F453715

General Info

Members Datasets Scaffolds Average Seq Length
488 348 109 310

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|8004640170|8004644161
Length 358
Sequence KAFANLPRCKKGAEPDAANLPPCGGDGRQARGGCPGSTSPIDAASMTDYKTLIDAETWAFIEKTNSYYPPDTIDYTIEEQRAIYDRMCREFFAGYPQAVTAETTAIAAPTNSIPIRIYRNATPDNTAMVLYIHGGGFILGGLDSHDDVCAELCARTGYEVVSVDYRLAPEHLHPAAFDDALGAFEWAARTYDRPVLLCGDSAGGNLCAAVAHATRGHVKKPAGQMLIYPGLGGDRSKGSYLTHSEAPMLTVRDLEFYKHIRTGGVDRTGDITLYPLADGDFANLPPTVLITAECDPLSSDGEAYRDRIVAAGGRAYWLEEPGLVHGYLRARHTVGRARASFTRIVDAVSALGRAECTW

Samples

Sample ID Description Type Environment
1 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
2 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
3 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
4 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
5 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
6 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
7 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
8 2512875024 Mesorhizobium loti R88b Isolate Nodule
9 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
10 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
11 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
12 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
13 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
14 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
15 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
16 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
17 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
18 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
19 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
20 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
21 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
22 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
23 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
24 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
25 2738543024 Aminobacter sp. AP02 Isolate Unclassified
26 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
27 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
28 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
29 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
30 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
31 2854681122 Luteovulum sphaeroides SCJ Isolate Unclassified
32 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
33 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
34 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
35 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
36 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
37 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
38 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
39 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
40 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
41 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
42 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
43 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
44 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
45 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
46 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
47 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
48 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
49 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
50 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
51 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
52 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
53 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
54 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
55 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
56 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
57 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
58 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
59 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
60 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
61 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
62 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
63 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
64 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
65 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
66 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
67 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
68 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
69 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
70 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
71 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
72 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
73 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
74 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
75 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
76 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
77 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
78 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
79 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
80 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
81 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
82 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
83 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
84 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
85 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
86 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
87 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
88 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
89 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
90 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
91 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
92 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
93 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
94 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
95 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
96 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
97 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
98 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
99 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
100 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
101 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
102 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
103 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
104 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
105 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
106 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
107 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
108 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
109 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
110 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
111 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
112 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
113 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
114 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
115 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
116 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
117 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
118 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
119 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
120 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
121 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
122 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
123 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
124 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
125 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
126 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
127 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
128 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
129 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
130 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
131 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
132 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
133 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
134 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
135 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
136 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
137 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
138 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
139 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
140 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
141 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
142 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
143 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
144 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
145 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
146 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
147 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
148 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
149 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
150 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
151 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
152 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
153 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
154 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
155 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
156 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
157 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
158 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
159 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
160 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
161 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
162 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
163 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
164 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
165 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
166 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
167 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
168 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
169 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
170 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
171 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
172 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
173 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
174 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
175 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
176 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
177 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
178 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
179 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
180 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
181 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
182 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
183 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
184 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
185 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
186 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
187 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
188 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
189 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
190 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
191 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
192 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
193 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
194 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
195 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
196 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
197 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
198 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
199 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
200 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
201 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
202 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
203 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
204 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
205 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
206 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
207 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
208 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
209 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
210 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
211 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
212 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
213 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
214 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
215 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
216 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
217 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
218 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
219 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
220 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
221 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
222 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
223 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
224 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
225 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
226 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
227 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
228 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
229 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
230 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
231 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
232 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
233 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
234 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
235 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
236 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
237 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
238 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
239 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
240 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
241 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
242 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
243 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
244 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
245 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
246 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
247 3004167301 Mesorhizobium loti 582 Isolate Unclassified
248 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
249 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
250 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
251 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
252 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
253 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
254 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
255 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
256 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
257 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
258 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
259 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
260 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
261 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
262 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
263 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
264 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
265 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
266 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
267 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
268 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
269 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
270 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
271 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
272 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
273 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
274 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
275 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
276 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
277 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
278 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
279 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
280 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
281 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
282 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
283 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
284 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
285 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
286 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
287 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
288 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
289 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
290 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
291 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
292 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
293 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
294 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
295 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
296 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
297 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
298 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
299 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
300 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
301 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
302 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
303 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
304 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
305 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
306 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
307 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
308 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
309 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
310 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
311 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
312 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
313 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
314 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
315 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
316 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
317 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
318 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
319 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
320 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
321 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
322 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
323 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
324 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
325 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
326 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
327 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
328 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
329 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
330 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
331 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
332 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
333 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
334 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
335 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
336 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
337 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
338 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
339 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
340 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
341 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
342 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
343 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
344 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
345 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
346 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
347 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
348 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 22.34
Metatranscriptomes 0
Isolates 77.66

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.33
Nodule 68.24
Rhizoplane 0.41
Rhizosphere 16.19
Stem 0
Stem Tuber 0
Unclassified 9.84

