F453728

General Info

Members Datasets Scaffolds Average Seq Length
489 301 978 291

Family's Representative Sequence

Representative Sequence 3300005262|Ga0065165_1013223|Ga0065165_10132232
Length 318
Sequence MPDRRNLTAWSDGYWWSNDGLRLHFRDYAGPEDRPAVLCFPGLTRNARDYEGLAQRLAGQWRVLLVEFRGRGESGYAKDPMSYVPLTYLQDVEALIEQAGLGQFVAVGTSLGGIVTMLLASTERERLVGAVLNDVGPELNPNGLARIRTYVGKPVWFPTWMHAARGVAEANGDVYPGYGIEDWLAMAKRLYRLNSAGRIVLDYDMKIAEPLRVPGNEAGPDMWAALDALSGKPVLVVRGARSDILAADAAERMVARLPGADLVTVPDVGHAPTLDEPEAVAGIEQLLGKVMKSPKKSPPLPKAKEEPAAGAQGRLLDL

Samples

Sample ID Description Type Environment
1 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
8 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
9 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
10 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
11 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
12 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
13 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
14 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
15 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
16 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
17 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
18 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
19 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
20 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
21 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
22 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
23 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
24 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
25 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
26 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
55 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
56 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
57 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
58 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
59 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
60 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
61 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
75 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
76 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
77 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
78 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
79 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
80 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
83 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
84 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
85 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
88 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
90 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
91 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
92 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
94 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
95 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
97 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
98 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
100 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
101 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
139 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
142 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
143 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
144 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
145 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
146 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
147 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
148 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
149 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
150 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
151 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
152 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
153 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
154 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
155 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
156 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
157 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
158 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
159 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
160 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
161 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
