F453701

General Info

Members Datasets Scaffolds Average Seq Length
488 251 976 340

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2554235003|2554249524
Length 392
Sequence MKAVRLHEFGGPDVLRYEDAPRPEMSADDVLVRVHAASLNPPDLYLRDGYRALPPEWQPSPSFPLILGTDVSGTVAAVGENVSQFKVNDEVYAMVRFPHDLMTGSSAYAEYVRVPVSELALKPAGIDHIQVAGAPMSLLTAWQFLVDLGHDLPNPFQTFQHAPVPLDGKIVLVNGAGGGVGHLAVQIAKWRGAKVIAVASGKNEALLYDLGADIFIDYTKAAAEAVVKDADLVLDAVGGANMERFLPSIKPDGALFLVNPLGFQGHDEAARRKITVSTTQVRSNGAQLAEAGRLLDDRSIAPIRWPRHRQRIVVLQKVASRARSCWLPPDHHLTSQGPGRRSSQTRCPRVLRSNRPANRCKNASLATRRLVVGVFVSGRCPCAYSTLWKSLR

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
3 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
4 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
5 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
6 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
7 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
8 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
9 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
10 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
11 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
12 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
13 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
14 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
15 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
16 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
17 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
18 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
19 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
20 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
21 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
22 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
23 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
33 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
34 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
35 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
36 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
37 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
38 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
39 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
40 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
43 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
44 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
45 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
46 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
47 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
48 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
49 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
50 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
51 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
52 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
53 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
54 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
55 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
56 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
57 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
58 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
59 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
60 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
61 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
62 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
63 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
64 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
65 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
67 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
68 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
82 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
83 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
86 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
87 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
88 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
89 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
90 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
91 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
92 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
93 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
94 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
95 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
96 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
97 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
98 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
99 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
100 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
101 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
102 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
103 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
104 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
105 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
106 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
107 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
108 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
109 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
110 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
111 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
112 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
113 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
114 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
115 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
116 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
117 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
118 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
119 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
120 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
121 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
122 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
123 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
124 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
125 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
126 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
127 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
128 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
129 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
130 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
131 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
132 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
133 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
134 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
135 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
136 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
137 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
138 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
139 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
140 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
141 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
142 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
143 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
144 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
145 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
146 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
147 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
148 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
149 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
150 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
151 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
152 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
153 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
154 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
155 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
156 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
157 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
158 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
159 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
160 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
161 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
162 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
163 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
164 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
165 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
166 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
167 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
168 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
169 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
170 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
171 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
172 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
173 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
174 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
175 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
176 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
177 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
178 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
179 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
180 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
181 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
182 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
183 2511231035 Pantoea sp. GM01 Isolate Rhizosphere
184 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
185 2547132181 Kosakonia sacchari SP1 Isolate Stem
186 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
187 2561511199 Enterobacter sp. R4-368 Isolate Nodule
188 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
189 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
190 2585427591 Rahnella aquatilis OV744 Isolate Rhizosphere
191 2585427592 Rahnella aquatilis OV588 Isolate Rhizosphere
192 2593339239 Luteibacter sp. UNCMF331Sha3.1 Isolate Unclassified
193 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
194 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
195 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
196 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
197 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
198 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
199 2600255256 Enterobacter sp. NFIX08 Isolate Rhizoplane
200 2600255257 Enterobacter sp. NFIX03 Isolate Rhizoplane
201 2600255310 Enterobacter sp. NFIX06 Isolate Rhizoplane
202 2600255311 Enterobacter sp. NFIX04 Isolate Rhizoplane
203 2602042046 Enterobacter sp. NFIX09 Isolate Rhizoplane
204 2609459761 Enterobacter sp. NFR05 Isolate Rhizoplane
205 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
206 2643221568 Rhizobium sp. Root564 Isolate Unclassified
207 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
208 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
209 2643221688 Rhizobium sp. Root482 Isolate Unclassified
210 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
211 2643221693 Rhizobium sp. Root491 Isolate Unclassified
212 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
213 2706794495 Dickeya zeae ZJU1202 Isolate Unclassified
214 2738541271 Pseudomonas sp. GV021 Isolate Unclassified
215 2738541297 Duganella sp. GV083 Isolate Unclassified
216 2738541357 Duganella sp. GV053 Isolate Unclassified
217 2738543003 Duganella sp. GV066 Isolate Unclassified
218 2738543016 Pseudomonas sp. GV012 Isolate Unclassified
219 2738543026 Duganella sp. GV089 Isolate Unclassified
220 2738543029 Duganella sp. GV039 Isolate Unclassified
221 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
222 2791354903 Mangrovibacter phragmitis MP23 Isolate Unclassified
223 2791355010 Kosakonia pseudosacchari NN143 Isolate Unclassified
224 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
225 2811995292 Kosakonia oryzae Ola 51 Isolate Unclassified
226 2814123068 Kosakonia radicincitans GXGL-4A Isolate Rhizosphere
227 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
228 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
229 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
230 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
231 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
232 2844528606 Pantoea sp. R-72498 v. 2 Isolate Unclassified
233 2855195626 Pectobacterium atrosepticum SS26 Isolate Stem Tuber
234 2865014394 Pantoea sp. R-71966 Isolate Unclassified
235 2871282230 Pectobacterium parmentieri SS90 Isolate Stem Tuber
236 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
237 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
238 2904474040 Rahnella aquatilis 4485 Isolate Rhizosphere
239 2919138771 Novosphingobium sp. 1748 Isolate Rhizosphere
240 2919150387 Rahnella aceris 1817 Isolate Unclassified
241 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
242 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
243 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
244 2927143783 Rahnella sp. 2050 Isolate Unclassified
245 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
246 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
247 2945874760 Phytobacter diazotrophicus UAEU22 Isolate Rhizosphere
248 2945951305 Pantoea agglomerans W2I1 Isolate Rhizosphere
249 646564506 Arcobacter nitrofigilis DSM 7299 Isolate Unclassified
250 8019499862 Kluyvera sp. 1366 Isolate Rhizosphere
251 8054002106 Azospirillum lipoferum 59b Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 85.25
Metatranscriptomes 0.2
Isolates 14.55

