154462 164
95 3300044683 Ga0466965_0039372 Ga0466965_0039372_281_844 164
96 3300044706 Ga0466964_0007359 Ga0466964_0007359_673_1236 164
97 3300044735 Ga0466968_0012235 Ga0466968_0012235_43_606 164
98 3300044842 Ga0466957_0016698 Ga0466957_0016698_3417_3980 164
99 3300044842 Ga0466957_0540786 Ga0466957_0540786_117_614 164
100 3300046463 Ga0495653_0025786 Ga0495653_0025786_1708_2214 164
101 3300046474 Ga0495605_0000276 Ga0495605_0000276_33330_33827 164
102 3300046501 Ga0495607_0016529 Ga0495607_0016529_3595_4092 164
103 3300046501 Ga0495607_0045340 Ga0495607_0045340_26_523 164
104 3300046507 Ga0495606_0225127 Ga0495606_0225127_127_624 164
105 3300046519 Ga0495632_0056040 Ga0495632_0056040_1415_1912 164
106 3300046522 Ga0495643_0004013 Ga0495643_0004013_7801_8298 164
107 3300046522 Ga0495643_0021580 Ga0495643_0021580_2297_2794 164
108 3300046524 Ga0495648_0001823 Ga0495648_0001823_6858_7355 164
109 3300046530 Ga0495654_0027988 Ga0495654_0027988_614_1111 164
110 3300046538 Ga0495609_0026312 Ga0495609_0026312_881_1378 164
111 3300046542 Ga0495597_0015815 Ga0495597_0015815_2615_3112 164
112 3300046543 Ga0495645_0636655 Ga0495645_0636655_80_583 164
113 3300046660 Ga0495625_0036805 Ga0495625_0036805_2492_2989 164
114 3300046664 Ga0495659_0001117 Ga0495659_0001117_6075_6572 164
115 3300046665 Ga0495661_0161448 Ga0495661_0161448_644_1150 164
116 3300046665 Ga0495661_0161673 Ga0495661_0161673_652_1149 164
117 3300046692 Ga0495671_0001726 Ga0495671_0001726_6423_6920 164
118 3300046694 Ga0495649_0006786 Ga0495649_0006786_3001_3498 164
119 3300046794 Ga0495589_0000175 Ga0495589_0000175_55966_56463 164
120 3300046794 Ga0495589_0217962 Ga0495589_0217962_298_795 164
121 3300046810 Ga0495660_0000113 Ga0495660_0000113_59022_59519 164
122 3300046810 Ga0495660_0001117 Ga0495660_0001117_7778_8275 164
123 3300047320 Ga0495672_0000035 Ga0495672_0000035_175918_176415 164
124 3300047320 Ga0495672_0001524 Ga0495672_0001524_9016_9513 164
125 3300047323 Ga0495683_0016554 Ga0495683_0016554_2437_2934 164
126 3300047443 Ga0495687_002621 Ga0495687_002621_7709_8206 164
127 3300047444 Ga0495675_0114712 Ga0495675_0114712_264_767 164
128 3300047445 Ga0495677_0002517 Ga0495677_0002517_3168_3665 164
129 3300047472 Ga0495686_0124399 Ga0495686_0124399_849_1346 164
130 3300048091 Ga0495626_0001112 Ga0495626_0001112_7648_8145 164
131 3300048925 Ga0496122_0014909 Ga0496122_0014909_4460_4957 164
132 3300048926 Ga0496123_0004651 Ga0496123_0004651_5523_6020 164
133 3300048928 Ga0496125_0156074 Ga0496125_0156074_29_526 164
134 3300049459 Ga0495678_021044 Ga0495678_021044_1143_1640 164
135 3300049460 Ga0495682_0319692 Ga0495682_0319692_22_519 164
136 3300003762 Ga0055542_1005705 Ga0055542_10057053 165
137 3300005327 Ga0070658_10720144 Ga0070658_107201442 165
138 3300005329 Ga0070683_101031234 Ga0070683_1010312341 165
139 3300005339 Ga0070660_100035030 Ga0070660_1000350301 165
140 3300005339 Ga0070660_100733062 Ga0070660_1007330621 165
141 3300005339 Ga0070660_100812846 Ga0070660_1008128461 165
142 3300005344 Ga0070661_100011877 Ga0070661_1000118772 165
143 3300005366 Ga0070659_100021256 Ga0070659_1000212562 165
144 3300005457 Ga0070662_100172477 Ga0070662_1001724771 165
145 3300005457 Ga0070662_100797626 Ga0070662_1007976261 165
146 3300005564 Ga0070664_100019392 Ga0070664_1000193926 165
147 3300005564 Ga0070664_100031999 Ga0070664_1000319994 165