162 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
163 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
164 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
165 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
166 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
167 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
168 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
169 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
170 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
171 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
172 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
173 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
174 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
175 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
176 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
177 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
178 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
179 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
180 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
181 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
182 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
183 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
184 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
185 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
186 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
187 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
188 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
189 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
190 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
191 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
192 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
193 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
194 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
195 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
196 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
197 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
198 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
199 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
200 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
201 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
202 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
203 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
204 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
205 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
206 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
207 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
208 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
209 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
210 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
211 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
212 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
213 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
214 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
215 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
216 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
217 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
218 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
219 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
220 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
221 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
222 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
223 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
224 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
229 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
232 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
233 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
234 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
235 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
236 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
237 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
238 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
239 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
240 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
242 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
243 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
244 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
245 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
246 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
247 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
248 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
249 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
250 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
251 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
252 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
253 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
254 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
255 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
256 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
257 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
258 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
259 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
260 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
261 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
262 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
263 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
264 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
265 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
266 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
267 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
268 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
269 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
270 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere
271 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
272 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
273 2643221560 Sphingopyxis sp. Root1497 Isolate Unclassified
274 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
275 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
276 2643221622 Sphingomonas sp. Root241 Isolate Unclassified
277 2739367664 Novosphingobium sp. GV002 Isolate Unclassified
278 2739367865 Novosphingobium sp. GV013 Isolate Unclassified
279 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
280 2775507255 Sphingobium indicum B90A Isolate Rhizosphere
281 2808606401 Sphingobium sp. AEW010 Isolate Rhizosphere
282 2808606404 Sphingobium sp. AEW013 Isolate Rhizosphere
283 2808606405 Sphingobium sp. AEW001 Isolate Rhizosphere
284 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
285 2830075706 Sphingomonas jinjuensis DSM 21457 Isolate Rhizosphere
286 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere
287 2852680915 Sphingopyxis sp. JAI128 Isolate Rhizosphere
288 2879163058 Sphingomonas pokkalii L3B27 Isolate Rhizosphere
289 2880518877 Sphingobium sp. JAI105 Isolate Rhizosphere
290 2885429604 Sphingomonas sp. WZY 27 Isolate Rhizosphere
291 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified
292 2928027323 Sphingomonas sp. 1185 Isolate Unclassified
293 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
294 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
295 2946787523 Sphingomonas faeni W4I17 Isolate Rhizosphere
296 2984555340 Sphingomonas sp. SORGH_AS789 Isolate Aerial Root
297 2984564862 Sphingomonas sp. SORGH_AS870 Isolate Aerial Root
298 2990265787 Sphingomonas sp. SORGH_AS802 Isolate Aerial Root
299 2993356040 Sphingomonas sp. SORGH_AS742 Isolate Aerial Root
300 2993693658 Sphingomonas sp. SORGH_AS438 Isolate Aerial Root
301 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.46
Metatranscriptomes 0
Isolates 6.54

Biome Distribution

Category Percentage (%)
Aerial Root 1.02
Bulb 0
Endosphere 20.25
Nodule 0
Rhizoplane 3.48
Rhizosphere 64.42
Stem 0
Stem Tuber 0
Unclassified 0.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065165_1013223 3300005262 Bacteria 3298
2 JGI24741J21665_1001599 3300001915 Bacteria 6361
3 JGI24740J21852_10001016 3300001979 Bacteria 12545
4 JGI24739J22299_10003240 3300001989 Bacteria 6212
5 JGI24737J22298_10007353 3300001990 Bacteria 3722
6 JGI24735J21928_10001895 3300002067 Bacteria 7340
7 JGI25150J39212_1000213 3300002774 Bacteria 31530
8 JGI25165J46597_1000012 3300003214 Bacteria 421074
9 JGI25153J46596_10000016 3300003215 Bacteria 285917
10 JGI25153J46596_10000036 3300003215 Bacteria 182205
11 JGI25153J46596_10019190 3300003215 Bacteria 2626
12 rootL2_10073233 3300003322 Bacteria 1714
13 Ga0055525_1000035 3300003759 Bacteria 300887
14 Ga0055542_1000060 3300003762 Bacteria 162275
15 Ga0055529_1000043 3300003763 Bacteria 221704
16 Ga0055526_1000409 3300003771 Bacteria 34679
17 Ga0055537_1001711 3300003773 Bacteria 8110
18 Ga0055524_1000180 3300003775 Bacteria 71495