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.52
Nodule 2.25
Rhizoplane 5.12
Rhizosphere 50.2
Stem 0.2
Stem Tuber 0.41
Unclassified 0.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_135341 2162886007 Bacteria 2342
2 SwRhRL2b_contig_2558692 2162886007 Bacteria 26233
3 SwRhRL2b_contig_3308847 2162886007 Bacteria 12236
4 JGI25158J39367_1000002 3300002739 Bacteria 73701
5 JGI25157J39369_1000807 3300002741 Bacteria 15743
6 JGI25152J39213_1000262 3300002773 Bacteria 35191
7 JGI25150J39212_1000184 3300002774 Bacteria 35191
8 JGI25159J45721_1000133 3300002987 Bacteria 35035
9 JGI25159J45721_1000386 3300002987 Bacteria 20455
10 JGI25151J46595_10000536 3300003187 Bacteria 35191
11 JGI25151J46595_10001159 3300003187 Bacteria 19053
12 JGI25151J46595_10002555 3300003187 Bacteria 10797
13 JGI25153J46596_10001879 3300003215 Bacteria 12437
14 rootH2_10000386 3300003320 Bacteria 15142
15 rootL2_10101894 3300003322 Bacteria 5592
16 rootL2_10134922 3300003322 Bacteria 5305
17 rootL2_10153602 3300003322 Bacteria 3885
18 rootH1_10242883 3300003323 Bacteria 4959
19 JGI25160J50197_1000300 3300003354 Bacteria 34955
20 JGI25161J50226_1000026 3300003374 Bacteria 146134
21 Ga0006562J51391_1028135 3300003578 Bacteria 2820
22 Ga0055526_1000385 3300003771 Bacteria 35743
23 Ga0055526_1014627 3300003771 Bacteria 3211
24 Ga0055524_1002373 3300003775 Bacteria 9767
25 Ga0055524_1008867 3300003775 Bacteria 4141
26 Ga0055528_1001559 3300003790 Bacteria 13758
27 Ga0055528_1009932 3300003790 Bacteria 3926
28 Ga0055531_10021206 3300003794 Bacteria 2533
29 Ga0058692_1000073 3300003856 Bacteria 75920
30 Ga0058692_1000255 3300003856 Bacteria 29148
31 Ga0058692_1000485 3300003856 Bacteria 17793
32 Ga0058692_1006756 3300003856 Bacteria 3109
33 Ga0055543_1000085 3300004625 Bacteria 81274
34 Ga0065165_1000777 3300005262 Bacteria 42783
35 Ga0065165_1032126 3300005262 Bacteria 1649
36 Ga0065704_10003086 3300005289 Bacteria 7049
37 Ga0065704_10070250 3300005289 Bacteria 48491
38 Ga0065704_10070441 3300005289 Bacteria 24656
39 Ga0070658_10023132 3300005327 Bacteria 4989
40 Ga0070669_100000716 3300005353 Bacteria 24268
41 Ga0070669_100141987 3300005353 Bacteria 1852
42 Ga0070671_100099576 3300005355 Bacteria 2438
43 Ga0070667_100000112 3300005367 Bacteria 104843
44 Ga0070667_100060906 3300005367 Bacteria 3195
45 Ga0070665_100010045 3300005548 Bacteria 9577
46 Ga0070665_100013124 3300005548 Bacteria 8343
47 Ga0070665_100023475 3300005548 Bacteria 6210
48 Ga0070665_100080484 3300005548 Bacteria 3263
49 Ga0068855_100352552 3300005563 Bacteria 1621
50 Ga0068855_100542860 3300005563 Bacteria 1259
51 Ga0068857_100361685 3300005577 Bacteria 1345
52 Ga0068852_100019225 3300005616 Bacteria 5399
53 Ga0068863_100002912 3300005841 Bacteria 16972
54 Ga0068862_100003558 3300005844 Bacteria 13336
55 Ga0068862_100472558 3300005844 Bacteria 1185
56 Ga0075362_10012208 3300006177 Bacteria 3407
57 Ga0075367_10077264 3300006178 Bacteria 2010
58 Ga0075369_10003237 3300006186 Bacteria 5913
59 Ga0075366_10038833 3300006195 Bacteria 2812
60 Ga0099826_10000162 3300006948 Bacteria 27992
61 Ga0105251_10004046 3300009011 Bacteria 10326
62 Ga0105244_10000538 3300009036 Bacteria 33838
63 Ga0105250_10002204 3300009092 Bacteria 9931
64 Ga0105240_10005065 3300009093 Bacteria 19755
65 Ga0105240_10049802 3300009093 Bacteria 5285
66 Ga0105240_10267022 3300009093 Bacteria 1972
67 Ga0105247_10044916 3300009101 Bacteria 2710
68 Ga0105243_10093028 3300009148 Bacteria 2487
69 Ga0105243_10204382 3300009148 Bacteria 1734
70 Ga0105248_10023894 3300009177 Bacteria 6794
71 Ga0105237_10377334 3300009545 Bacteria 1422
72 Ga0105237_10412255 3300009545 Bacteria 1356
73 Ga0157371_10000136 3300013102 Bacteria 107554
74 Ga0157371_10000905 3300013102 Bacteria 33385
75 Ga0157371_10232931 3300013102 Bacteria 1324
76 Ga0157370_10000065 3300013104 Bacteria 113986
77 Ga0157370_10000481 3300013104 Bacteria 49689
78 Ga0157369_10025632 3300013105 Bacteria 6544
79 Ga0157369_10083021 3300013105 Bacteria 3427
80 Ga0163162_10016914 3300013306 Bacteria 7132
81 Ga0157372_10120362 3300013307 Bacteria 3014
82 Ga0182008_10028048 3300014497 Bacteria 2848
83 Ga0182008_10067407 3300014497 Bacteria 1761
84 Ga0182008_10093875 3300014497 Bacteria 1480
85 Ga0182007_10011677 3300015262 Bacteria 3412
86 Ga0163161_10015462 3300017792 Bacteria 5320
87 Ga0213876_10000030 3300021384 Bacteria 216610
88 Ga0209436_100016 3300025208 Bacteria 117496
89 Ga0207425_1000101 3300025245 Bacteria 80528
90 Ga0207425_1005401 3300025245 Bacteria 3650
91 Ga0209026_1000420 3300025250 Bacteria 36034
92 Ga0209759_1000149 3300025256 Bacteria 120932
93 Ga0209759_1001455 3300025256 Bacteria 13319
94 Ga0209129_1000070 3300025258 Bacteria 212476
95 Ga0209129_1000196 3300025258 Bacteria 80528
96 Ga0209673_1000086 3300025273 Bacteria 210101
97 Ga0209673_1000573 3300025273 Bacteria 58647
98 Ga0209673_1018050 3300025273 Bacteria 2579
99 Ga0209130_1000073 3300025284 Bacteria 174439
100 Ga0209025_1000044 3300025294 Bacteria 349480
101 Ga0209025_1000239 3300025294 Bacteria 128436
102 Ga0209025_1000450 3300025294 Bacteria 80528
103 Ga0209025_1000962 3300025294 Bacteria 43394
104 Ga0209564_1000168 3300025295 Bacteria 158368
105 Ga0209564_1001536 3300025295 Bacteria 22876
106 Ga0209758_1001089 3300025297 Bacteria 35245
107 Ga0209758_1034075 3300025297 Bacteria 2032
108 Ga0209050_1015229 3300025298 Bacteria 3246
109 Ga0209256_1000429 3300025299 Bacteria 65911
110 Ga0209256_1007893 3300025299 Bacteria 5096
111 Ga0207426_1000140 3300025302 Bacteria 195664
112 Ga0209257_1000311 3300025304 Bacteria 103263
113 Ga0207696_1001238 3300025711 Bacteria 14435