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25156J39149_1008947 3300002705 Bacteria 2476
2 JGI25157J39369_1000542 3300002741 Bacteria 22661
3 JGI25165J46597_1000147 3300003214 Bacteria 116564
4 Ga0055542_1000730 3300003762 Bacteria 25624
5 Ga0070658_10070081 3300005327 Bacteria 2869
6 Ga0068853_100343262 3300005539 Bacteria 1388
7 Ga0068856_100280289 3300005614 Bacteria 1684
8 Ga0075365_10005575 3300006038 Bacteria 6804
9 Ga0075365_10166240 3300006038 Bacteria 1539
10 Ga0075363_100051371 3300006048 Bacteria 2198
11 Ga0075367_10024009 3300006178 Bacteria 3436
12 Ga0075370_10048951 3300006353 Bacteria 2395
13 Ga0075370_10148694 3300006353 Bacteria 1372
14 Ga0075370_10173090 3300006353 Bacteria 1269
15 Ga0068865_100078226 3300006881 Bacteria 2365
16 Ga0105240_10354249 3300009093 Bacteria 1664
17 Ga0105240_10505893 3300009093 Bacteria 1343
18 Ga0105240_10636713 3300009093 Bacteria 1170
19 Ga0105238_10040365 3300009551 Bacteria 4729
20 Ga0105238_10201510 3300009551 Bacteria 1966
21 Ga0105239_10336413 3300010375 Bacteria 1703
22 Ga0157372_10341403 3300013307 Bacteria 1744
23 Ga0157380_10025180 3300014326 Bacteria 4509
24 Ga0157380_10408055 3300014326 Bacteria 1291
25 Ga0209026_1000050 3300025250 Bacteria 254994
26 Ga0209148_1000032 3300025254 Bacteria 557660
27 Ga0209759_1000313 3300025256 Bacteria 65652
28 Ga0209233_1000034 3300025261 Bacteria 578898
29 Ga0209455_1000085 3300025272 Bacteria 247601
30 Ga0209758_1006725 3300025297 Bacteria 8100
31 Ga0207647_10016984 3300025904 Bacteria 4955
32 Ga0207705_10148592 3300025909 Bacteria 1754
33 Ga0207654_10094850 3300025911 Bacteria 1827
34 Ga0207695_10344071 3300025913 Bacteria 1379
35 Ga0207639_10582485 3300026041 Bacteria 1030
36 Ga0268266_10044305 3300028379 Bacteria 3804
37 Ga0268265_10028402 3300028380 Bacteria 4004
38 Ga0307405_10155394 3300031731 Bacteria 1614
39 Ga0395900_0214419 3300037418 Bacteria 1943
40 Ga0395898_0369854 3300037466 Bacteria 1367
41 Ga0395905_0002606 3300037471 Bacteria 19855
42 Ga0395905_0006342 3300037471 Bacteria 11918
43 Ga0395905_0021230 3300037471 Bacteria 6144
44 Ga0395905_0057405 3300037471 Bacteria 3641
45 Ga0395905_0123843 3300037471 Bacteria 2431
46 Ga0395901_0067085 3300038443 Bacteria 3737
47 Ga0395901_0111689 3300038443 Bacteria 2870
48 Ga0395901_0176107 3300038443 Bacteria 2244
49 Ga0466972_0050786 3300044658 Bacteria 2001
50 Ga0495638_0012965 3300046460 Bacteria 5691
51 Ga0495638_0015769 3300046460 Bacteria 5063
52 Ga0495638_0049963 3300046460 Bacteria 2613
53 Ga0495597_0106772 3300046542 Bacteria 1177
54 Ga0495625_0047658 3300046660 Bacteria 3089
55 Ga0496112_0599134 3300048915 Bacteria 1034
56 Ga0496119_0015055 3300048922 Bacteria 5991
57 Ga0496121_0300026 3300048924 Bacteria 1091
58 Ga0496126_0153933 3300048929 Bacteria 1969
59 Ga0501032_0062238 3300049569 Bacteria 2501
60 Ga0501033_0003577 3300049570 Bacteria 12714
61 Ga0501033_0010870 3300049570 Bacteria 6979
62 Ga0501033_0033068 3300049570 Bacteria 3883
63 Ga0501034_0000012 3300049571 Bacteria 310504
64 Ga0501034_0084945 3300049571 Bacteria 3167
65 Ga0501037_0000105 3300049573 Bacteria 79431
66 Ga0501038_0094408 3300049574 Bacteria 2501
67 Ga0501038_0097432 3300049574 Bacteria 2453
68 Ga0501038_0127329 3300049574 Bacteria 2095
69 Ga0501043_0000055 3300049579 Bacteria 105522
70 Ga0501047_0024852 3300049581 Bacteria 5752
71 Ga0501047_0182286 3300049581 Bacteria 1966
72 Ga0501047_0369589 3300049581 Bacteria 1269
73 Ga0501069_0000106 3300049585 Bacteria 38605
74 Ga0501070_0000781 3300049586 Bacteria 28933
75 Ga0501070_0001320 3300049586 Bacteria 22173
76 Ga0501070_0026746 3300049586 Bacteria 4839
77 Ga0501070_0079985 3300049586 Bacteria 2704
78 Ga0501070_0082356 3300049586 Bacteria 2663
79 Ga0501071_0014383 3300049587 Bacteria 5411
80 Ga0501073_0028743 3300049589 Bacteria 3973
81 Ga0501073_0094777 3300049589 Bacteria 2073
82 Ga0501073_0128938 3300049589 Bacteria 1753
83 Ga0501074_0000072 3300049590 Bacteria 48714
84 Ga0501080_0000168 3300049742 Bacteria 47595
85 Ga0501080_0041989 3300049742 Bacteria 4260
86 Ga0501083_0000644 3300049744 Bacteria 22556
87 Ga0501035_0000060 3300049822 Bacteria 132293
88 Ga0501035_0001424 3300049822 Bacteria 24501
89 Ga0501035_0009657 3300049822 Bacteria 8975
90 Ga0501044_0000009 3300049823 Bacteria 270072
91 Ga0501044_0001598 3300049823 Bacteria 26508
92 Ga0501044_0257645 3300049823 Bacteria 1683
93 Ga0501044_0280581 3300049823 Bacteria 1600
94 Ga0501044_0329388 3300049823 Bacteria 1450
95 Ga0501044_0418503 3300049823 Bacteria 1250
96 nmdc:mga03n38_176976_c1 3300050490 Bacteria 1091
97 nmdc:mga0yw44_114957_c1 3300050492 Bacteria 1728
98 nmdc:mga0yw44_1407_c1 3300050492 Bacteria 9536
99 nmdc:mga06z11_229752_c1 3300050494 Bacteria 1087
100 nmdc:mga07m45_51028_c1 3300050496 Bacteria 2332
101 nmdc:mga0sz30_2400_c1 3300050516 Bacteria 6685
102 Ga0500610_0163751 3300053079 Bacteria 1104
103 Ga0495655_0013615 3300053083 Bacteria 1687
104 Ga0500658_0121589 3300053134 Bacteria 1158
105 Ga0500559_0022164 3300053136 Bacteria 2694
106 Ga0500568_0000116 3300053139 Bacteria 71883
107 Ga0500604_0050865 3300053151 Bacteria 1278
108 Ga0500616_0050478 3300053153 Bacteria 2197
109 Ga0500627_0087866 3300053158 Bacteria 1390