148 3300005578 Ga0068854_100832314 Ga0068854_1008323141 165
149 3300005616 Ga0068852_100403907 Ga0068852_1004039071 165
150 3300006946 Ga0079104_1012368 Ga0079104_10123682 165
151 3300009036 Ga0105244_10030050 Ga0105244_100300503 165
152 3300009098 Ga0105245_11307606 Ga0105245_113076062 165
153 3300009174 Ga0105241_10018382 Ga0105241_100183827 165
154 3300009174 Ga0105241_10559476 Ga0105241_105594762 165
155 3300009176 Ga0105242_10057488 Ga0105242_100574881 165
156 3300009551 Ga0105238_10084913 Ga0105238_100849133 165
157 3300013102 Ga0157371_10000399 Ga0157371_1000039925 165
158 3300013307 Ga0157372_11524936 Ga0157372_115249361 165
159 3300014497 Ga0182008_10064164 Ga0182008_100641643 165
160 3300015261 Ga0182006_1000055 Ga0182006_100005527 165
161 3300015262 Ga0182007_10045067 Ga0182007_100450672 165
162 3300015265 Ga0182005_1000003 Ga0182005_1000003236 165
163 3300025254 Ga0209148_1000272 Ga0209148_100027241 165
164 3300025909 Ga0207705_10004801 Ga0207705_100048012 165
165 3300025911 Ga0207654_10028705 Ga0207654_100287053 165
166 3300025911 Ga0207654_10552261 Ga0207654_105522612 165
167 3300025919 Ga0207657_10014498 Ga0207657_1001449810 165
168 3300025919 Ga0207657_10325443 Ga0207657_103254431 165
169 3300025920 Ga0207649_10056149 Ga0207649_100561492 165
170 3300025924 Ga0207694_10107858 Ga0207694_101078582 165
171 3300025927 Ga0207687_10163670 Ga0207687_101636701 165
172 3300025932 Ga0207690_10645057 Ga0207690_106450571 165
173 3300025933 Ga0207706_10460766 Ga0207706_104607661 165
174 3300025934 Ga0207686_10001803 Ga0207686_100018036 165
175 3300025945 Ga0207679_10023661 Ga0207679_100236614 165
176 3300027111 Ga0209281_1002340 Ga0209281_10023404 165
177 3300031548 Ga0307408_100000180 Ga0307408_10000018060 165
178 3300031733 Ga0316577_10240330 Ga0316577_102403302 165
179 3300037312 Ga0395899_0009464 Ga0395899_0009464_4276_4842 165
180 3300037312 Ga0395899_0023657 Ga0395899_0023657_3104_3670 165
181 3300037418 Ga0395900_0001494 Ga0395900_0001494_7898_8470 165
182 3300037418 Ga0395900_0003169 Ga0395900_0003169_3226_3792 165
183 3300037418 Ga0395900_0051861 Ga0395900_0051861_3305_3871 165
184 3300037466 Ga0395898_0060198 Ga0395898_0060198_353_853 165
185 3300037466 Ga0395898_0979958 Ga0395898_0979958_70_576 165
186 3300037471 Ga0395905_0030165 Ga0395905_0030165_4210_4707 165
187 3300038443 Ga0395901_0000307 Ga0395901_0000307_52502_53008 165
188 3300038443 Ga0395901_0003234 Ga0395901_0003234_13734_14300 165
189 3300038443 Ga0395901_0573862 Ga0395901_0573862_341_841 165
190 3300041413 Ga0439465_0125793 Ga0439465_0125793_13_519 165
191 3300042005 Ga0439448_0003795 Ga0439448_0003795_2320_2886 165
192 3300042007 Ga0439449_0014769 Ga0439449_0014769_1762_2328 165
193 3300042008 Ga0439450_001845 Ga0439450_001845_1705_2271 165
194 3300042012 Ga0439455_0005011 Ga0439455_0005011_1557_2123 165
195 3300042115 Ga0450911_039905 Ga0450911_039905_55_561 165
196 3300044683 Ga0466965_0036714 Ga0466965_0036714_1793_2296 165
197 3300044694 Ga0466963_0180235 Ga0466963_0180235_892_1392 165
198 3300044735 Ga0466968_0050065 Ga0466968_0050065_654_1157 165
199 3300045836 Ga0466958_0026209 Ga0466958_0026209_2035_2607 165
200 3300046457 Ga0495590_0000023 Ga0495590_0000023_121390_121890 165
201 3300046460 Ga0495638_0000067 Ga0495638_0000067_157405_157923 165
202 3300046471 Ga0495650_0002963 Ga0495650_0002963_4970_5488 165