114 Ga0207696_1002130 3300025711 Bacteria 9939
115 Ga0207655_1000826 3300025728 Bacteria 33394
116 Ga0207713_1026944 3300025735 Bacteria 2620
117 Ga0207705_10083767 3300025909 Bacteria 2327
118 Ga0207695_10000416 3300025913 Bacteria 94770
119 Ga0207695_10004813 3300025913 Bacteria 18263
120 Ga0207671_10000736 3300025914 Bacteria 41541
121 Ga0207657_10034799 3300025919 Bacteria 4524
122 Ga0207657_10170582 3300025919 Bacteria 1763
123 Ga0207681_10000259 3300025923 Bacteria 40452
124 Ga0207644_10004943 3300025931 Bacteria 8697
125 Ga0207709_10199993 3300025935 Bacteria 1426
126 Ga0207668_10017504 3300025972 Bacteria 4490
127 Ga0207668_10060597 3300025972 Bacteria 2657
128 Ga0207658_10001052 3300025986 Bacteria 22374
129 Ga0207658_10044854 3300025986 Bacteria 3220
130 Ga0209371_1000002 3300027312 Bacteria 1551985
131 Ga0209371_1000017 3300027312 Bacteria 625776
132 Ga0209371_1000039 3300027312 Bacteria 350081
133 Ga0209371_1008590 3300027312 Bacteria 3363
134 Ga0209371_1010300 3300027312 Bacteria 2889
135 Ga0209282_1000273 3300027666 Bacteria 25724
136 Ga0268266_10008461 3300028379 Bacteria 9148
137 Ga0268266_10009427 3300028379 Bacteria 8597
138 Ga0268266_10058076 3300028379 Bacteria 3331
139 Ga0268266_10060031 3300028379 Bacteria 3277
140 Ga0268265_10063179 3300028380 Bacteria 2847
141 Ga0307515_10006781 3300028794 Bacteria 22788
142 Ga0268256_1000002 3300030500 Bacteria 1535763
143 Ga0268256_1000033 3300030500 Bacteria 420973
144 Ga0268256_1000208 3300030500 Bacteria 66543
145 Ga0268256_1008997 3300030500 Bacteria 3363
146 Ga0268256_1011054 3300030500 Bacteria 2888
147 Ga0316183_1039435 3300030742 Bacteria 1905
148 Ga0307513_10177498 3300031456 Bacteria 1998
149 Ga0395899_0003448 3300037312 Bacteria 12534
150 Ga0395900_0000242 3300037418 Bacteria 85924
151 Ga0395900_0053282 3300037418 Bacteria 4163
152 Ga0395898_0093863 3300037466 Bacteria 2883
153 Ga0395905_0057562 3300037471 Bacteria 3636
154 Ga0395905_0081241 3300037471 Bacteria 3038
155 Ga0395901_0111016 3300038443 Bacteria 2879
156 Ga0395901_0187234 3300038443 Bacteria 2171
157 Ga0395901_0211565 3300038443 Bacteria 2029
158 Ga0436365_0368505 3300039437 Bacteria 454216
159 Ga0439438_024127 3300041405 Bacteria 1668
160 Ga0439447_000540 3300041407 Bacteria 13961
161 Ga0439466_0000020 3300041411 Bacteria 97570
162 Ga0439452_000037 3300042010 Bacteria 150659
163 Ga0439463_000736 3300042016 Bacteria 9056
164 Ga0439463_025634 3300042016 Bacteria 1480
165 Ga0450907_005198 3300042146 Bacteria 2203
166 Ga0439460_0001603 3300042461 Bacteria 5353
167 Ga0466961_0019311 3300044693 Bacteria 4384
168 Ga0466959_0004424 3300045049 Bacteria 9411
169 Ga0495617_000004 3300046452 Bacteria 511274
170 Ga0495591_001886 3300046458 Bacteria 12332
171 Ga0495638_0000080 3300046460 Bacteria 155967
172 Ga0495650_0000031 3300046471 Bacteria 433811
173 Ga0495650_0002214 3300046471 Bacteria 16366
174 Ga0495650_0002427 3300046471 Bacteria 15123
175 Ga0495650_0003172 3300046471 Bacteria 12263
176 Ga0495650_0007423 3300046471 Bacteria 6591
177 Ga0495650_0011604 3300046471 Bacteria 4813
178 Ga0495605_0000223 3300046474 Bacteria 70071
179 Ga0495605_0000636 3300046474 Bacteria 26966
180 Ga0495605_0004095 3300046474 Bacteria 8602
181 Ga0495639_0005768 3300046475 Bacteria 5326
182 Ga0495584_0004869 3300046491 Bacteria 7175
183 Ga0495585_0000536 3300046492 Bacteria 35838
184 Ga0495585_0001274 3300046492 Bacteria 20169
185 Ga0495585_0023436 3300046492 Bacteria 3542
186 Ga0495585_0057061 3300046492 Bacteria 2156
187 Ga0495607_0002506 3300046501 Bacteria 14883
188 Ga0495607_0006810 3300046501 Bacteria 7976
189 Ga0495607_0016739 3300046501 Bacteria 4727
190 Ga0495607_0032650 3300046501 Bacteria 3175
191 Ga0495607_0051688 3300046501 Bacteria 2385
192 Ga0495607_0070589 3300046501 Bacteria 1951
193 Ga0495583_0000076 3300046506 Bacteria 174154
194 Ga0495583_0000109 3300046506 Bacteria 138768
195 Ga0495583_0000924 3300046506 Bacteria 34532
196 Ga0495583_0032235 3300046506 Bacteria 2531
197 Ga0495606_0000022 3300046507 Bacteria 265567
198 Ga0495606_0000384 3300046507 Bacteria 75041
199 Ga0495606_0001642 3300046507 Bacteria 29148
200 Ga0495606_0002842 3300046507 Bacteria 19191
201 Ga0495610_0000010 3300046512 Bacteria 538821
202 Ga0495610_0028503 3300046512 Bacteria 2952
203 Ga0495616_0000225 3300046513 Bacteria 46536
204 Ga0495616_0000911 3300046513 Bacteria 21287
205 Ga0495616_0032372 3300046513 Bacteria 2732
206 Ga0495620_0000319 3300046515 Bacteria 34075
207 Ga0495620_0062496 3300046515 Unclassified 1546
208 Ga0495620_0062957 3300046515 Bacteria 1539
209 Ga0495631_0001579 3300046518 Bacteria 13686
210 Ga0495631_0004414 3300046518 Bacteria 7494
211 Ga0495632_0000349 3300046519 Bacteria 43897
212 Ga0495632_0004500 3300046519 Bacteria 9447
213 Ga0495632_0026001 3300046519 Bacteria 3088
214 Ga0495637_0010210 3300046520 Bacteria 4550
215 Ga0495643_0010370 3300046522 Bacteria 5736
216 Ga0495643_0015067 3300046522 Bacteria 4580
217 Ga0495643_0043039 3300046522 Bacteria 2459
218 Ga0495643_0053844 3300046522 Bacteria 2156
219 Ga0495643_0134962 3300046522 Bacteria 1236
220 Ga0495644_0063900 3300046523 Bacteria 1383
221 Ga0495648_0000010 3300046524 Bacteria 307259
222 Ga0495648_0000236 3300046524 Bacteria 63182
223 Ga0495648_0001157 3300046524 Bacteria 26670
224 Ga0495648_0002921 3300046524 Bacteria 15354
225 Ga0495648_0016904 3300046524 Bacteria 5241
226 Ga0495648_0122896 3300046524 Bacteria 1392
227 Ga0495642_0001845 3300046528 Bacteria 9067
228 Ga0495654_0000211 3300046530 Bacteria 55188
229 Ga0495654_0000818 3300046530 Bacteria 23720
230 Ga0495654_0000867 3300046530 Bacteria 22788