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2869271264 2869275332 267
2 iso_pu_bacteria 2869234852 2869239207 276
3 iso_pu_bacteria 2970619444 2970624387 279
4 iso_pu_bacteria 8004395343 8004399708 288
5 iso_pu_bacteria 2979742915 2979743516 291
6 3300053139 Ga0500568_0000116 Ga0500568_0000116_12419_13360 292
7 iso_pu_bacteria 2871435913 2871443053 293
8 3300014326 Ga0157380_10408055 Ga0157380_104080552 294
9 3300037471 Ga0395905_0021230 Ga0395905_0021230_3944_4942 296
10 3300037471 Ga0395905_0006342 Ga0395905_0006342_2296_3300 297
11 3300053153 Ga0500616_0050478 Ga0500616_0050478_331_1281 298
12 3300037466 Ga0395898_0369854 Ga0395898_0369854_227_1189 299
13 3300049571 Ga0501034_0000012 Ga0501034_0000012_274413_275354 299
14 3300049574 Ga0501038_0127329 Ga0501038_0127329_685_1626 299
15 3300049581 Ga0501047_0182286 Ga0501047_0182286_242_1186 300
16 3300049586 Ga0501070_0079985 Ga0501070_0079985_1595_2539 300
17 3300049589 Ga0501073_0094777 Ga0501073_0094777_772_1716 300
18 3300049744 Ga0501083_0000644 Ga0501083_0000644_1515_2459 300
19 3300037471 Ga0395905_0002606 Ga0395905_0002606_15444_16457 301
20 3300049570 Ga0501033_0010870 Ga0501033_0010870_117_1061 301
21 3300049571 Ga0501034_0084945 Ga0501034_0084945_1655_2599 301
22 3300049574 Ga0501038_0094408 Ga0501038_0094408_435_1379 301
23 3300049581 Ga0501047_0024852 Ga0501047_0024852_2779_3723 301
24 3300049586 Ga0501070_0000781 Ga0501070_0000781_13779_14723 301
25 3300049589 Ga0501073_0128938 Ga0501073_0128938_372_1316 301
26 3300049742 Ga0501080_0000168 Ga0501080_0000168_29931_30875 301
27 3300049822 Ga0501035_0001424 Ga0501035_0001424_9784_10728 301
28 3300049823 Ga0501044_0001598 Ga0501044_0001598_17229_18173 301
29 iso_pu_bacteria 2922178524 2922178590 302
30 3300031731 Ga0307405_10155394 Ga0307405_101553942 303
31 iso_pu_bacteria 8004395343 8004402510 303
32 iso_pu_bacteria 2854681122 2854681494 304
33 iso_pu_bacteria 2856364286 2856370115 306
34 iso_pu_bacteria 2869285874 2869290912 306
35 iso_pu_bacteria 2871429161 2871433194 306
36 iso_pu_bacteria 2874146452 2874153645 306
37 iso_pu_bacteria 2874155637 2874160910 306
38 iso_pu_bacteria 2876413966 2876418950 306
39 iso_pu_bacteria 2878745973 2878750807 306
40 iso_pu_bacteria 2903492973 2903496414 306
41 iso_pu_bacteria 2906308376 2906313732 306
42 iso_pu_bacteria 2906321335 2906326441 306
43 iso_pu_bacteria 2937813078 2937819963 306
44 iso_pu_bacteria 2958041894 2958044019 306
45 iso_pu_bacteria 2958130278 2958135312 306
46 iso_pu_bacteria 2958179912 2958184341 306
47 iso_pu_bacteria 2961077736 2961082396 306
48 iso_pu_bacteria 2977843712 2977850493 306
49 iso_pu_bacteria 8004387939 8004393201 306
50 iso_pu_bacteria 8004714634 8004719988 306
51 iso_pu_bacteria 2856334872 2856335801 307
52 iso_pu_bacteria 2857367948 2857370633 307
53 iso_pu_bacteria 2888350351 2888352886 307
54 iso_pu_bacteria 2924762789 2924762983 307
55 iso_pu_bacteria 2937822353 2937826460 307
56 iso_pu_bacteria 2958122699 2958129034 307
57 iso_pu_bacteria 2965032056 2965036135 307
58 iso_pu_bacteria 2977872689 2977879709 307
59 iso_pu_bacteria 2977957713 2977958227 307
60 iso_pu_bacteria 2987666974 2987667294 307
61 iso_pu_bacteria 3004239961 3004242488 307
62 iso_pu_bacteria 3004268573 3004272469 307
63 iso_pu_bacteria 2503198000 2503198440 308
64 iso_pu_bacteria 2509276018 2509368480 308
65 iso_pu_bacteria 2510065059 2510314761 308
66 iso_pu_bacteria 2512875016 2512934096 308
67 iso_pu_bacteria 2512875024 2512962387 308
68 iso_pu_bacteria 2513237164 2514037979 308
69 iso_pu_bacteria 2588253730 2588520239 308
70 iso_pu_bacteria 2643221595 2643983840 308
71 iso_pu_bacteria 2643221627 2644155972 308
72 iso_pu_bacteria 2687453392 2688595734 308
73 iso_pu_bacteria 2791355123 2792746917 308
74 iso_pu_bacteria 2844002411 2844003722 308
75 iso_pu_bacteria 2844009547 2844010540 308
76 iso_pu_bacteria 2856328259 2856332779 308
77 iso_pu_bacteria 2869169390 2869173082 308
78 iso_pu_bacteria 2869234852 2869239798 308
79 iso_pu_bacteria 2869242130 2869248768 308
80 iso_pu_bacteria 2869249662 2869251607 308
81 iso_pu_bacteria 2869256925 2869260000 308
82 iso_pu_bacteria 2869264136 2869266250 308
83 iso_pu_bacteria 2869271264 2869274112 308
84 iso_pu_bacteria 2871451962 2871455324 308
85 iso_pu_bacteria 2871459585 2871466721 308
86 iso_pu_bacteria 2871481445 2871484914 308
87 iso_pu_bacteria 2874109183 2874112680 308
88 iso_pu_bacteria 2874116593 2874120868 308
89 iso_pu_bacteria 2874131515 2874137390 308
90 iso_pu_bacteria 2874162495 2874168401 308
91 iso_pu_bacteria 2874168670 2874172143 308
92 iso_pu_bacteria 2876363079 2876363646 308
93 iso_pu_bacteria 2876386047 2876391290 308
94 iso_pu_bacteria 2876399893 2876404118 308
95 iso_pu_bacteria 2876406927 2876410963 308
96 iso_pu_bacteria 2876420981 2876421431 308
97 iso_pu_bacteria 2878730984 2878734803 308
98 iso_pu_bacteria 2878774303 2878780996 308