203 3300046475 Ga0495639_0002664 Ga0495639_0002664_4237_4737 165
204 3300046506 Ga0495583_0001039 Ga0495583_0001039_7649_8152 165
205 3300046506 Ga0495583_0001894 Ga0495583_0001894_8811_9329 165
206 3300046507 Ga0495606_0003815 Ga0495606_0003815_7752_8252 165
207 3300046522 Ga0495643_0004026 Ga0495643_0004026_2235_2735 165
208 3300046522 Ga0495643_0132841 Ga0495643_0132841_126_629 165
209 3300046522 Ga0495643_0352618 Ga0495643_0352618_39_539 165
210 3300046524 Ga0495648_0000008 Ga0495648_0000008_76853_77371 165
211 3300046528 Ga0495642_0001811 Ga0495642_0001811_4507_5007 165
212 3300046538 Ga0495609_0032208 Ga0495609_0032208_1846_2346 165
213 3300046542 Ga0495597_0002274 Ga0495597_0002274_3130_3630 165
214 3300046557 Ga0495622_0000959 Ga0495622_0000959_8836_9336 165
215 3300046558 Ga0495633_0002413 Ga0495633_0002413_8935_9435 165
216 3300046616 Ga0495668_0000347 Ga0495668_0000347_59912_60412 165
217 3300046660 Ga0495625_0003583 Ga0495625_0003583_9337_9855 165
218 3300046664 Ga0495659_0294514 Ga0495659_0294514_61_573 165
219 3300046691 Ga0495670_0082481 Ga0495670_0082481_175_693 165
220 3300046694 Ga0495649_0007681 Ga0495649_0007681_215_718 165
221 3300046810 Ga0495660_0021310 Ga0495660_0021310_286_786 165
222 3300047318 Ga0495636_0111740 Ga0495636_0111740_59_565 165
223 3300047443 Ga0495687_003801 Ga0495687_003801_6318_6818 165
224 3300047443 Ga0495687_008618 Ga0495687_008618_1453_1953 165
225 3300048907 Ga0496104_0187061 Ga0496104_0187061_1041_1547 165
226 3300048918 Ga0496115_0528917 Ga0496115_0528917_420_920 165
227 3300048928 Ga0496125_0108812 Ga0496125_0108812_17_523 165
228 3300049459 Ga0495678_007755 Ga0495678_007755_4641_5141 165
229 3300049775 Ga0501279_015103 Ga0501279_015103_337_840 165
230 3300049822 Ga0501035_0024716 Ga0501035_0024716_1348_1848 165
231 3300049823 Ga0501044_0302112 Ga0501044_0302112_247_753 165
232 iso_pu_bacteria 2857553236 2857554900 165
233 3300002738 JGI25154J39366_1000269 JGI25154J39366_100026915 166
234 3300003771 Ga0055526_1001774 Ga0055526_100177410 166
235 3300005331 Ga0070670_101410085 Ga0070670_1014100851 166
236 3300017792 Ga0163161_10013299 Ga0163161_100132993 166
237 3300025246 Ga0209646_1000104 Ga0209646_100010424 166
238 3300025250 Ga0209026_1010266 Ga0209026_10102663 166
239 3300025295 Ga0209564_1000006 Ga0209564_1000006727 166
240 3300032005 Ga0307411_10409993 Ga0307411_104099932 166
241 3300046475 Ga0495639_0372808 Ga0495639_0372808_70_573 166
242 3300046518 Ga0495631_0011928 Ga0495631_0011928_3220_3723 166
243 3300046537 Ga0495598_0042367 Ga0495598_0042367_453_959 166
244 3300046648 Ga0495611_0012290 Ga0495611_0012290_2700_3209 166
245 3300047320 Ga0495672_0055040 Ga0495672_0055040_1725_2228 166
246 3300048907 Ga0496104_0306061 Ga0496104_0306061_884_1390 166
247 3300048910 Ga0496107_0161297 Ga0496107_0161297_528_1034 166
248 3300048911 Ga0496108_0421892 Ga0496108_0421892_142_648 166
249 3300048913 Ga0496110_0440482 Ga0496110_0440482_22_528 166
250 3300048917 Ga0496114_0039752 Ga0496114_0039752_192_698 166
251 3300005288 Ga0065714_10270173 Ga0065714_102701731 167
252 3300005614 Ga0068856_100594160 Ga0068856_1005941602 167
253 3300009036 Ga0105244_10003849 Ga0105244_100038491 167
254 3300014497 Ga0182008_10002256 Ga0182008_1000225615 167
255 3300015261 Ga0182006_1000010 Ga0182006_1000010143 167
256 3300015261 Ga0182006_1002330 Ga0182006_100233011 167