231 Ga0495654_0001341 3300046530 Bacteria 17111
232 Ga0495654_0033173 3300046530 Bacteria 2614
233 Ga0495609_0000013 3300046538 Bacteria 328540
234 Ga0495609_0000014 3300046538 Bacteria 326023
235 Ga0495609_0000389 3300046538 Bacteria 37075
236 Ga0495609_0005448 3300046538 Bacteria 6676
237 Ga0495622_0000174 3300046557 Bacteria 52629
238 Ga0495622_0026243 3300046557 Bacteria 2721
239 Ga0495633_0000054 3300046558 Bacteria 151646
240 Ga0495633_0000076 3300046558 Bacteria 129915
241 Ga0495633_0000694 3300046558 Bacteria 30761
242 Ga0495656_0003444 3300046615 Bacteria 5350
243 Ga0495668_0000652 3300046616 Bacteria 41643
244 Ga0495668_0001721 3300046616 Bacteria 20164
245 Ga0495668_0003365 3300046616 Bacteria 12045
246 Ga0495668_0010686 3300046616 Bacteria 5545
247 Ga0495625_0000365 3300046660 Bacteria 69161
248 Ga0495625_0021287 3300046660 Bacteria 4995
249 Ga0495661_0000257 3300046665 Bacteria 60952
250 Ga0495661_0001554 3300046665 Bacteria 18936
251 Ga0495661_0015485 3300046665 Bacteria 5089
252 Ga0495661_0021093 3300046665 Bacteria 4250
253 Ga0495661_0046133 3300046665 Bacteria 2662
254 Ga0495671_0000002 3300046692 Bacteria 1136189
255 Ga0495671_0002142 3300046692 Bacteria 12598
256 Ga0495671_0005089 3300046692 Bacteria 7735
257 Ga0495671_0008669 3300046692 Bacteria 5711
258 Ga0495589_0000047 3300046794 Bacteria 117810
259 Ga0495589_0162644 3300046794 Bacteria 1063
260 Ga0495660_0000015 3300046810 Bacteria 324892
261 Ga0495660_0000170 3300046810 Bacteria 70588
262 Ga0495660_0002633 3300046810 Bacteria 11411
263 Ga0495660_0006577 3300046810 Bacteria 6868
264 Ga0495660_0050083 3300046810 Bacteria 2277
265 Ga0495672_0000001 3300047320 Bacteria 1458820
266 Ga0495672_0000037 3300047320 Bacteria 278588
267 Ga0495672_0001814 3300047320 Bacteria 20431
268 Ga0495672_0009056 3300047320 Bacteria 7259
269 Ga0495672_0085097 3300047320 Bacteria 1753
270 Ga0495683_0011950 3300047323 Bacteria 4563
271 Ga0495683_0016321 3300047323 Bacteria 3857
272 Ga0495683_0043765 3300047323 Bacteria 2253
273 Ga0495683_0051290 3300047323 Bacteria 2063
274 Ga0495687_000935 3300047443 Bacteria 30223
275 Ga0495677_0000515 3300047445 Bacteria 16249
276 Ga0495679_000146 3300047446 Bacteria 64432
277 Ga0495679_003809 3300047446 Bacteria 7141
278 Ga0495673_0000073 3300047469 Bacteria 211743
279 Ga0495673_0000207 3300047469 Bacteria 89423
280 Ga0495673_0010438 3300047469 Bacteria 5048
281 Ga0495673_0074955 3300047469 Bacteria 1414
282 Ga0495681_0008095 3300047470 Bacteria 6619
283 Ga0495626_0000010 3300048091 Bacteria 270265
284 Ga0495626_0000047 3300048091 Bacteria 161939
285 Ga0495626_0000423 3300048091 Bacteria 43383
286 Ga0496101_0082437 3300048904 Bacteria 2380
287 Ga0496101_0086041 3300048904 Bacteria 2330
288 Ga0496102_0000106 3300048905 Bacteria 118841
289 Ga0496102_0026294 3300048905 Bacteria 5190
290 Ga0496103_0000095 3300048906 Bacteria 98260
291 Ga0496103_0009248 3300048906 Bacteria 5838
292 Ga0496105_0001024 3300048908 Bacteria 19313
293 Ga0496106_0001059 3300048909 Bacteria 20276
294 Ga0496107_0017180 3300048910 Bacteria 5089
295 Ga0496107_0037241 3300048910 Bacteria 3491
296 Ga0496111_0154691 3300048914 Bacteria 1702
297 Ga0496113_0010221 3300048916 Bacteria 6196
298 Ga0496116_0000097 3300048919 Bacteria 200658
299 Ga0496116_0006654 3300048919 Bacteria 10431
300 Ga0496116_0068410 3300048919 Bacteria 2262
301 Ga0496117_0000033 3300048920 Bacteria 345605
302 Ga0496117_0000105 3300048920 Bacteria 188970
303 Ga0496117_0000153 3300048920 Bacteria 147065
304 Ga0496117_0000366 3300048920 Bacteria 78816
305 Ga0496117_0002157 3300048920 Bacteria 25680
306 Ga0496117_0013747 3300048920 Bacteria 7031
307 Ga0496117_0024328 3300048920 Bacteria 4793
308 Ga0496117_0032733 3300048920 Bacteria 3945
309 Ga0496117_0033057 3300048920 Bacteria 3917
310 Ga0496117_0036058 3300048920 Bacteria 3705
311 Ga0496117_0109228 3300048920 Bacteria 1727
312 Ga0496118_0000168 3300048921 Bacteria 118938
313 Ga0496118_0000269 3300048921 Bacteria 91110
314 Ga0496118_0000594 3300048921 Bacteria 59894
315 Ga0496118_0001510 3300048921 Bacteria 34648
316 Ga0496118_0005824 3300048921 Bacteria 13812
317 Ga0496118_0006265 3300048921 Bacteria 13156
318 Ga0496118_0012351 3300048921 Bacteria 8212
319 Ga0496118_0013800 3300048921 Bacteria 7609
320 Ga0496118_0052023 3300048921 Bacteria 3128
321 Ga0496118_0073682 3300048921 Bacteria 2444
322 Ga0496118_0080332 3300048921 Bacteria 2295
323 Ga0496119_0000084 3300048922 Bacteria 137831
324 Ga0496119_0007082 3300048922 Bacteria 10200
325 Ga0496119_0015843 3300048922 Bacteria 5774
326 Ga0496119_0022474 3300048922 Bacteria 4513
327 Ga0496119_0049150 3300048922 Bacteria 2610
328 Ga0496120_0000430 3300048923 Bacteria 66414
329 Ga0496120_0010462 3300048923 Bacteria 6471
330 Ga0496121_0000055 3300048924 Bacteria 304572
331 Ga0496121_0001994 3300048924 Bacteria 32423
332 Ga0496121_0006758 3300048924 Bacteria 14074
333 Ga0496121_0010977 3300048924 Bacteria 10114
334 Ga0496121_0032375 3300048924 Bacteria 4753
335 Ga0496121_0044268 3300048924 Bacteria 3842
336 Ga0496122_0000068 3300048925 Bacteria 226155
337 Ga0496122_0000192 3300048925 Bacteria 139867
338 Ga0496122_0000253 3300048925 Bacteria 120534
339 Ga0496122_0000336 3300048925 Bacteria 101904
340 Ga0496122_0000347 3300048925 Bacteria 100062
341 Ga0496122_0005232 3300048925 Bacteria 15572
342 Ga0496122_0015897 3300048925 Bacteria 7164
343 Ga0496122_0021287 3300048925 Bacteria 5811
344 Ga0496122_0041888 3300048925 Bacteria 3611
345 Ga0496122_0052279 3300048925 Bacteria 3094
346 Ga0496122_0054295 3300048925 Bacteria 3011
347 Ga0496122_0094472 3300048925 Bacteria 2024