19 Ga0055536_1007858 3300003781 Bacteria 4698
20 Ga0055536_1013724 3300003781 Bacteria 2896
21 Ga0055534_1005916 3300003784 Bacteria 3178
22 Ga0055530_10001368 3300003791 Bacteria 18071
23 Ga0055530_10001487 3300003791 Bacteria 17016
24 Ga0055530_10002465 3300003791 Bacteria 11862
25 Ga0055530_10024347 3300003791 Bacteria 1718
26 Ga0055540_1001419 3300003792 Bacteria 14282
27 Ga0055531_10000161 3300003794 Bacteria 76455
28 Ga0055531_10004136 3300003794 Bacteria 8964
29 Ga0055531_10005830 3300003794 Bacteria 7123
30 Ga0065165_1001869 3300005262 Bacteria 20423
31 Ga0065165_1036037 3300005262 Bacteria 1513
32 Ga0065704_10003107 3300005289 Bacteria 5121
33 Ga0065704_10008828 3300005289 Bacteria 3322
34 Ga0065707_10097428 3300005295 Bacteria 3175
35 Ga0070658_10004796 3300005327 Bacteria 11006
36 Ga0070658_10071050 3300005327 Bacteria 2851
37 Ga0070670_100122766 3300005331 Bacteria 2241
38 Ga0070660_100059270 3300005339 Bacteria 2968
39 Ga0070660_100158547 3300005339 Bacteria 1822
40 Ga0070661_100075829 3300005344 Bacteria 2478
41 Ga0070668_100000034 3300005347 Bacteria 82494
42 Ga0070668_100001336 3300005347 Bacteria 17622
43 Ga0070668_100074579 3300005347 Bacteria 2647
44 Ga0070668_100153325 3300005347 Bacteria 1865
45 Ga0070669_100007849 3300005353 Bacteria 7627
46 Ga0070669_100016403 3300005353 Bacteria 5284
47 Ga0070675_100105737 3300005354 Bacteria 2375
48 Ga0070675_100227503 3300005354 Bacteria 1626
49 Ga0070675_100414224 3300005354 Bacteria 1204
50 Ga0070671_100000135 3300005355 Bacteria 47375
51 Ga0070671_100056233 3300005355 Bacteria 3274
52 Ga0070671_100210771 3300005355 Bacteria 1648
53 Ga0070674_100000171 3300005356 Bacteria 30183
54 Ga0070674_100005971 3300005356 Bacteria 7079
55 Ga0070674_100091746 3300005356 Bacteria 2194
56 Ga0070659_100071925 3300005366 Bacteria 2751
57 Ga0070659_100073734 3300005366 Bacteria 2717
58 Ga0070667_100000062 3300005367 Bacteria 143729
59 Ga0070663_100001785 3300005455 Bacteria 11967
60 Ga0070678_100008672 3300005456 Bacteria 6100
61 Ga0070662_100175187 3300005457 Bacteria 1687
62 Ga0068853_100025588 3300005539 Bacteria 4954
63 Ga0068853_100126482 3300005539 Bacteria 2283
64 Ga0070665_100000186 3300005548 Bacteria 110750
65 Ga0070665_100129458 3300005548 Bacteria 2526
66 Ga0070665_100148734 3300005548 Bacteria 2345
67 Ga0068855_100094729 3300005563 Bacteria 3442
68 Ga0068855_100106364 3300005563 Bacteria 3225
69 Ga0068855_100393071 3300005563 Bacteria 1521
70 Ga0070664_100038821 3300005564 Bacteria 4010
71 Ga0068857_100322231 3300005577 Bacteria 1427
72 Ga0068854_100137628 3300005578 Bacteria 1871
73 Ga0068856_100078600 3300005614 Bacteria 3271
74 Ga0068856_100078868 3300005614 Bacteria 3265
75 Ga0068852_100299991 3300005616 Bacteria 1555
76 Ga0068859_100034578 3300005617 Bacteria 5072
77 Ga0068859_100206155 3300005617 Bacteria 2051
78 Ga0068864_100000425 3300005618 Bacteria 36468
79 Ga0068861_100012369 3300005719 Bacteria 5951
80 Ga0068851_10020627 3300005834 Bacteria 3192
81 Ga0068851_10056412 3300005834 Bacteria 2003
82 Ga0068851_10163700 3300005834 Bacteria 1223
83 Ga0068863_100000020 3300005841 Bacteria 198519
84 Ga0068863_100000054 3300005841 Bacteria 124495
85 Ga0068858_100000583 3300005842 Bacteria 38259
86 Ga0068858_100005885 3300005842 Bacteria 11971
87 Ga0068860_100059211 3300005843 Bacteria 3642
88 Ga0068862_100031100 3300005844 Bacteria 4503
89 Ga0068862_100306894 3300005844 Bacteria 1461
90 Ga0081539_10114273 3300005985 Bacteria 1353
91 Ga0075368_10000299 3300006042 Bacteria 14296
92 Ga0075363_100010883 3300006048 Bacteria 4340
93 Ga0075362_10006792 3300006177 Bacteria 4280
94 Ga0075367_10000054 3300006178 Bacteria 27401
95 Ga0075369_10016719 3300006186 Bacteria 2964
96 Ga0075370_10071801 3300006353 Bacteria 1981
97 Ga0075429_100058702 3300006880 Bacteria 3351
98 Ga0097620_100034578 3300006931 Bacteria 5072
99 Ga0097620_100206152 3300006931 Bacteria 2051
100 Ga0105240_10004825 3300009093 Bacteria 20323
101 Ga0105245_10022875 3300009098 Bacteria 5484
102 Ga0114129_10103028 3300009147 Bacteria 3946
103 Ga0105243_10000082 3300009148 Bacteria 108252
104 Ga0105241_10002257 3300009174 Bacteria 14478
105 Ga0105241_10002409 3300009174 Bacteria 14050
106 Ga0105248_10064706 3300009177 Bacteria 4105
107 Ga0105248_10069413 3300009177 Bacteria 3957
108 Ga0105248_10100971 3300009177 Bacteria 3251
109 Ga0105237_10064114 3300009545 Bacteria 3671
110 Ga0105237_10211912 3300009545 Bacteria 1937