257 3300015262 Ga0182007_10000030 Ga0182007_10000030149 167
258 3300015265 Ga0182005_1000009 Ga0182005_1000009241 167
259 3300017792 Ga0163161_10081316 Ga0163161_100813163 167
260 3300017792 Ga0163161_10110000 Ga0163161_101100003 167
261 3300025728 Ga0207655_1003237 Ga0207655_10032376 167
262 3300044661 Ga0466975_0325147 Ga0466975_0325147_47_550 167
263 3300044683 Ga0466965_0015972 Ga0466965_0015972_622_1125 167
264 3300044684 Ga0466966_0005719 Ga0466966_0005719_1123_1626 167
265 3300044693 Ga0466961_0046133 Ga0466961_0046133_1894_2397 167
266 3300044706 Ga0466964_0012044 Ga0466964_0012044_1350_1853 167
267 3300044719 Ga0466971_0000925 Ga0466971_0000925_9662_10165 167
268 3300044842 Ga0466957_0004693 Ga0466957_0004693_4787_5290 167
269 3300045049 Ga0466959_0057149 Ga0466959_0057149_2083_2589 167
270 3300045836 Ga0466958_0173371 Ga0466958_0173371_622_1125 167
271 3300045976 Ga0466967_0344147 Ga0466967_0344147_423_926 167
272 3300046452 Ga0495617_000189 Ga0495617_000189_27796_28302 167
273 3300046452 Ga0495617_001998 Ga0495617_001998_6647_7153 167
274 3300046452 Ga0495617_005256 Ga0495617_005256_1458_1967 167
275 3300046452 Ga0495617_016745 Ga0495617_016745_1631_2140 167
276 3300046457 Ga0495590_0010408 Ga0495590_0010408_1386_1895 167
277 3300046460 Ga0495638_0016796 Ga0495638_0016796_2671_3180 167
278 3300046460 Ga0495638_0128569 Ga0495638_0128569_760_1266 167
279 3300046474 Ga0495605_0009182 Ga0495605_0009182_2853_3362 167
280 3300046491 Ga0495584_0001049 Ga0495584_0001049_8577_9086 167
281 3300046491 Ga0495584_0021950 Ga0495584_0021950_2234_2743 167
282 3300046491 Ga0495584_0176953 Ga0495584_0176953_530_1042 167
283 3300046491 Ga0495584_0278336 Ga0495584_0278336_255_761 167
284 3300046492 Ga0495585_0000231 Ga0495585_0000231_10666_11172 167
285 3300046492 Ga0495585_0031084 Ga0495585_0031084_2071_2580 167
286 3300046492 Ga0495585_0071330 Ga0495585_0071330_1142_1651 167
287 3300046500 Ga0495596_0000167 Ga0495596_0000167_18194_18700 167
288 3300046500 Ga0495596_0052524 Ga0495596_0052524_530_1036 167
289 3300046501 Ga0495607_0026695 Ga0495607_0026695_2772_3281 167
290 3300046501 Ga0495607_0028071 Ga0495607_0028071_225_731 167
291 3300046501 Ga0495607_0036845 Ga0495607_0036845_2207_2716 167
292 3300046501 Ga0495607_0056481 Ga0495607_0056481_550_1062 167
293 3300046501 Ga0495607_0088920 Ga0495607_0088920_995_1504 167
294 3300046506 Ga0495583_0000004 Ga0495583_0000004_343678_344187 167
295 3300046506 Ga0495583_0033981 Ga0495583_0033981_455_964 167
296 3300046506 Ga0495583_0069729 Ga0495583_0069729_988_1494 167
297 3300046506 Ga0495583_0187153 Ga0495583_0187153_38_550 167
298 3300046507 Ga0495606_0006376 Ga0495606_0006376_4492_4998 167
299 3300046507 Ga0495606_0006946 Ga0495606_0006946_7383_7889 167
300 3300046512 Ga0495610_0003777 Ga0495610_0003777_3768_4346 167
301 3300046512 Ga0495610_0005340 Ga0495610_0005340_6966_7490 167
302 3300046512 Ga0495610_0015389 Ga0495610_0015389_1428_2006 167
303 3300046512 Ga0495610_0023355 Ga0495610_0023355_2567_3073 167
304 3300046513 Ga0495616_0001343 Ga0495616_0001343_9794_10300 167
305 3300046513 Ga0495616_0022213 Ga0495616_0022213_2352_2861 167
306 3300046513 Ga0495616_0067730 Ga0495616_0067730_239_751 167
307 3300046513 Ga0495616_0067879 Ga0495616_0067879_626_1135 167
308 3300046518 Ga0495631_0107258 Ga0495631_0107258_159_671 167
309 3300046519 Ga0495632_0017005 Ga0495632_0017005_2878_3390 167