348 Ga0496122_0099796 3300048925 Bacteria 1945
349 Ga0496122_0131025 3300048925 Bacteria 1593
350 Ga0496122_0167056 3300048925 Bacteria 1332
351 Ga0496123_0000014 3300048926 Bacteria 433465
352 Ga0496123_0000059 3300048926 Bacteria 226155
353 Ga0496123_0000206 3300048926 Bacteria 120598
354 Ga0496123_0000236 3300048926 Bacteria 111543
355 Ga0496123_0000383 3300048926 Bacteria 83052
356 Ga0496123_0006357 3300048926 Bacteria 11469
357 Ga0496123_0011918 3300048926 Bacteria 7467
358 Ga0496123_0016597 3300048926 Bacteria 5967
359 Ga0496123_0018367 3300048926 Bacteria 5567
360 Ga0496123_0038945 3300048926 Bacteria 3332
361 Ga0496123_0046461 3300048926 Bacteria 2945
362 Ga0496123_0050647 3300048926 Bacteria 2772
363 Ga0496123_0060855 3300048926 Bacteria 2431
364 Ga0496123_0102338 3300048926 Bacteria 1663
365 Ga0496124_0000060 3300048927 Bacteria 239933
366 Ga0496124_0000184 3300048927 Bacteria 123894
367 Ga0496124_0000254 3300048927 Bacteria 103551
368 Ga0496124_0000423 3300048927 Bacteria 75679
369 Ga0496124_0000975 3300048927 Bacteria 45532
370 Ga0496124_0001133 3300048927 Bacteria 41858
371 Ga0496124_0005183 3300048927 Bacteria 14820
372 Ga0496124_0015081 3300048927 Bacteria 7430
373 Ga0496124_0019727 3300048927 Bacteria 6261
374 Ga0496124_0037911 3300048927 Bacteria 4187
375 Ga0496124_0048101 3300048927 Bacteria 3647
376 Ga0496124_0054359 3300048927 Bacteria 3389
377 Ga0496124_0099441 3300048927 Bacteria 2359
378 Ga0496124_0102319 3300048927 Bacteria 2318
379 Ga0496124_0149348 3300048927 Bacteria 1835
380 Ga0496125_0014003 3300048928 Bacteria 7843
381 Ga0496125_0014834 3300048928 Bacteria 7567
382 Ga0496125_0052733 3300048928 Bacteria 3342
383 Ga0496125_0087149 3300048928 Bacteria 2359
384 Ga0496125_0118607 3300048928 Bacteria 1894
385 Ga0496125_0127529 3300048928 Bacteria 1799
386 Ga0496126_0000119 3300048929 Bacteria 184211
387 Ga0496126_0000294 3300048929 Bacteria 106327
388 Ga0496126_0016208 3300048929 Bacteria 7464
389 Ga0496126_0028873 3300048929 Bacteria 5277
390 Ga0496126_0122002 3300048929 Bacteria 2259
391 Ga0496126_0154508 3300048929 Bacteria 1964
392 Ga0496126_0191228 3300048929 Bacteria 1733
393 Ga0495678_000426 3300049459 Bacteria 42366
394 Ga0495678_000944 3300049459 Bacteria 25200
395 Ga0495678_002683 3300049459 Bacteria 11754
396 Ga0495678_004773 3300049459 Bacteria 7725
397 Ga0495678_007634 3300049459 Bacteria 5580
398 Ga0495682_0000001 3300049460 Bacteria 1559116
399 nmdc:mga03n38_15175_c1 3300050490 Bacteria 2970
400 nmdc:mga00v17_8_c1 3300050491 Bacteria 141008
401 nmdc:mga07m45_5103_c1 3300050496 Bacteria 6499
402 nmdc:mga0sz30_599_c1 3300050516 Bacteria 13429
403 Ga0500578_0199525 3300053086 Bacteria 1225
404 Ga0500557_000774 3300053105 Bacteria 4585
405 Ga0500569_000696 3300053109 Bacteria 5841
406 Ga0500594_0000261 3300053118 Bacteria 12363
407 Ga0500618_000204 3300053125 Bacteria 47175
408 Ga0500618_000306 3300053125 Bacteria 36367
409 Ga0500618_004852 3300053125 Bacteria 4199
410 Ga0500618_006432 3300053125 Bacteria 3448
411 Ga0500621_000002 3300053126 Bacteria 849473
412 Ga0500559_0045086 3300053136 Bacteria 1929
413 Ga0500561_0000020 3300053137 Bacteria 39471
414 Ga0500573_0001004 3300053140 Bacteria 12959
415 Ga0500586_001088 3300053145 Bacteria 5609
416 Ga0500588_0012413 3300053146 Bacteria 2112
417 Ga0500616_0011280 3300053153 Bacteria 5290
418 2554249524 2554235003 Bacteria 5877155
419 2509391131 2509276021 Bacteria 7634384
420 2511437376 2511231035 Bacteria 5341610
421 2517409640 2517287029 Bacteria 6905599
422 2547694946 2547132181 Bacteria 4945084
423 2559298145 2558860242 Bacteria 5568029
424 2562466972 2561511199 Bacteria 5155034
425 2585535151 2585427527 Bacteria 7273426
426 2585556138 2585427530 Bacteria 7383882
427 2585825543 2585427591 Bacteria 5482980
428 2585831983 2585427592 Bacteria 5370892
429 2595450282 2593339239 Bacteria 4124669
430 2599611192 2599185212 Bacteria 6765997
431 2600023466 2599185316 Bacteria 6320029
432 2600035641 2599185318 Bacteria 6961590
433 2600057135 2599185322 Bacteria 6763055
434 2600077377 2599185325 Bacteria 6324919
435 2600200810 2599185354 Bacteria 4398675
436 2601535935 2600255256 Bacteria 5597742
437 2601540517 2600255257 Bacteria 5597196
438 2601758929 2600255310 Bacteria 5600903
439 2601764831 2600255311 Bacteria 5598766
440 2603637131 2602042046 Bacteria 5483348
441 2609910374 2609459761 Bacteria 5513740
442 2616311503 2615840626 Bacteria 7921970
443 2643858114 2643221568 Bacteria 5187270
444 2644040162 2643221605 Bacteria 4772303
445 2644195185 2643221634 Bacteria 6705461
446 2644495676 2643221688 Bacteria 5260751
447 2644501533 2643221689 Bacteria 6042950
448 2644523579 2643221693 Bacteria 5513853
449 2671124661 2667528176 Bacteria 6724917
450 2707101922 2706794495 Bacteria 4536932
451 2738689184 2738541271 Bacteria 5657310
452 2738830344 2738541297 Bacteria 6549566
453 2739154140 2738541357 Bacteria 6549408
454 2739196060 2738543003 Bacteria 6549560
455 2739264571 2738543016 Bacteria 5657564
456 2739322536 2738543026 Bacteria 6549408
457 2739340777 2738543029 Bacteria 6549249
458 2739352181 2738543031 Bacteria 5769731
459 2791924670 2791354903 Bacteria 4937680
460 2792311552 2791355010 Bacteria 4864581
461 2808989345 2808606387 Bacteria 5697198
462 2813728148 2811995292 Bacteria 5303342
463 2814695691 2814123068 Bacteria 5687681
464 2819643577 2818991453 Bacteria 7181617
465 2819689041 2818991461 Bacteria 7026071
466 2841856693 2841851746 Bacteria 7532261
467 2842117251 2842110456 Bacteria 7656360
468 2842275486 2842271015 Bacteria 7807131
469 2844529635 2844528606 Bacteria 4733806
470 2855199818 2855195626 Bacteria 4927512