111 Ga0105237_10323768 3300009545 Bacteria 1545
112 Ga0105238_10076513 3300009551 Bacteria 3338
113 Ga0105238_10094365 3300009551 Bacteria 2980
114 Ga0105249_10008089 3300009553 Bacteria 9169
115 Ga0105148_100027 3300009978 Bacteria 21393
116 Ga0105239_10056462 3300010375 Bacteria 4307
117 Ga0157373_10083077 3300013100 Bacteria 2258
118 Ga0157371_10000030 3300013102 Bacteria 241585
119 Ga0157371_10040274 3300013102 Bacteria 3337
120 Ga0157370_10529932 3300013104 Bacteria 1081
121 Ga0157369_10223869 3300013105 Bacteria 1968
122 Ga0157374_10119131 3300013296 Bacteria 2546
123 Ga0157378_10322158 3300013297 Bacteria 1502
124 Ga0163162_10031283 3300013306 Bacteria 5278
125 Ga0163163_10295372 3300014325 Bacteria 1672
126 Ga0157380_10028757 3300014326 Bacteria 4242
127 Ga0163161_10015537 3300017792 Bacteria 5308
128 Ga0213872_10001033 3300021361 Bacteria 19398
129 Ga0209674_104180 3300025226 Bacteria 2411
130 Ga0209563_100047 3300025230 Bacteria 366620
131 Ga0207425_1000037 3300025245 Bacteria 224645
132 Ga0207425_1011771 3300025245 Bacteria 2072
133 Ga0209148_1000017 3300025254 Bacteria 787064
134 Ga0209129_1000363 3300025258 Bacteria 37614
135 Ga0209233_1000058 3300025261 Bacteria 421872
136 Ga0209565_1000012 3300025263 Bacteria 606500
137 Ga0209565_1000427 3300025263 Bacteria 34040
138 Ga0209455_1000005 3300025272 Bacteria 1416756
139 Ga0209673_1002832 3300025273 Bacteria 11149
140 Ga0209675_1000097 3300025291 Bacteria 131546
141 Ga0209676_1000060 3300025292 Bacteria 338238
142 Ga0209676_1000175 3300025292 Bacteria 153258
143 Ga0209676_1000298 3300025292 Bacteria 100554
144 Ga0209025_1000117 3300025294 Bacteria 215073
145 Ga0209025_1033286 3300025294 Bacteria 2385
146 Ga0209758_1000035 3300025297 Bacteria 448190
147 Ga0209758_1000103 3300025297 Bacteria 223968
148 Ga0209050_1000001 3300025298 Bacteria 3563507
149 Ga0209050_1000014 3300025298 Bacteria 774327
150 Ga0209050_1001389 3300025298 Bacteria 26337
151 Ga0209050_1002628 3300025298 Bacteria 14768
152 Ga0209050_1013680 3300025298 Bacteria 3578
153 Ga0209256_1000012 3300025299 Bacteria 790371
154 Ga0207426_1016065 3300025302 Bacteria 2698
155 Ga0209051_1000296 3300025303 Bacteria 79427
156 Ga0209257_1000019 3300025304 Bacteria 774261
157 Ga0209257_1000174 3300025304 Bacteria 165255
158 Ga0209257_1002738 3300025304 Bacteria 16712
159 Ga0209257_1007152 3300025304 Bacteria 6861
160 Ga0209257_1022060 3300025304 Bacteria 2285
161 Ga0207656_10027945 3300025321 Bacteria 2311
162 Ga0207647_10010060 3300025904 Bacteria 6691
163 Ga0207647_10017188 3300025904 Bacteria 4922
164 Ga0207705_10000163 3300025909 Bacteria 71674
165 Ga0207654_10000852 3300025911 Bacteria 16833
166 Ga0207654_10014870 3300025911 Bacteria 4029
167 Ga0207695_10003499 3300025913 Bacteria 22030
168 Ga0207695_10007334 3300025913 Bacteria 14080
169 Ga0207695_10069230 3300025913 Bacteria 3612
170 Ga0207671_10003706 3300025914 Bacteria 15059
171 Ga0207671_10013937 3300025914 Bacteria 6381
172 Ga0207657_10043876 3300025919 Bacteria 3935
173 Ga0207657_10127916 3300025919 Bacteria 2085
174 Ga0207649_10000199 3300025920 Bacteria 49941
175 Ga0207681_10144544 3300025923 Bacteria 1775
176 Ga0207681_10219763 3300025923 Bacteria 1469
177 Ga0207694_10049753 3300025924 Bacteria 3244
178 Ga0207694_10069396 3300025924 Bacteria 2753
179 Ga0207650_10044563 3300025925 Bacteria 3261
180 Ga0207650_10127169 3300025925 Bacteria 1990
181 Ga0207659_10404816 3300025926 Bacteria 1142
182 Ga0207687_10008492 3300025927 Bacteria 6714
183 Ga0207644_10000162 3300025931 Bacteria 48507
184 Ga0207690_10042487 3300025932 Bacteria 2986
185 Ga0207706_10042199 3300025933 Bacteria 4043
186 Ga0207706_10049344 3300025933 Bacteria 3720
187 Ga0207709_10000083 3300025935 Bacteria 163025
188 Ga0207669_10000071 3300025937 Bacteria 51781
189 Ga0207669_10006089 3300025937 Bacteria 5475
190 Ga0207711_10010157 3300025941 Bacteria 7817
191 Ga0207711_10065252 3300025941 Bacteria 3147
192 Ga0207711_10348315 3300025941 Bacteria 1371
193 Ga0207661_10448964 3300025944 Bacteria 1174
194 Ga0207679_10011396 3300025945 Bacteria 5756
195 Ga0207667_10000004 3300025949 Bacteria 737718
196 Ga0207667_10015604 3300025949 Bacteria 8618
197 Ga0207667_10085471 3300025949 Bacteria 3266
198 Ga0207712_10009153 3300025961 Bacteria 6267
199 Ga0207668_10000163 3300025972 Bacteria 46311
200 Ga0207668_10000924 3300025972 Bacteria 17639
201 Ga0207668_10002756 3300025972 Bacteria 10266
202 Ga0207668_10039017 3300025972 Bacteria 3193