310 3300046520 Ga0495637_0003972 Ga0495637_0003972_1112_1618 167
311 3300046520 Ga0495637_0073982 Ga0495637_0073982_151_657 167
312 3300046522 Ga0495643_0001210 Ga0495643_0001210_7693_8271 167
313 3300046523 Ga0495644_0031876 Ga0495644_0031876_978_1484 167
314 3300046523 Ga0495644_0126036 Ga0495644_0126036_62_574 167
315 3300046524 Ga0495648_0000305 Ga0495648_0000305_43505_44011 167
316 3300046524 Ga0495648_0019633 Ga0495648_0019633_468_977 167
317 3300046524 Ga0495648_0026089 Ga0495648_0026089_1890_2468 167
318 3300046525 Ga0495663_0061663 Ga0495663_0061663_131_640 167
319 3300046528 Ga0495642_0031718 Ga0495642_0031718_1201_1713 167
320 3300046528 Ga0495642_0114741 Ga0495642_0114741_50_556 167
321 3300046530 Ga0495654_0010890 Ga0495654_0010890_1366_1944 167
322 3300046538 Ga0495609_0006552 Ga0495609_0006552_54_563 167
323 3300046538 Ga0495609_0006566 Ga0495609_0006566_2564_3073 167
324 3300046542 Ga0495597_0002612 Ga0495597_0002612_1892_2470 167
325 3300046542 Ga0495597_0048174 Ga0495597_0048174_790_1302 167
326 3300046542 Ga0495597_0070428 Ga0495597_0070428_182_694 167
327 3300046557 Ga0495622_0134743 Ga0495622_0134743_576_1082 167
328 3300046557 Ga0495622_0183198 Ga0495622_0183198_313_819 167
329 3300046558 Ga0495633_0000226 Ga0495633_0000226_8209_8715 167
330 3300046558 Ga0495633_0004432 Ga0495633_0004432_981_1559 167
331 3300046558 Ga0495633_0005974 Ga0495633_0005974_3136_3645 167
332 3300046558 Ga0495633_0006349 Ga0495633_0006349_3537_4046 167
333 3300046616 Ga0495668_0007806 Ga0495668_0007806_5739_6251 167
334 3300046648 Ga0495611_0005101 Ga0495611_0005101_674_1183 167
335 3300046648 Ga0495611_0020794 Ga0495611_0020794_768_1280 167
336 3300046648 Ga0495611_0028585 Ga0495611_0028585_458_967 167
337 3300046648 Ga0495611_0034284 Ga0495611_0034284_314_823 167
338 3300046660 Ga0495625_0011500 Ga0495625_0011500_4144_4650 167
339 3300046660 Ga0495625_0017353 Ga0495625_0017353_591_1100 167
340 3300046660 Ga0495625_0034572 Ga0495625_0034572_219_728 167
341 3300046664 Ga0495659_0000738 Ga0495659_0000738_2846_3355 167
342 3300046664 Ga0495659_0061991 Ga0495659_0061991_660_1166 167
343 3300046665 Ga0495661_0014887 Ga0495661_0014887_1209_1715 167
344 3300046665 Ga0495661_0082168 Ga0495661_0082168_1305_1814 167
345 3300046665 Ga0495661_0091451 Ga0495661_0091451_91_600 167
346 3300046665 Ga0495661_0098191 Ga0495661_0098191_927_1439 167
347 3300046665 Ga0495661_0504637 Ga0495661_0504637_18_527 167
348 3300046684 Ga0495669_0022247 Ga0495669_0022247_2033_2539 167
349 3300046691 Ga0495670_0002896 Ga0495670_0002896_3084_3593 167
350 3300046691 Ga0495670_0007367 Ga0495670_0007367_1881_2387 167
351 3300046691 Ga0495670_0032355 Ga0495670_0032355_16_525 167
352 3300046691 Ga0495670_0036305 Ga0495670_0036305_968_1477 167
353 3300046691 Ga0495670_0316620 Ga0495670_0316620_294_800 167
354 3300046692 Ga0495671_0011653 Ga0495671_0011653_673_1182 167
355 3300046692 Ga0495671_0025444 Ga0495671_0025444_303_812 167
356 3300046694 Ga0495649_0003538 Ga0495649_0003538_6923_7501 167
357 3300046694 Ga0495649_0015847 Ga0495649_0015847_3461_3967 167
358 3300046794 Ga0495589_0066121 Ga0495589_0066121_264_776 167
359 3300047318 Ga0495636_0000408 Ga0495636_0000408_8755_9264 167
360 3300047320 Ga0495672_0000708 Ga0495672_0000708_8551_9129 167
361 3300047320 Ga0495672_0023241 Ga0495672_0023241_722_1231 167
362 3300047320 Ga0495672_0034391 Ga0495672_0034391_225_731 167