471 2865014590 2865014394 Bacteria 4764573
472 2871283569 2871282230 Bacteria 4917173
473 2884963256 2884960567 Bacteria 5437054
474 2899846749 2899845264 Bacteria 5672268
475 2904479109 2904474040 Bacteria 5504324
476 2919142512 2919138771 Bacteria 5281312
477 2919155218 2919150387 Bacteria 5500879
478 2919169911 2919166419 Bacteria 4952238
479 2923587737 2923586266 Bacteria 6565975
480 2926765561 2926760298 Bacteria 5505990
481 2927148800 2927143783 Bacteria 5504251
482 2933590067 2933586486 Bacteria 7667493
483 2933598521 2933594066 Bacteria 5594265
484 2945878273 2945874760 Bacteria 5527237
485 2945955931 2945951305 Bacteria 4918162
486 646813781 646564506 Bacteria 3192235
487 8019504459 8019499862 Bacteria 5169538
488 8054008254 8054002106 Bacteria 7987183
489 SwRhRL2b_contig_135341
490 SwRhRL2b_contig_2558692
491 SwRhRL2b_contig_3308847
492 JGI25158J39367_1000002
493 JGI25157J39369_1000807
494 JGI25152J39213_1000262
495 JGI25150J39212_1000184
496 JGI25159J45721_1000133
497 JGI25159J45721_1000386
498 JGI25151J46595_10000536
499 JGI25151J46595_10001159
500 JGI25151J46595_10002555
501 JGI25153J46596_10001879
502 rootH2_10000386
503 rootL2_10101894
504 rootL2_10134922
505 rootL2_10153602
506 rootH1_10242883
507 JGI25160J50197_1000300
508 JGI25161J50226_1000026
509 Ga0006562J51391_1028135
510 Ga0055526_1000385
511 Ga0055526_1014627
512 Ga0055524_1002373
513 Ga0055524_1008867
514 Ga0055528_1001559
515 Ga0055528_1009932
516 Ga0055531_10021206
517 Ga0058692_1000073
518 Ga0058692_1000255
519 Ga0058692_1000485
520 Ga0058692_1006756
521 Ga0055543_1000085
522 Ga0065165_1000777
523 Ga0065165_1032126
524 Ga0065704_10003086
525 Ga0065704_10070250
526 Ga0065704_10070441
527 Ga0070658_10023132
528 Ga0070669_100000716
529 Ga0070669_100141987
530 Ga0070671_100099576
531 Ga0070667_100000112
532 Ga0070667_100060906
533 Ga0070665_100010045
534 Ga0070665_100013124
535 Ga0070665_100023475
536 Ga0070665_100080484
537 Ga0068855_100352552
538 Ga0068855_100542860
539 Ga0068857_100361685
540 Ga0068852_100019225
541 Ga0068863_100002912
542 Ga0068862_100003558
543 Ga0068862_100472558
544 Ga0075362_10012208
545 Ga0075367_10077264
546 Ga0075369_10003237
547 Ga0075366_10038833
548 Ga0099826_10000162
549 Ga0105251_10004046
550 Ga0105244_10000538
551 Ga0105250_10002204
552 Ga0105240_10005065
553 Ga0105240_10049802
554 Ga0105240_10267022
555 Ga0105247_10044916
556 Ga0105243_10093028
557 Ga0105243_10204382
558 Ga0105248_10023894
559 Ga0105237_10377334
560 Ga0105237_10412255
561 Ga0157371_10000136
562 Ga0157371_10000905
563 Ga0157371_10232931
564 Ga0157370_10000065
565 Ga0157370_10000481
566 Ga0157369_10025632
567 Ga0157369_10083021
568 Ga0163162_10016914
569 Ga0157372_10120362
570 Ga0182008_10028048
571 Ga0182008_10067407
572 Ga0182008_10093875
573 Ga0182007_10011677
574 Ga0163161_10015462
575 Ga0213876_10000030
576 Ga0209436_100016
577 Ga0207425_1000101
578 Ga0207425_1005401
579 Ga0209026_1000420
580 Ga0209759_1000149
581 Ga0209759_1001455
582 Ga0209129_1000070
583 Ga0209129_1000196
584 Ga0209673_1000086
585 Ga0209673_1000573
586 Ga0209673_1018050
587 Ga0209130_1000073
588 Ga0209025_1000044
589 Ga0209025_1000239
590 Ga0209025_1000450
591 Ga0209025_1000962
592 Ga0209564_1000168
593 Ga0209564_1001536
594 Ga0209758_1001089
595 Ga0209758_1034075
596 Ga0209050_1015229
597 Ga0209256_1000429
598 Ga0209256_1007893
599 Ga0207426_1000140
600 Ga0209257_1000311
601 Ga0207696_1001238
602 Ga0207696_1002130
603 Ga0207655_1000826
604 Ga0207713_1026944
605 Ga0207705_10083767
606 Ga0207695_10000416
607 Ga0207695_10004813
608 Ga0207671_10000736
609 Ga0207657_10034799
610 Ga0207657_10170582
611 Ga0207681_10000259
612 Ga0207644_10004943
613 Ga0207709_10199993
614 Ga0207668_10017504
615 Ga0207668_10060597
616 Ga0207658_10001052
617 Ga0207658_10044854
618 Ga0209371_1000002
619 Ga0209371_1000017
620 Ga0209371_1000039
621 Ga0209371_1008590
622 Ga0209371_1010300
623 Ga0209282_1000273
624 Ga0268266_10008461
625 Ga0268266_10009427
626 Ga0268266_10058076
627 Ga0268266_10060031
628 Ga0268265_10063179
629 Ga0307515_10006781
630 Ga0268256_1000002
631 Ga0268256_1000033
632 Ga0268256_1000208
633 Ga0268256_1008997
634 Ga0268256_1011054
635 Ga0316183_1039435
636 Ga0307513_10177498
637 Ga0395899_0003448
638 Ga0395900_0000242
639 Ga0395900_0053282
640 Ga0395898_0093863
641 Ga0395905_0057562
642 Ga0395905_0081241
643 Ga0395901_0111016
644 Ga0395901_0187234
645 Ga0395901_0211565
646 Ga0436365_0368505
647 Ga0439438_024127
648 Ga0439447_000540
649 Ga0439466_0000020
650 Ga0439452_000037
651 Ga0439463_000736
652 Ga0439463_025634
653 Ga0450907_005198
654 Ga0439460_0001603
655 Ga0466961_0019311
656 Ga0466959_0004424
657 Ga0495617_000004
658 Ga0495591_001886
659 Ga0495638_0000080
660 Ga0495650_0000031
661 Ga0495650_0002214
662 Ga0495650_0002427
663 Ga0495650_0003172
664 Ga0495650_0007423
665 Ga0495650_0011604
666 Ga0495605_0000223
667 Ga0495605_0000636
668 Ga0495605_0004095
669 Ga0495639_0005768
670 Ga0495584_0004869
671 Ga0495585_0000536
672 Ga0495585_0001274
673 Ga0495585_0023436
674 Ga0495585_0057061
675 Ga0495607_0002506
676 Ga0495607_0006810
677 Ga0495607_0016739
678 Ga0495607_0032650
679 Ga0495607_0051688
680 Ga0495607_0070589
681 Ga0495583_0000076
682 Ga0495583_0000109
683 Ga0495583_0000924
684 Ga0495583_0032235
685 Ga0495606_0000022
686 Ga0495606_0000384
687 Ga0495606_0001642
688 Ga0495606_0002842
689 Ga0495610_0000010
690 Ga0495610_0028503
691 Ga0495616_0000225
692 Ga0495616_0000911
693 Ga0495616_0032372
694 Ga0495620_0000319
695 Ga0495620_0062496
696 Ga0495620_0062957
697 Ga0495631_0001579
698 Ga0495631_0004414
699 Ga0495632_0000349