203 Ga0207640_10027036 3300025981 Bacteria 3492
204 Ga0207658_10000039 3300025986 Bacteria 143707
205 Ga0207703_10000715 3300026035 Bacteria 32705
206 Ga0207703_10002552 3300026035 Bacteria 15728
207 Ga0207639_10000138 3300026041 Bacteria 54326
208 Ga0207639_10000414 3300026041 Bacteria 29581
209 Ga0207639_10000510 3300026041 Bacteria 26910
210 Ga0207639_10000631 3300026041 Bacteria 24265
211 Ga0207639_10005262 3300026041 Bacteria 8732
212 Ga0207639_10319584 3300026041 Bacteria 1378
213 Ga0207678_10002459 3300026067 Bacteria 16827
214 Ga0207678_10003700 3300026067 Bacteria 13745
215 Ga0207702_10003043 3300026078 Bacteria 15581
216 Ga0207702_10005770 3300026078 Bacteria 10768
217 Ga0207702_10104786 3300026078 Bacteria 2504
218 Ga0207641_10000001 3300026088 Bacteria 1180841
219 Ga0207641_10000095 3300026088 Bacteria 124498
220 Ga0207676_10001886 3300026095 Bacteria 15325
221 Ga0207674_10010631 3300026116 Bacteria 10407
222 Ga0207675_100021165 3300026118 Bacteria 6059
223 Ga0207675_100223153 3300026118 Bacteria 1816
224 Ga0207698_10001107 3300026142 Bacteria 15705
225 Ga0207698_10047114 3300026142 Bacteria 3262
226 Ga0209813_10000063 3300027866 Bacteria 43741
227 Ga0268266_10000002 3300028379 Bacteria 3059047
228 Ga0268266_10353055 3300028379 Bacteria 1382
229 Ga0268264_10005348 3300028381 Bacteria 10881
230 Ga0268264_10043149 3300028381 Bacteria 3736
231 Ga0307517_10026574 3300028786 Bacteria 7006
232 Ga0307513_10015055 3300031456 Bacteria 9388
233 Ga0307513_10097818 3300031456 Bacteria 2969
234 Ga0307509_10310936 3300031507 Bacteria 1318
235 Ga0307408_100014405 3300031548 Bacteria 5252
236 Ga0307508_10000479 3300031616 Bacteria 48265
237 Ga0307405_10009290 3300031731 Bacteria 5033
238 Ga0307405_10200823 3300031731 Bacteria 1448
239 Ga0307405_10221058 3300031731 Bacteria 1389
240 Ga0307413_10057315 3300031824 Bacteria 2382
241 Ga0307413_10079583 3300031824 Bacteria 2095
242 Ga0307413_10092406 3300031824 Bacteria 1975
243 Ga0307410_10044751 3300031852 Bacteria 2943
244 Ga0307410_10081574 3300031852 Bacteria 2272
245 Ga0307406_10100440 3300031901 Bacteria 1969
246 Ga0307406_10200761 3300031901 Bacteria 1467
247 Ga0307406_10217122 3300031901 Bacteria 1419
248 Ga0307412_10000247 3300031911 Bacteria 35011
249 Ga0307412_10000958 3300031911 Bacteria 16516
250 Ga0307412_10023257 3300031911 Bacteria 3810
251 Ga0307412_10052540 3300031911 Bacteria 2699
252 Ga0307409_100066548 3300031995 Bacteria 2842
253 Ga0307414_10000177 3300032004 Bacteria 43274
254 Ga0307414_10000402 3300032004 Bacteria 23465
255 Ga0307414_10064924 3300032004 Bacteria 2602
256 Ga0307414_10501204 3300032004 Bacteria 1074
257 Ga0307411_10139116 3300032005 Bacteria 1788
258 Ga0307510_10009662 3300033180 Bacteria 11493
259 Ga0307510_10036939 3300033180 Bacteria 5430
260 Ga0395899_0058419 3300037312 Bacteria 2845
261 Ga0395901_0088772 3300038443 Bacteria 3234
262 Ga0395901_0124648 3300038443 Bacteria 2707
263 Ga0436360_0717004 3300039438 Unclassified 1183
264 Ga0436361_0050556 3300039447 Bacteria 3128
265 Ga0436361_0794380 3300039447 Bacteria 20936
266 Ga0439436_0024781 3300041404 Bacteria 1768
267 Ga0439461_0001007 3300041410 Bacteria 4235
268 Ga0439465_0004377 3300041413 Bacteria 4570
269 Ga0451800_1337823 3300041459 Bacteria 976
270 Ga0451807_0805410 3300041486 Bacteria 1498
271 Ga0439431_0004112 3300041997 Bacteria 3201
272 Ga0439431_0007752 3300041997 Bacteria 2398
273 Ga0439442_013518 3300042002 Bacteria 1674
274 Ga0439445_0004806 3300042004 Bacteria 3065
275 Ga0439457_006077 3300042014 Bacteria 2981
276 Ga0439462_0005961 3300042015 Bacteria 3019
277 Ga0439434_0011910 3300042435 Bacteria 2570
278 Ga0466968_0139765 3300044735 Bacteria 1107
279 Ga0495617_022657 3300046452 Bacteria 2124
280 Ga0495627_000193 3300046453 Bacteria 67253
281 Ga0495627_000478 3300046453 Bacteria 33914
282 Ga0495638_0000021 3300046460 Bacteria 365602
283 Ga0495638_0000350 3300046460 Bacteria 57915
284 Ga0495638_0090518 3300046460 Bacteria 1844
285 Ga0495650_0000373 3300046471 Bacteria 78223
286 Ga0495650_0002647 3300046471 Bacteria 13986
287 Ga0495585_0001259 3300046492 Bacteria 20359
288 Ga0495583_0000143 3300046506 Bacteria 121364
289 Ga0495583_0001602 3300046506 Bacteria 22224
290 Ga0495583_0013051 3300046506 Bacteria 4662
291 Ga0495583_0050529 3300046506 Bacteria 1899
292 Ga0495606_0000591 3300046507 Bacteria 57426
293 Ga0495610_0001092 3300046512 Bacteria 24761
294 Ga0495616_0000018 3300046513 Bacteria 167281
295 Ga0495632_0000042 3300046519 Bacteria 145186