99 iso_pu_bacteria 2878781027 2878783816 308
100 iso_pu_bacteria 2903448605 2903454269 308
101 iso_pu_bacteria 2903513507 2903516003 308
102 iso_pu_bacteria 2903521522 2903523293 308
103 iso_pu_bacteria 2903528002 2903529332 308
104 iso_pu_bacteria 2906363423 2906369146 308
105 iso_pu_bacteria 2906370794 2906374640 308
106 iso_pu_bacteria 2906386501 2906393286 308
107 iso_pu_bacteria 2906393657 2906395086 308
108 iso_pu_bacteria 2906401398 2906405245 308
109 iso_pu_bacteria 2906408224 2906409394 308
110 iso_pu_bacteria 2906427513 2906432971 308
111 iso_pu_bacteria 2922151315 2922151415 308
112 iso_pu_bacteria 2922172374 2922176554 308
113 iso_pu_bacteria 2924710171 2924717045 308
114 iso_pu_bacteria 2924733363 2924736577 308
115 iso_pu_bacteria 2924741084 2924742056 308
116 iso_pu_bacteria 2924748358 2924752605 308
117 iso_pu_bacteria 2937848649 2937849611 308
118 iso_pu_bacteria 2937861824 2937862484 308
119 iso_pu_bacteria 2937868953 2937874482 308
120 iso_pu_bacteria 2937980651 2937986641 308
121 iso_pu_bacteria 2958108152 2958112727 308
122 iso_pu_bacteria 2958137437 2958143490 308
123 iso_pu_bacteria 2958158011 2958161776 308
124 iso_pu_bacteria 2961136820 2961139884 308
125 iso_pu_bacteria 2961183825 2961184980 308
126 iso_pu_bacteria 2963644680 2963645106 308
127 iso_pu_bacteria 2965025482 2965030228 308
128 iso_pu_bacteria 2965040258 2965047400 308
129 iso_pu_bacteria 2965047637 2965053287 308
130 iso_pu_bacteria 2965089291 2965096581 308
131 iso_pu_bacteria 2965102966 2965105132 308
132 iso_pu_bacteria 2965110997 2965119306 308
133 iso_pu_bacteria 2968083720 2968089995 308
134 iso_pu_bacteria 2968138860 2968139250 308
135 iso_pu_bacteria 2970489779 2970490080 308
136 iso_pu_bacteria 2970510686 2970517500 308
137 iso_pu_bacteria 2970532167 2970537563 308
138 iso_pu_bacteria 2970547951 2970552201 308
139 iso_pu_bacteria 2970619444 2970621522 308
140 iso_pu_bacteria 2970627176 2970629530 308
141 iso_pu_bacteria 2977851361 2977854699 308
142 iso_pu_bacteria 2977898635 2977900278 308
143 iso_pu_bacteria 2977907340 2977909244 308
144 iso_pu_bacteria 2977915119 2977919362 308
145 iso_pu_bacteria 2977922695 2977925765 308
146 iso_pu_bacteria 2977935797 2977939204 308
147 iso_pu_bacteria 2977950692 2977950957 308
148 iso_pu_bacteria 2977986579 2977986750 308
149 iso_pu_bacteria 2979772303 2979779023 308
150 iso_pu_bacteria 2979793036 2979794959 308
151 iso_pu_bacteria 2987645492 2987652052 308
152 iso_pu_bacteria 2987673487 2987680126 308
153 iso_pu_bacteria 2996310559 2996311794 308
154 iso_pu_bacteria 2996386984 2996387580 308
155 iso_pu_bacteria 3004167301 3004172956 308
156 iso_pu_bacteria 3004195979 3004197827 308
157 iso_pu_bacteria 3004211236 3004217303 308
158 iso_pu_bacteria 3004218560 3004220430 308
159 iso_pu_bacteria 3004232784 3004232785 308
160 iso_pu_bacteria 3004248173 3004252991 308
161 iso_pu_bacteria 3004334049 3004337629 308
162 iso_pu_bacteria 637000159 637077246 308
163 iso_pu_bacteria 649633066 649870302 308
164 iso_pu_bacteria 8004300914 8004304862 308
165 iso_pu_bacteria 8004312739 8004316622 308
166 iso_pu_bacteria 8004695233 8004701433 308
167 iso_pu_bacteria 8004727605 8004732636 308
168 3300048924 Ga0496121_0300026 Ga0496121_0300026_77_1006 309
169 3300048929 Ga0496126_0153933 Ga0496126_0153933_1012_1941 309
170 iso_pu_bacteria 2508501123 2509114070 309
171 iso_pu_bacteria 2508501127 2509140691 309
172 iso_pu_bacteria 2509276022 2509393574 309
173 iso_pu_bacteria 2513237090 2513613465 309
174 iso_pu_bacteria 2513237305 2514419200 309
175 iso_pu_bacteria 2513237351 2514587327 309
176 iso_pu_bacteria 2597489875 2597810462 309
177 iso_pu_bacteria 2643221550 2643772397 309
178 iso_pu_bacteria 2643221564 2643838314 309
179 iso_pu_bacteria 2643221623 2644133394 309
180 iso_pu_bacteria 2693429783 2694628100 309
181 iso_pu_bacteria 2693429784 2694641043 309
182 iso_pu_bacteria 2721755686 2723572860 309
183 iso_pu_bacteria 2738543024 2739309501 309
184 iso_pu_bacteria 2841734538 2841736152 309
185 iso_pu_bacteria 2847670302 2847673248 309
186 iso_pu_bacteria 2856314179 2856319283 309
187 iso_pu_bacteria 2856320880 2856322186 309
188 iso_pu_bacteria 2856342000 2856342778 309
189 iso_pu_bacteria 2856349417 2856351902 309
190 iso_pu_bacteria 2856356410 2856361747 309
191 iso_pu_bacteria 2857349434 2857352700 309
192 iso_pu_bacteria 2869278585 2869284719 309
193 iso_pu_bacteria 2871444079 2871450167 309
194 iso_pu_bacteria 2871474448 2871478961 309
195 iso_pu_bacteria 2871488783 2871491088 309
196 iso_pu_bacteria 2871495908 2871500851 309
197 iso_pu_bacteria 2874102143 2874105123 309
198 iso_pu_bacteria 2874123672 2874131496 309
199 iso_pu_bacteria 2874139085 2874142961 309
200 iso_pu_bacteria 2876369609 2876372851 309
201 iso_pu_bacteria 2876377896 2876380545 309
202 iso_pu_bacteria 2876392853 2876397265 309