700 Ga0495632_0004500
701 Ga0495632_0026001
702 Ga0495637_0010210
703 Ga0495643_0010370
704 Ga0495643_0015067
705 Ga0495643_0043039
706 Ga0495643_0053844
707 Ga0495643_0134962
708 Ga0495644_0063900
709 Ga0495648_0000010
710 Ga0495648_0000236
711 Ga0495648_0001157
712 Ga0495648_0002921
713 Ga0495648_0016904
714 Ga0495648_0122896
715 Ga0495642_0001845
716 Ga0495654_0000211
717 Ga0495654_0000818
718 Ga0495654_0000867
719 Ga0495654_0001341
720 Ga0495654_0033173
721 Ga0495609_0000013
722 Ga0495609_0000014
723 Ga0495609_0000389
724 Ga0495609_0005448
725 Ga0495622_0000174
726 Ga0495622_0026243
727 Ga0495633_0000054
728 Ga0495633_0000076
729 Ga0495633_0000694
730 Ga0495656_0003444
731 Ga0495668_0000652
732 Ga0495668_0001721
733 Ga0495668_0003365
734 Ga0495668_0010686
735 Ga0495625_0000365
736 Ga0495625_0021287
737 Ga0495661_0000257
738 Ga0495661_0001554
739 Ga0495661_0015485
740 Ga0495661_0021093
741 Ga0495661_0046133
742 Ga0495671_0000002
743 Ga0495671_0002142
744 Ga0495671_0005089
745 Ga0495671_0008669
746 Ga0495589_0000047
747 Ga0495589_0162644
748 Ga0495660_0000015
749 Ga0495660_0000170
750 Ga0495660_0002633
751 Ga0495660_0006577
752 Ga0495660_0050083
753 Ga0495672_0000001
754 Ga0495672_0000037
755 Ga0495672_0001814
756 Ga0495672_0009056
757 Ga0495672_0085097
758 Ga0495683_0011950
759 Ga0495683_0016321
760 Ga0495683_0043765
761 Ga0495683_0051290
762 Ga0495687_000935
763 Ga0495677_0000515
764 Ga0495679_000146
765 Ga0495679_003809
766 Ga0495673_0000073
767 Ga0495673_0000207
768 Ga0495673_0010438
769 Ga0495673_0074955
770 Ga0495681_0008095
771 Ga0495626_0000010
772 Ga0495626_0000047
773 Ga0495626_0000423
774 Ga0496101_0082437
775 Ga0496101_0086041
776 Ga0496102_0000106
777 Ga0496102_0026294
778 Ga0496103_0000095
779 Ga0496103_0009248
780 Ga0496105_0001024
781 Ga0496106_0001059
782 Ga0496107_0017180
783 Ga0496107_0037241
784 Ga0496111_0154691
785 Ga0496113_0010221
786 Ga0496116_0000097
787 Ga0496116_0006654
788 Ga0496116_0068410
789 Ga0496117_0000033
790 Ga0496117_0000105
791 Ga0496117_0000153
792 Ga0496117_0000366
793 Ga0496117_0002157
794 Ga0496117_0013747
795 Ga0496117_0024328
796 Ga0496117_0032733
797 Ga0496117_0033057
798 Ga0496117_0036058
799 Ga0496117_0109228
800 Ga0496118_0000168
801 Ga0496118_0000269
802 Ga0496118_0000594
803 Ga0496118_0001510
804 Ga0496118_0005824
805 Ga0496118_0006265
806 Ga0496118_0012351
807 Ga0496118_0013800
808 Ga0496118_0052023
809 Ga0496118_0073682
810 Ga0496118_0080332
811 Ga0496119_0000084
812 Ga0496119_0007082
813 Ga0496119_0015843
814 Ga0496119_0022474
815 Ga0496119_0049150
816 Ga0496120_0000430
817 Ga0496120_0010462
818 Ga0496121_0000055
819 Ga0496121_0001994
820 Ga0496121_0006758
821 Ga0496121_0010977
822 Ga0496121_0032375
823 Ga0496121_0044268
824 Ga0496122_0000068
825 Ga0496122_0000192
826 Ga0496122_0000253
827 Ga0496122_0000336
828 Ga0496122_0000347
829 Ga0496122_0005232
830 Ga0496122_0015897
831 Ga0496122_0021287
832 Ga0496122_0041888
833 Ga0496122_0052279
834 Ga0496122_0054295
835 Ga0496122_0094472
836 Ga0496122_0099796
837 Ga0496122_0131025
838 Ga0496122_0167056
839 Ga0496123_0000014
840 Ga0496123_0000059
841 Ga0496123_0000206
842 Ga0496123_0000236
843 Ga0496123_0000383
844 Ga0496123_0006357
845 Ga0496123_0011918
846 Ga0496123_0016597
847 Ga0496123_0018367
848 Ga0496123_0038945
849 Ga0496123_0046461
850 Ga0496123_0050647
851 Ga0496123_0060855
852 Ga0496123_0102338
853 Ga0496124_0000060
854 Ga0496124_0000184
855 Ga0496124_0000254
856 Ga0496124_0000423
857 Ga0496124_0000975
858 Ga0496124_0001133
859 Ga0496124_0005183
860 Ga0496124_0015081
861 Ga0496124_0019727
862 Ga0496124_0037911
863 Ga0496124_0048101
864 Ga0496124_0054359
865 Ga0496124_0099441
866 Ga0496124_0102319
867 Ga0496124_0149348
868 Ga0496125_0014003
869 Ga0496125_0014834
870 Ga0496125_0052733
871 Ga0496125_0087149
872 Ga0496125_0118607
873 Ga0496125_0127529
874 Ga0496126_0000119
875 Ga0496126_0000294
876 Ga0496126_0016208
877 Ga0496126_0028873
878 Ga0496126_0122002
879 Ga0496126_0154508
880 Ga0496126_0191228
881 Ga0495678_000426
882 Ga0495678_000944
883 Ga0495678_002683
884 Ga0495678_004773
885 Ga0495678_007634
886 Ga0495682_0000001
887 nmdc:mga03n38_15175_c1
888 nmdc:mga00v17_8_c1
889 nmdc:mga07m45_5103_c1
890 nmdc:mga0sz30_599_c1
891 Ga0500578_0199525
892 Ga0500557_000774
893 Ga0500569_000696
894 Ga0500594_0000261
895 Ga0500618_000204
896 Ga0500618_000306
897 Ga0500618_004852
898 Ga0500618_006432
899 Ga0500621_000002
900 Ga0500559_0045086
901 Ga0500561_0000020
902 Ga0500573_0001004
903 Ga0500586_001088
904 Ga0500588_0012413
905 Ga0500616_0011280
906 2554249524
907 2509391131
908 2511437376
909 2517409640
910 2547694946
911 2559298145
912 2562466972
913 2585535151
914 2585556138
915 2585825543
916 2585831983
917 2595450282
918 2599611192
919 2600023466
920 2600035641
921 2600057135
922 2600077377
923 2600200810
924 2601535935
925 2601540517
926 2601758929
927 2601764831
928 2603637131
929 2609910374
930 2616311503
931 2643858114
932 2644040162
933 2644195185
934 2644495676
935 2644501533
936 2644523579
937 2671124661
938 2707101922
939 2738689184
940 2738830344
941 2739154140
942 2739196060
943 2739264571
944 2739322536
945 2739340777
946 2739352181
947 2791924670
948 2792311552
949 2808989345
950 2813728148
951 2814695691
952 2819643577
953 2819689041
954 2841856693
955 2842117251
956 2842275486
957 2844529635
958 2855199818
959 2865014590
960 2871283569
961 2884963256
962 2899846749
963 2904479109
964 2919142512
965 2919155218
966 2919169911
967 2923587737
968 2926765561
969 2927148800
970 2933590067
971 2933598521
972 2945878273
973 2945955931
974 646813781
975 8019504459
976 8054008254