296 Ga0495632_0001405 3300046519 Bacteria 20171
297 Ga0495637_0000626 3300046520 Bacteria 24967
298 Ga0495643_0000005 3300046522 Bacteria 443135
299 Ga0495643_0008338 3300046522 Bacteria 6573
300 Ga0495643_0024998 3300046522 Bacteria 3383
301 Ga0495643_0038986 3300046522 Bacteria 2599
302 Ga0495643_0055662 3300046522 Bacteria 2114
303 Ga0495643_0115908 3300046522 Bacteria 1357
304 Ga0495648_0000071 3300046524 Bacteria 133473
305 Ga0495648_0000115 3300046524 Bacteria 98656
306 Ga0495648_0011981 3300046524 Bacteria 6498
307 Ga0495648_0034351 3300046524 Bacteria 3300
308 Ga0495648_0045407 3300046524 Bacteria 2733
309 Ga0495648_0099324 3300046524 Bacteria 1610
310 Ga0495648_0131193 3300046524 Bacteria 1332
311 Ga0495663_0000015 3300046525 Bacteria 145185
312 Ga0495663_0057350 3300046525 Bacteria 1218
313 Ga0495666_0087396 3300046526 Bacteria 1473
314 Ga0495622_0004489 3300046557 Bacteria 6467
315 Ga0495633_0000197 3300046558 Bacteria 76903
316 Ga0495633_0000262 3300046558 Bacteria 62524
317 Ga0495633_0002089 3300046558 Bacteria 14358
318 Ga0495633_0002581 3300046558 Bacteria 12683
319 Ga0495668_0000001 3300046616 Bacteria 1013420
320 Ga0495668_0000007 3300046616 Bacteria 552902
321 Ga0495668_0018406 3300046616 Bacteria 4036
322 Ga0495611_0010003 3300046648 Bacteria 4013
323 Ga0495625_0000390 3300046660 Bacteria 66951
324 Ga0495625_0000503 3300046660 Bacteria 58118
325 Ga0495625_0001297 3300046660 Bacteria 31374
326 Ga0495625_0003168 3300046660 Bacteria 16742
327 Ga0495625_0005011 3300046660 Bacteria 12284
328 Ga0495625_0134298 3300046660 Bacteria 1674
329 Ga0495625_0145317 3300046660 Bacteria 1597
330 Ga0495669_0000268 3300046684 Bacteria 29882
331 Ga0495670_0000066 3300046691 Bacteria 46500
332 Ga0495670_0130809 3300046691 Bacteria 1308
333 Ga0495671_0000007 3300046692 Bacteria 443069
334 Ga0495671_0000046 3300046692 Bacteria 157975
335 Ga0495671_0007536 3300046692 Bacteria 6196
336 Ga0495649_0012633 3300046694 Bacteria 4901
337 Ga0495600_0004421 3300046809 Bacteria 8408
338 Ga0495683_0006685 3300047323 Bacteria 6283
339 Ga0495687_000044 3300047443 Bacteria 215400
340 Ga0495687_000055 3300047443 Bacteria 194477
341 Ga0495677_0023603 3300047445 Bacteria 2232
342 Ga0495677_0050943 3300047445 Bacteria 1524
343 Ga0495673_0000066 3300047469 Bacteria 221478
344 Ga0495681_0000032 3300047470 Bacteria 127415
345 Ga0495681_0002596 3300047470 Bacteria 12823
346 Ga0495681_0011440 3300047470 Bacteria 5285
347 Ga0495681_0074113 3300047470 Bacteria 1535
348 Ga0495686_0001453 3300047472 Bacteria 25811
349 Ga0495686_0022900 3300047472 Bacteria 4127
350 Ga0495686_0091502 3300047472 Bacteria 1846
351 Ga0495686_0152824 3300047472 Bacteria 1354
352 Ga0496102_0006661 3300048905 Bacteria 9874
353 Ga0496103_0000151 3300048906 Bacteria 72539
354 Ga0496104_0017788 3300048907 Bacteria 6481
355 Ga0496105_0002067 3300048908 Bacteria 14517
356 Ga0496108_0002067 3300048911 Bacteria 16059
357 Ga0496108_0026301 3300048911 Bacteria 4799
358 Ga0496109_0027708 3300048912 Bacteria 5062
359 Ga0496110_0053058 3300048913 Bacteria 3563
360 Ga0496111_0263986 3300048914 Bacteria 1277
361 Ga0496113_0004996 3300048916 Bacteria 8221
362 Ga0496114_0035635 3300048917 Bacteria 4109
363 Ga0496115_0000018 3300048918 Bacteria 182523
364 Ga0496115_0005756 3300048918 Bacteria 9026
365 Ga0496116_0010565 3300048919 Bacteria 7721
366 Ga0496116_0038657 3300048919 Bacteria 3310
367 Ga0496116_0040418 3300048919 Bacteria 3212
368 Ga0496117_0000408 3300048920 Bacteria 72369
369 Ga0496117_0037057 3300048920 Bacteria 3638
370 Ga0496117_0128431 3300048920 Bacteria 1542
371 Ga0496118_0000600 3300048921 Bacteria 59661
372 Ga0496118_0001927 3300048921 Bacteria 29427
373 Ga0496119_0029228 3300048922 Bacteria 3743
374 Ga0496120_0042730 3300048923 Bacteria 2645
375 Ga0496121_0000208 3300048924 Bacteria 129753
376 Ga0496121_0000237 3300048924 Bacteria 118615
377 Ga0496121_0001774 3300048924 Bacteria 35047
378 Ga0496121_0037492 3300048924 Bacteria 4305
379 Ga0496121_0138315 3300048924 Bacteria 1811
380 Ga0496121_0248036 3300048924 Bacteria 1236
381 Ga0496122_0029719 3300048925 Bacteria 4599
382 Ga0496122_0065696 3300048925 Bacteria 2628
383 Ga0496122_0072518 3300048925 Bacteria 2448
384 Ga0496123_0014667 3300048926 Bacteria 6477
385 Ga0496123_0123405 3300048926 Bacteria 1451
386 Ga0496124_0000099 3300048927 Bacteria 182007
387 Ga0496124_0000186 3300048927 Bacteria 123307
388 Ga0496124_0012427 3300048927 Bacteria 8406