203 iso_pu_bacteria 2878035449 2878039672 309
204 iso_pu_bacteria 2878738818 2878740970 309
205 iso_pu_bacteria 2878753008 2878755497 309
206 iso_pu_bacteria 2878760144 2878764920 309
207 iso_pu_bacteria 2878767105 2878772042 309
208 iso_pu_bacteria 2878788777 2878793185 309
209 iso_pu_bacteria 2881147464 2881147968 309
210 iso_pu_bacteria 2881155292 2881158986 309
211 iso_pu_bacteria 2881161766 2881164752 309
212 iso_pu_bacteria 2881845957 2881851507 309
213 iso_pu_bacteria 2881853255 2881858940 309
214 iso_pu_bacteria 2881861095 2881867813 309
215 iso_pu_bacteria 2882632389 2882634767 309
216 iso_pu_bacteria 2882912400 2882917824 309
217 iso_pu_bacteria 2885305155 2885306565 309
218 iso_pu_bacteria 2885312484 2885314392 309
219 iso_pu_bacteria 2885318864 2885324352 309
220 iso_pu_bacteria 2885326080 2885333880 309
221 iso_pu_bacteria 2885334103 2885336759 309
222 iso_pu_bacteria 2885350715 2885350997 309
223 iso_pu_bacteria 2888337043 2888343425 309
224 iso_pu_bacteria 2888343758 2888344117 309
225 iso_pu_bacteria 2889010040 2889014657 309
226 iso_pu_bacteria 2889016732 2889020355 309
227 iso_pu_bacteria 2903492973 2903499028 309
228 iso_pu_bacteria 2903540706 2903545664 309
229 iso_pu_bacteria 2904659560 2904664019 309
230 iso_pu_bacteria 2906328253 2906334954 309
231 iso_pu_bacteria 2906414383 2906419355 309
232 iso_pu_bacteria 2922130491 2922130792 309
233 iso_pu_bacteria 2922158528 2922163276 309
234 iso_pu_bacteria 2922185730 2922192781 309
235 iso_pu_bacteria 2924718760 2924723719 309
236 iso_pu_bacteria 2924726620 2924729851 309
237 iso_pu_bacteria 2924776078 2924778571 309
238 iso_pu_bacteria 2924784321 2924791530 309
239 iso_pu_bacteria 2937836603 2937836615 309
240 iso_pu_bacteria 2937843397 2937847774 309
241 iso_pu_bacteria 2937877337 2937878794 309
242 iso_pu_bacteria 2937972304 2937974424 309
243 iso_pu_bacteria 2937994558 2937999517 309
244 iso_pu_bacteria 2938014810 2938018595 309
245 iso_pu_bacteria 2958034702 2958041426 309
246 iso_pu_bacteria 2958041894 2958042400 309
247 iso_pu_bacteria 2958064165 2958065254 309
248 iso_pu_bacteria 2958071322 2958077114 309
249 iso_pu_bacteria 2958084443 2958085945 309
250 iso_pu_bacteria 2958092219 2958100123 309
251 iso_pu_bacteria 2958115193 2958119353 309
252 iso_pu_bacteria 2958144490 2958144855 309
253 iso_pu_bacteria 2958165035 2958169990 309
254 iso_pu_bacteria 2958172287 2958178302 309
255 iso_pu_bacteria 2961114664 2961118841 309
256 iso_pu_bacteria 2961127735 2961128919 309
257 iso_pu_bacteria 2961136820 2961139688 309
258 iso_pu_bacteria 2961163497 2961168447 309
259 iso_pu_bacteria 2961170736 2961176559 309
260 iso_pu_bacteria 2965018300 2965023266 309
261 iso_pu_bacteria 2965119406 2965122280 309
262 iso_pu_bacteria 2967996073 2968001424 309
263 iso_pu_bacteria 2968003550 2968007477 309
264 iso_pu_bacteria 2968016561 2968022946 309
265 iso_pu_bacteria 2968091066 2968093785 309
266 iso_pu_bacteria 2968097103 2968097790 309
267 iso_pu_bacteria 2968110612 2968115158 309
268 iso_pu_bacteria 2968117919 2968122046 309
269 iso_pu_bacteria 2968128360 2968131244 309
270 iso_pu_bacteria 2968171901 2968176849 309
271 iso_pu_bacteria 2970469710 2970475531 309
272 iso_pu_bacteria 2970503327 2970509230 309
273 iso_pu_bacteria 2970524798 2970525823 309
274 iso_pu_bacteria 2970540015 2970540571 309
275 iso_pu_bacteria 2970554993 2970559767 309
276 iso_pu_bacteria 2970593180 2970599330 309
277 iso_pu_bacteria 2977821940 2977824637 309
278 iso_pu_bacteria 2977858184 2977861083 309
279 iso_pu_bacteria 2977864932 2977871576 309
280 iso_pu_bacteria 2977942078 2977944223 309
281 iso_pu_bacteria 2977971508 2977974635 309
282 iso_pu_bacteria 2979710463 2979712063 309
283 iso_pu_bacteria 2979764755 2979765691 309
284 iso_pu_bacteria 2979779861 2979784902 309
285 iso_pu_bacteria 2979808191 2979813909 309
286 iso_pu_bacteria 2987636660 2987641293 309
287 iso_pu_bacteria 2987652177 2987653715 309
288 iso_pu_bacteria 2987659509 2987664464 309
289 iso_pu_bacteria 2996341866 2996347637 309
290 iso_pu_bacteria 2996348954 2996355859 309
291 iso_pu_bacteria 3000135777 3000142499 309
292 iso_pu_bacteria 3004188549 3004193520 309
293 iso_pu_bacteria 3004203850 3004210099 309
294 iso_pu_bacteria 3004275668 3004282285 309
295 iso_pu_bacteria 3004289098 3004293870 309
296 iso_pu_bacteria 8002285264 8002287076 309
297 iso_pu_bacteria 8004374579 8004377076 309
298 iso_pu_bacteria 8004445564 8004449799 309
299 iso_pu_bacteria 8004633249 8004637281 309
300 iso_pu_bacteria 8004703790 8004706937 309
301 iso_pu_bacteria 8055617313 8055617639 309
302 3300005614 Ga0068856_100280289 Ga0068856_1002802892 310
303 3300010375 Ga0105239_10336413 Ga0105239_103364132 310
304 3300025297 Ga0209758_1006725 Ga0209758_10067252 310
305 3300025904 Ga0207647_10016984 Ga0207647_100169843 310
306 3300048915 Ga0496112_0599134 Ga0496112_0599134_58_993 310