363 3300047323 Ga0495683_0008229 Ga0495683_0008229_673_1182 167
364 3300047323 Ga0495683_0012354 Ga0495683_0012354_958_1464 167
365 3300047443 Ga0495687_000186 Ga0495687_000186_59531_60040 167
366 3300047447 Ga0495685_000004 Ga0495685_000004_32623_33132 167
367 3300047469 Ga0495673_0000034 Ga0495673_0000034_32380_32886 167
368 3300047470 Ga0495681_0119099 Ga0495681_0119099_110_616 167
369 3300048091 Ga0495626_0387571 Ga0495626_0387571_17_529 167
370 3300048905 Ga0496102_0098615 Ga0496102_0098615_336_845 167
371 3300048906 Ga0496103_0002408 Ga0496103_0002408_5249_5755 167
372 3300048919 Ga0496116_0009678 Ga0496116_0009678_6966_7472 167
373 3300048920 Ga0496117_0000010 Ga0496117_0000010_339971_340477 167
374 3300048921 Ga0496118_0000009 Ga0496118_0000009_271478_271984 167
375 3300048924 Ga0496121_0006620 Ga0496121_0006620_2767_3273 167
376 3300048924 Ga0496121_0010080 Ga0496121_0010080_5665_6171 167
377 3300048924 Ga0496121_0021716 Ga0496121_0021716_4437_4943 167
378 3300048925 Ga0496122_0003978 Ga0496122_0003978_8588_9094 167
379 3300048926 Ga0496123_0103539 Ga0496123_0103539_453_959 167
380 3300048927 Ga0496124_0076620 Ga0496124_0076620_1094_1600 167
381 3300048928 Ga0496125_0028116 Ga0496125_0028116_3693_4199 167
382 3300048928 Ga0496125_0186775 Ga0496125_0186775_692_1198 167
383 3300049459 Ga0495678_002234 Ga0495678_002234_7556_8134 167
384 3300049459 Ga0495678_002857 Ga0495678_002857_6498_7004 167
385 3300049459 Ga0495678_003464 Ga0495678_003464_2667_3176 167
386 3300049460 Ga0495682_0002105 Ga0495682_0002105_6925_7434 167
387 3300049460 Ga0495682_0002400 Ga0495682_0002400_6929_7438 167
388 3300049460 Ga0495682_0005412 Ga0495682_0005412_2696_3274 167
389 3300049460 Ga0495682_0036855 Ga0495682_0036855_1036_1545 167
390 3300049460 Ga0495682_0041707 Ga0495682_0041707_15_521 167
391 3300049460 Ga0495682_0043275 Ga0495682_0043275_524_1036 167
392 3300049679 Ga0501249_000460 Ga0501249_000460_73_579 167
393 3300049766 Ga0501269_000228 Ga0501269_000228_6129_6635 167
394 3300050489 nmdc:mga03683_5244_c1 nmdc:mga03683_5244_c1_924_1430 167
395 3300053118 Ga0500594_0001548 Ga0500594_0001548_3471_3977 167
396 3300053145 Ga0500586_000320 Ga0500586_000320_5660_6238 167
397 3300061719 Ga0466962_0041068 Ga0466962_0041068_1140_1643 167
398 iso_pu_bacteria 2511231003 2511249138 167
399 iso_pu_bacteria 2548876994 2550692440 167
400 iso_pu_bacteria 2818991445 2819592583 167
401 iso_pu_bacteria 2884811622 2884811967 167
402 iso_pu_bacteria 2884836552 2884838928 167
403 iso_pu_bacteria 2884852848 2884855220 167
404 iso_pu_bacteria 2896154374 2896156111 167
405 3300046453 Ga0495627_000065 Ga0495627_000065_51563_52150 168
406 3300046522 Ga0495643_0025864 Ga0495643_0025864_12_524 168
407 3300046523 Ga0495644_0007529 Ga0495644_0007529_367_954 168
408 3300046810 Ga0495660_0002300 Ga0495660_0002300_7397_7984 168
409 3300046810 Ga0495660_0003758 Ga0495660_0003758_4305_4892 168
410 3300047470 Ga0495681_0003979 Ga0495681_0003979_569_1156 168
411 3300047472 Ga0495686_0074358 Ga0495686_0074358_1284_1892 168
412 3300048917 Ga0496114_0030524 Ga0496114_0030524_2185_2712 168
413 3300048928 Ga0496125_0034011 Ga0496125_0034011_1855_2382 168
414 3300049459 Ga0495678_000001 Ga0495678_000001_911031_911543 168
415 3300049459 Ga0495678_142237 Ga0495678_142237_178_696 168
416 3300005616 Ga0068852_100029429 Ga0068852_1000294293 169