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08240

ADH_N

Alcohol dehydrogenase GroES-like domain

26

124

0.85

PF00107

ADH_zinc_N

Zinc-binding dehydrogenase

179

290

0.84

PF13602

ADH_zinc_N_2

Zinc-binding dehydrogenase

210

304

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ide-assembly1.cif.gz_A structure of the fragaria x ananassa enone oxidoreductase in complex with nadp+ and edhmf 0.8903 2 339
3tqh-assembly1.cif.gz_A structure of the quinone oxidoreductase from coxiella burnetii 0.8881 4 339
3tqh-assembly1.cif.gz_A structure of the quinone oxidoreductase from coxiella burnetii 0.8854 4 339
5a3j-assembly8.cif.gz_H crystal structure of the chloroplastic gamma-ketol reductase from arabidopsis thaliana bound to 13-oxo-9(z),11(e),15(z)- octadecatrienoic acid. 0.8771 4 337
5a4d-assembly5.cif.gz_E crystal structure of the chloroplastic gamma-ketol reductase from arabidopsis thaliana bound to 13kote and nadp 0.8742 6 337
ID Description Score Start End Superfamily
4a27B01 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9284 4 138 3.90.180.10
af_M0R3N4_1_117_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9235 6 133 3.90.180.10
af_A0A0P0W924_2_174_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9228 20 148 3.90.180.10
af_A0A0P0W8W7_12_109_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9159 25 128 3.90.180.10
5a4dE01 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9157 6 337 3.90.180.10
ID Description Score Start End GO Terms
AF-A0A7Y2W8E6-F1-model_v4 NADP-dependent oxidoreductase 0.996 67 337 GO:0016491
AF-B6A117-F1-model_v4 deleted 0.9931 6 337
AF-A0A8B4TPP6-F1-model_v4 Bifunctional zinc-containing alcohol dehydrogenase/quinone oxidoreductase (EC 1.6.5.5) 0.9911 1 325 GO:0008270
GO:0016491
AF-A0A4Q5QYW0-F1-model_v4 NADP-dependent oxidoreductase 0.9872 44 337 GO:0008270
GO:0016491
AF-A0A8B4TPP6-F1-model_v4 Bifunctional zinc-containing alcohol dehydrogenase/quinone oxidoreductase (EC 1.6.5.5) 0.9851 1 325 GO:0008270
GO:0016491

Map