307 3300048922 Ga0496119_0015055 Ga0496119_0015055_2948_3880 310
308 iso_pu_bacteria 2869242130 2869246641 310
309 iso_pu_bacteria 2871481445 2871485770 310
310 iso_pu_bacteria 2874116593 2874120264 310
311 iso_pu_bacteria 2876386047 2876392581 310
312 iso_pu_bacteria 2876420981 2876424652 310
313 iso_pu_bacteria 2906401398 2906402258 310
314 iso_pu_bacteria 2924741084 2924748211 310
315 iso_pu_bacteria 2937861824 2937867741 310
316 iso_pu_bacteria 2958108152 2958112000 310
317 iso_pu_bacteria 2961183825 2961187697 310
318 iso_pu_bacteria 2970627176 2970628859 310
319 iso_pu_bacteria 2977851361 2977855277 310
320 iso_pu_bacteria 2977907340 2977911439 310
321 iso_pu_bacteria 2979764755 2979770651 310
322 iso_pu_bacteria 2979772303 2979779444 310
323 iso_pu_bacteria 3002141150 3002143609 310
324 iso_pu_bacteria 8004727605 8004731891 310
325 3300046542 Ga0495597_0106772 Ga0495597_0106772_44_979 311
326 3300046660 Ga0495625_0047658 Ga0495625_0047658_262_1197 311
327 3300050492 nmdc:mga0yw44_114957_c1 nmdc:mga0yw44_114957_c1_214_1149 311
328 3300053079 Ga0500610_0163751 Ga0500610_0163751_50_985 311
329 3300053134 Ga0500658_0121589 Ga0500658_0121589_42_977 311
330 3300053151 Ga0500604_0050865 Ga0500604_0050865_65_1000 311
331 3300053158 Ga0500627_0087866 Ga0500627_0087866_29_964 311
332 iso_pu_bacteria 2509276018 2509371543 311
333 iso_pu_bacteria 2510065059 2510315230 311
334 iso_pu_bacteria 2597489875 2597810816 311
335 iso_pu_bacteria 2599185301 2599935392 311
336 iso_pu_bacteria 2687453392 2688596147 311
337 iso_pu_bacteria 2844009547 2844010951 311
338 iso_pu_bacteria 2856328259 2856329429 311
339 iso_pu_bacteria 2856334872 2856335350 311
340 iso_pu_bacteria 2856342000 2856348094 311
341 iso_pu_bacteria 2857367948 2857373289 311
342 iso_pu_bacteria 2869249662 2869253992 311
343 iso_pu_bacteria 2869256925 2869257705 311
344 iso_pu_bacteria 2869264136 2869269867 311
345 iso_pu_bacteria 2871435913 2871443390 311
346 iso_pu_bacteria 2871451962 2871452037 311
347 iso_pu_bacteria 2874131515 2874136570 311
348 iso_pu_bacteria 2874162495 2874163661 311
349 iso_pu_bacteria 2876399893 2876401126 311
350 iso_pu_bacteria 2876406927 2876407891 311
351 iso_pu_bacteria 2878730984 2878734492 311
352 iso_pu_bacteria 2878781027 2878782806 311
353 iso_pu_bacteria 2906363423 2906365519 311
354 iso_pu_bacteria 2906370794 2906372701 311
355 iso_pu_bacteria 2906393657 2906395801 311
356 iso_pu_bacteria 2906408224 2906409001 311
357 iso_pu_bacteria 2922151315 2922153586 311
358 iso_pu_bacteria 2922172374 2922177276 311
359 iso_pu_bacteria 2924710171 2924715780 311
360 iso_pu_bacteria 2924733363 2924738470 311
361 iso_pu_bacteria 2924748358 2924753123 311
362 iso_pu_bacteria 2958122699 2958129565 311
363 iso_pu_bacteria 2958158011 2958164171 311
364 iso_pu_bacteria 2965025482 2965026817 311
365 iso_pu_bacteria 2965040258 2965047345 311
366 iso_pu_bacteria 2965089291 2965090778 311
367 iso_pu_bacteria 2965102966 2965105281 311
368 iso_pu_bacteria 2968138860 2968139095 311
369 iso_pu_bacteria 2970510686 2970511813 311
370 iso_pu_bacteria 2970524798 2970526241 311
371 iso_pu_bacteria 2970540015 2970544581 311
372 iso_pu_bacteria 2977872689 2977876726 311
373 iso_pu_bacteria 2977898635 2977903048 311
374 iso_pu_bacteria 2977915119 2977920892 311
375 iso_pu_bacteria 2977935797 2977941646 311
376 iso_pu_bacteria 2977950692 2977955415 311
377 iso_pu_bacteria 2979793036 2979794937 311
378 iso_pu_bacteria 2987645492 2987651204 311
379 iso_pu_bacteria 2996386984 2996387766 311
380 iso_pu_bacteria 3004195979 3004201655 311
381 iso_pu_bacteria 3004232784 3004237205 311
382 iso_pu_bacteria 3004239961 3004244617 311
383 iso_pu_bacteria 649633066 649870707 311
384 iso_pu_bacteria 8004300914 8004304556 311
385 iso_pu_bacteria 8004695233 8004699492 311
386 3300003762 Ga0055542_1000730 Ga0055542_100073020 312
387 3300005327 Ga0070658_10070081 Ga0070658_100700813 312
388 3300005539 Ga0068853_100343262 Ga0068853_1003432621 312
389 3300006178 Ga0075367_10024009 Ga0075367_100240092 312
390 3300006353 Ga0075370_10048951 Ga0075370_100489512 312
391 3300009093 Ga0105240_10505893 Ga0105240_105058931 312
392 3300009093 Ga0105240_10636713 Ga0105240_106367131 312
393 3300009551 Ga0105238_10201510 Ga0105238_102015102 312
394 3300013307 Ga0157372_10341403 Ga0157372_103414032 312
395 3300025254 Ga0209148_1000032 Ga0209148_1000032448 312
396 3300025272 Ga0209455_1000085 Ga0209455_1000085224 312
397 3300025909 Ga0207705_10148592 Ga0207705_101485921 312
398 3300025911 Ga0207654_10094850 Ga0207654_100948502 312
399 3300026041 Ga0207639_10582485 Ga0207639_105824851 312
400 3300046460 Ga0495638_0049963 Ga0495638_0049963_1105_2043 312
401 3300049569 Ga0501032_0062238 Ga0501032_0062238_1486_2427 312
402 3300049570 Ga0501033_0033068 Ga0501033_0033068_1164_2105 312
403 3300049822 Ga0501035_0009657 Ga0501035_0009657_5433_6374 312