417 3300025920 Ga0207649_10759243 Ga0207649_107592432 169
418 3300037471 Ga0395905_0000137 Ga0395905_0000137_65160_65684 169
419 3300044658 Ga0466972_0191332 Ga0466972_0191332_384_917 169
420 3300046679 Ga0495623_0016901 Ga0495623_0016901_324_836 169
421 3300047472 Ga0495686_0001474 Ga0495686_0001474_8966_9505 169
422 3300049161 Ga0501305_081685 Ga0501305_081685_24_533 169
423 3300049161 Ga0501305_086496 Ga0501305_086496_15_524 169
424 3300059503 Ga0587080_003513 Ga0587080_003513_1168_1740 169
425 3300059505 Ga0587083_0009959 Ga0587083_0009959_795_1367 169
426 3300059640 Ga0587067_000709 Ga0587067_000709_2345_2917 169
427 3300059644 Ga0587075_033488 Ga0587075_033488_225_797 169
428 3300059652 Ga0587107_034816 Ga0587107_034816_146_718 169
429 3300046615 Ga0495656_0228623 Ga0495656_0228623_184_714 170
430 3300047472 Ga0495686_0042992 Ga0495686_0042992_931_1503 170
431 3300048917 Ga0496114_0089957 Ga0496114_0089957_749_1261 170
432 3300002704 JGI25155J39150_1000142 JGI25155J39150_100014241 171
433 3300002704 JGI25155J39150_1000395 JGI25155J39150_100039511 171
434 3300002705 JGI25156J39149_1001097 JGI25156J39149_10010975 171
435 3300002705 JGI25156J39149_1003611 JGI25156J39149_10036114 171
436 3300002737 JGI25162J39368_1004783 JGI25162J39368_10047832 171
437 3300002738 JGI25154J39366_1000916 JGI25154J39366_10009164 171
438 3300002738 JGI25154J39366_1000927 JGI25154J39366_100092711 171
439 3300002741 JGI25157J39369_1000203 JGI25157J39369_10002035 171
440 3300003758 Ga0055532_1000005 Ga0055532_1000005118 171
441 3300005614 Ga0068856_100051505 Ga0068856_1000515052 171
442 3300005616 Ga0068852_100152219 Ga0068852_1001522192 171
443 3300009011 Ga0105251_10136420 Ga0105251_101364201 171
444 3300009093 Ga0105240_10014863 Ga0105240_1001486310 171
445 3300009093 Ga0105240_10026065 Ga0105240_100260657 171
446 3300013100 Ga0157373_10091024 Ga0157373_100910243 171
447 3300025206 Ga0209435_100004 Ga0209435_100004216 171
448 3300025206 Ga0209435_101309 Ga0209435_1013095 171
449 3300025229 Ga0209147_100011 Ga0209147_100011314 171
450 3300025233 Ga0209437_100084 Ga0209437_100084157 171
451 3300025242 Ga0209258_100677 Ga0209258_1006774 171
452 3300025246 Ga0209646_1000032 Ga0209646_1000032146 171
453 3300025246 Ga0209646_1000372 Ga0209646_100037212 171
454 3300025250 Ga0209026_1000062 Ga0209026_10000625 171
455 3300025250 Ga0209026_1001169 Ga0209026_10011695 171
456 3300025256 Ga0209759_1000126 Ga0209759_100012612 171
457 3300025256 Ga0209759_1001426 Ga0209759_100142612 171
458 3300025272 Ga0209455_1001769 Ga0209455_10017692 171
459 3300025913 Ga0207695_10010353 Ga0207695_100103535 171
460 3300025913 Ga0207695_10045891 Ga0207695_100458913 171
461 3300025924 Ga0207694_10105313 Ga0207694_101053133 171
462 3300025925 Ga0207650_10033202 Ga0207650_100332022 171
463 3300025949 Ga0207667_10012547 Ga0207667_100125479 171
464 3300025949 Ga0207667_10634968 Ga0207667_106349681 171
465 3300026078 Ga0207702_10105331 Ga0207702_101053313 171
466 3300026142 Ga0207698_10255429 Ga0207698_102554293 171
467 3300037312 Ga0395899_0001205 Ga0395899_0001205_4196_4717 171
468 3300037418 Ga0395900_0013160 Ga0395900_0013160_4915_5436 171
469 3300037471 Ga0395905_0030268 Ga0395905_0030268_311_835 171
470 3300038443 Ga0395901_0341930 Ga0395901_0341930_840_1361 171
471 3300044658 Ga0466972_0000029 Ga0466972_0000029_12637_13155 171