404 3300049823 Ga0501044_0257645 Ga0501044_0257645_668_1609 312
405 3300050494 nmdc:mga06z11_229752_c1 nmdc:mga06z11_229752_c1_62_1000 312
406 3300050496 nmdc:mga07m45_51028_c1 nmdc:mga07m45_51028_c1_460_1398 312
407 iso_pu_bacteria 2869278585 2869283089 312
408 iso_pu_bacteria 2871466892 2871470044 312
409 iso_pu_bacteria 2874139085 2874142748 312
410 iso_pu_bacteria 2878738818 2878741173 312
411 iso_pu_bacteria 2888337043 2888343558 312
412 iso_pu_bacteria 2924718760 2924724510 312
413 iso_pu_bacteria 2924776078 2924778833 312
414 iso_pu_bacteria 2937877337 2937880426 312
415 iso_pu_bacteria 2958034702 2958039073 312
416 iso_pu_bacteria 2958041894 2958052144 312
417 iso_pu_bacteria 2958064165 2958070978 312
418 iso_pu_bacteria 2958084443 2958087561 312
419 iso_pu_bacteria 2968016561 2968017448 312
420 iso_pu_bacteria 2970469710 2970472494 312
421 iso_pu_bacteria 2970593180 2970597708 312
422 iso_pu_bacteria 2977922695 2977924728 312
423 iso_pu_bacteria 2996348954 2996349874 312
424 iso_pu_bacteria 3004211236 3004218519 312
425 iso_pu_bacteria 3004218560 3004223635 312
426 iso_pu_bacteria 3004275668 3004276576 312
427 iso_pu_bacteria 3004289098 3004296693 312
428 iso_pu_bacteria 3004334049 3004337059 312
429 iso_pu_bacteria 8004361976 8004362624 312
430 3300002705 JGI25156J39149_1008947 JGI25156J39149_10089472 313
431 3300002741 JGI25157J39369_1000542 JGI25157J39369_10005427 313
432 3300003214 JGI25165J46597_1000147 JGI25165J46597_10001477 313
433 3300006038 Ga0075365_10005575 Ga0075365_100055756 313
434 3300006038 Ga0075365_10166240 Ga0075365_101662402 313
435 3300006048 Ga0075363_100051371 Ga0075363_1000513712 313
436 3300006353 Ga0075370_10148694 Ga0075370_101486942 313
437 3300006353 Ga0075370_10173090 Ga0075370_101730902 313
438 3300006881 Ga0068865_100078226 Ga0068865_1000782262 313
439 3300009093 Ga0105240_10354249 Ga0105240_103542491 313
440 3300009551 Ga0105238_10040365 Ga0105238_100403653 313
441 3300014326 Ga0157380_10025180 Ga0157380_100251803 313
442 3300025250 Ga0209026_1000050 Ga0209026_1000050210 313
443 3300025256 Ga0209759_1000313 Ga0209759_100031351 313
444 3300025261 Ga0209233_1000034 Ga0209233_10000346 313
445 3300025913 Ga0207695_10344071 Ga0207695_103440711 313
446 3300028379 Ga0268266_10044305 Ga0268266_100443052 313
447 3300028380 Ga0268265_10028402 Ga0268265_100284022 313
448 3300037418 Ga0395900_0214419 Ga0395900_0214419_808_1749 313
449 3300037471 Ga0395905_0057405 Ga0395905_0057405_976_1917 313
450 3300037471 Ga0395905_0123843 Ga0395905_0123843_1297_2238 313
451 3300038443 Ga0395901_0067085 Ga0395901_0067085_473_1414 313
452 3300038443 Ga0395901_0111689 Ga0395901_0111689_1101_2042 313
453 3300038443 Ga0395901_0176107 Ga0395901_0176107_107_1048 313
454 3300044658 Ga0466972_0050786 Ga0466972_0050786_880_1821 313
455 3300046460 Ga0495638_0012965 Ga0495638_0012965_3089_4048 313
456 3300046460 Ga0495638_0015769 Ga0495638_0015769_553_1500 313
457 3300049570 Ga0501033_0003577 Ga0501033_0003577_2279_3223 313
458 3300049573 Ga0501037_0000105 Ga0501037_0000105_10776_11720 313
459 3300049574 Ga0501038_0097432 Ga0501038_0097432_183_1127 313
460 3300049579 Ga0501043_0000055 Ga0501043_0000055_27133_28077 313
461 3300049581 Ga0501047_0369589 Ga0501047_0369589_101_1045 313
462 3300049585 Ga0501069_0000106 Ga0501069_0000106_11329_12273 313
463 3300049586 Ga0501070_0001320 Ga0501070_0001320_15319_16263 313
464 3300049586 Ga0501070_0026746 Ga0501070_0026746_2384_3355 313
465 3300049586 Ga0501070_0082356 Ga0501070_0082356_1234_2178 313
466 3300049587 Ga0501071_0014383 Ga0501071_0014383_4173_5117 313
467 3300049589 Ga0501073_0028743 Ga0501073_0028743_2945_3889 313
468 3300049590 Ga0501074_0000072 Ga0501074_0000072_29618_30562 313
469 3300049742 Ga0501080_0041989 Ga0501080_0041989_1756_2700 313
470 3300049822 Ga0501035_0000060 Ga0501035_0000060_1529_2473 313
471 3300049823 Ga0501044_0000009 Ga0501044_0000009_190992_191936 313
472 3300049823 Ga0501044_0280581 Ga0501044_0280581_143_1084 313
473 3300049823 Ga0501044_0329388 Ga0501044_0329388_75_1046 313
474 3300049823 Ga0501044_0418503 Ga0501044_0418503_49_1047 313
475 3300050490 nmdc:mga03n38_176976_c1 nmdc:mga03n38_176976_c1_15_956 313
476 3300050492 nmdc:mga0yw44_1407_c1 nmdc:mga0yw44_1407_c1_3290_4231 313
477 3300050516 nmdc:mga0sz30_2400_c1 nmdc:mga0sz30_2400_c1_5411_6352 313
478 3300053083 Ga0495655_0013615 Ga0495655_0013615_208_1170 313
479 3300053136 Ga0500559_0022164 Ga0500559_0022164_1079_2086 313
480 iso_pu_bacteria 2513237164 2514035460 313
481 iso_pu_bacteria 2869162929 2869164817 313
482 iso_pu_bacteria 2881147464 2881152328 313
483 iso_pu_bacteria 2937848649 2937852733 313
484 iso_pu_bacteria 2958100919 2958101343 313
485 iso_pu_bacteria 2970489779 2970493561 313
486 iso_pu_bacteria 3000135777 3000137537 313
487 iso_pu_bacteria 3004268573 3004273037 313
488 iso_pu_bacteria 8004640170 8004644161 313

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07859

Abhydrolase_3

alpha/beta hydrolase fold

129

329

0.95

PF20434

BD-FAE

BD-FAE

115

228

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
3aim-assembly1.cif.gz_A r267e mutant of a hsl-like carboxylesterase from sulfolobus tokodaii 0.9357 31 308
2yh2-assembly1.cif.gz_D pyrobaculum calidifontis esterase monoclinic form 0.9251 28 302
3wj2-assembly1.cif.gz_A crystal structure of estfa (fe-lacking apo form) 0.9188 7 307
3aim-assembly1.cif.gz_A r267e mutant of a hsl-like carboxylesterase from sulfolobus tokodaii 0.9166 31 308
4ypv-assembly1.cif.gz_A high-resolution structure of a metagenome-derived esterase est8 0.9149 8 307
ID Description Score Start End Superfamily
3wj2A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9188 7 307 3.40.50.1820
4ypvA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9149 8 307 3.40.50.1820
3aikA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.913 31 305 3.40.50.1820
3wj2A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9129 7 307 3.40.50.1820
5jd4D00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9097 6 305 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A529LJV7-F1-model_v4 Alpha/beta hydrolase 0.9982 147 311 GO:0016787
AF-A0A435PE19-F1-model_v4 deleted 0.9853 151 311
AF-A0A528N730-F1-model_v4 Alpha/beta hydrolase 0.9843 65 217 GO:0034338
AF-A0A3S1S7U2-F1-model_v4 Alpha/beta hydrolase 0.9833 1 147 GO:0034338
AF-A0A529LJV7-F1-model_v4 Alpha/beta hydrolase 0.9804 147 311 GO:0016787

Feature Viewer

pLDDT pTM Quality
95.63 0.94 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map