472 3300044658 Ga0466972_0391260 Ga0466972_0391260_48_566 171
473 3300044683 Ga0466965_0039643 Ga0466965_0039643_396_914 171
474 3300044735 Ga0466968_0055268 Ga0466968_0055268_165_683 171
475 3300044735 Ga0466968_0105893 Ga0466968_0105893_541_1059 171
476 3300045976 Ga0466967_0025444 Ga0466967_0025444_4111_4629 171
477 3300046660 Ga0495625_0007426 Ga0495625_0007426_6917_7498 171
478 3300047320 Ga0495672_0290457 Ga0495672_0290457_95_619 171
479 3300048920 Ga0496117_0318494 Ga0496117_0318494_206_799 171
480 3300048921 Ga0496118_0130365 Ga0496118_0130365_882_1475 171
481 3300048924 Ga0496121_0022000 Ga0496121_0022000_2117_2644 171
482 3300048924 Ga0496121_0066027 Ga0496121_0066027_1275_1868 171
483 3300048925 Ga0496122_0001689 Ga0496122_0001689_8408_8923 171
484 3300048926 Ga0496123_0000145 Ga0496123_0000145_88489_89004 171
485 3300048928 Ga0496125_0044618 Ga0496125_0044618_1318_1911 171
486 3300048929 Ga0496126_1003012 Ga0496126_1003012_73_588 171
487 3300050513 nmdc:mga0rr50_507326_c1 nmdc:mga0rr50_507326_c1_234_764 171
488 3300053156 Ga0500622_0070718 Ga0500622_0070718_578_1114 171

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01967

MoaC

MoaC family

58

193

1

Structural Annotation

Top 5 Hits

ID Description Score Start End
4fdf-assembly1.cif.gz_A structural insights into putative molybdenum cofactor biosynthesis protein c (moac2) from mycobacterium tuberculosis h37rv 0.977 24 160
4fdf-assembly1.cif.gz_B structural insights into putative molybdenum cofactor biosynthesis protein c (moac2) from mycobacterium tuberculosis h37rv 0.9715 25 170
4pyd-assembly1.cif.gz_E moac in complex with cpmp crystallized in space group p212121 0.971 24 161
1ekr-assembly1.cif.gz_A moac protein from e. coli 0.969 24 170
3jqk-assembly1.cif.gz_A crystal structure of the molybdenum cofactor biosynthesis protein c (ttha1789) from thermus theromophilus hb8 (h32 form) 0.9686 25 170
ID Description Score Start End Superfamily
4fdfA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Molybdopterin cofactor biosynthesis C (MoaC) domain 0.977 24 160 3.30.70.640
1ekrA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Molybdopterin cofactor biosynthesis C (MoaC) domain 0.969 24 170 3.30.70.640
1ekrA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Molybdopterin cofactor biosynthesis C (MoaC) domain 0.9624 24 170 3.30.70.640
af_B4FJH5_64_220_3.30.70.640 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Molybdopterin cofactor biosynthesis C (MoaC) domain 0.9614 17 171 3.30.70.640
af_P9WJR7_13_167_3.30.70.640 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Molybdopterin cofactor biosynthesis C (MoaC) domain 0.9607 16 171 3.30.70.640
ID Description Score Start End GO Terms
AF-X0TEN6-F1-model_v4 Molybdopterin cofactor biosynthesis C (MoaC) domain-containing protein 0.9928 28 125 GO:0006777
AF-A0A1F4F2M0-F1-model_v4 Molybdenum cofactor biosynthesis protein C 0.9926 28 146 GO:0006777
GO:0061799
AF-A0A838Q804-F1-model_v4 Cyclic pyranopterin monophosphate synthase MoaC (EC 4.6.1.17) 0.9891 38 161 GO:0006777
GO:0016829
AF-A0A699GEP3-F1-model_v4 cyclic pyranopterin monophosphate synthase (EC 4.6.1.17) 0.9888 28 171 GO:0006777
GO:0061799
AF-A0A1F7RTD9-F1-model_v4 cyclic pyranopterin monophosphate synthase (EC 4.6.1.17) 0.988 28 170 GO:0006777
GO:0061799

Feature Viewer

pLDDT pTM Quality
83.29 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map