389 Ga0496124_0013584 3300048927 Bacteria 7940
390 Ga0496124_0058874 3300048927 Bacteria 3229
391 Ga0496124_0218929 3300048927 Bacteria 1433
392 Ga0496125_0001436 3300048928 Bacteria 34724
393 Ga0496125_0052446 3300048928 Bacteria 3354
394 Ga0496125_0058345 3300048928 Bacteria 3118
395 Ga0496125_0061849 3300048928 Bacteria 3000
396 Ga0496126_0000507 3300048929 Bacteria 76510
397 Ga0496126_0051333 3300048929 Bacteria 3754
398 Ga0496126_0201957 3300048929 Bacteria 1678
399 Ga0501031_0030695 3300049568 Bacteria 3506
400 Ga0501032_0072434 3300049569 Bacteria 2296
401 Ga0501033_0038196 3300049570 Bacteria 3591
402 Ga0501033_0198214 3300049570 Bacteria 1435
403 Ga0501034_0027308 3300049571 Bacteria 5807
404 Ga0501034_0119959 3300049571 Bacteria 2616
405 Ga0501036_0089051 3300049572 Bacteria 2607
406 Ga0501037_0007067 3300049573 Bacteria 8202
407 Ga0501047_0035738 3300049581 Bacteria 4800
408 Ga0501069_0093507 3300049585 Bacteria 1701
409 Ga0501223_000004 3300049663 Bacteria 141027
410 Ga0501223_001007 3300049663 Bacteria 6654
411 Ga0501224_000001 3300049664 Bacteria 308131
412 Ga0501233_000100 3300049668 Bacteria 11484
413 Ga0501235_002500 3300049669 Bacteria 3962
414 Ga0501246_000475 3300049676 Bacteria 2917
415 Ga0501225_0000003 3300049705 Bacteria 141070
416 Ga0501225_0000185 3300049705 Bacteria 19439
417 Ga0501225_0002828 3300049705 Bacteria 5332
418 Ga0501234_000756 3300049707 Bacteria 5013
419 Ga0501241_001451 3300049758 Bacteria 4818
420 Ga0501044_0031887 3300049823 Bacteria 5542
421 Ga0501226_000043 3300049853 Bacteria 58106
422 nmdc:mga03683_64761_c1 3300050489 Bacteria 1552
423 nmdc:mga03n38_24081_c1 3300050490 Bacteria 2485
424 nmdc:mga06z11_27_c1 3300050494 Bacteria 64010
425 nmdc:mga04h51_147_c1 3300050495 Bacteria 20575
426 nmdc:mga07m45_306781_c1 3300050496 Bacteria 923
427 nmdc:mga07m45_44560_c1 3300050496 Bacteria 2490
428 nmdc:mga05p37_90313_c1 3300050507 Bacteria 3775
429 nmdc:mga0sz30_4297_c1 3300050516 Bacteria 5140
430 Ga0500610_0000107 3300053079 Bacteria 25089
431 Ga0500643_000081 3300053087 Bacteria 101681
432 Ga0500643_004504 3300053087 Bacteria 6273
433 Ga0500643_023414 3300053087 Bacteria 1973
434 Ga0500583_0134785 3300053092 Bacteria 1226
435 Ga0500566_0020724 3300053094 Bacteria 3866
436 Ga0500641_0014498 3300053096 Bacteria 2910
437 Ga0500595_000618 3300053119 Bacteria 21260
438 Ga0500608_000363 3300053122 Bacteria 17531
439 Ga0500642_0000116 3300053130 Bacteria 37194
440 Ga0500658_0000581 3300053134 Bacteria 15401
441 Ga0500658_0002030 3300053134 Bacteria 7899
442 Ga0500559_0056573 3300053136 Bacteria 1741
443 Ga0500568_0004250 3300053139 Bacteria 7699
444 Ga0500568_0080238 3300053139 Bacteria 1239
445 Ga0500573_0000046 3300053140 Bacteria 98723
446 Ga0500573_0089291 3300053140 Bacteria 1743
447 Ga0500604_0004967 3300053151 Bacteria 3522
448 Ga0500604_0009817 3300053151 Bacteria 2552
449 Ga0500616_0066878 3300053153 Bacteria 1844
450 Ga0500622_0083631 3300053156 Bacteria 1594
451 Ga0500624_000053 3300053157 Bacteria 74086
452 Ga0500627_0000054 3300053158 Bacteria 55229
453 Ga0500567_000369 3300053723 Bacteria 14834
454 Ga0500625_000019 3300053729 Bacteria 93445
455 Ga0500645_000009 3300053730 Bacteria 206177
456 Ga0500645_012547 3300053730 Bacteria 2737
457 Ga0500596_002336 3300053735 Bacteria 3753
458 2512644712 2512564014 Bacteria 4639632
459 2600200731 2599185354 Bacteria 4398675
460 2600226595 2599185359 Bacteria 4772316
461 2643822903 2643221560 Bacteria 4801179
462 2643832491 2643221563 Bacteria 4726935
463 2644053714 2643221608 Bacteria 4724829
464 2644126953 2643221622 Bacteria 4212502
465 2739649226 2739367664 Bacteria 4114334
466 2740027699 2739367865 Bacteria 4114482
467 2753765131 2751185897 Bacteria 5322941
468 2778123879 2775507255 Bacteria 3945731
469 2809062197 2808606401 Bacteria 4586670
470 2809078463 2808606404 Bacteria 4652788
471 2809082586 2808606405 Bacteria 4586632
472 2819713105 2818991466 Bacteria 4748179
473 2830077135 2830075706 Bacteria 3855215
474 2852654836 2852653556 Bacteria 4050083
475 2852681641 2852680915 Bacteria 4100189
476 2879164490 2879163058 Bacteria 4223965
477 2880518996 2880518877 Bacteria 5012590
478 2885430070 2885429604 Bacteria 3642894
479 2919711692 2919709256 Bacteria 4318106
480 2928029588 2928027323 Bacteria 4382488
481 2928527646 2928526807 Bacteria 4760224
482 2928971722 2928968154 Bacteria 4633371
483 2946788263 2946787523 Bacteria 4366789
484 2984557515 2984555340 Bacteria 4247089
485 2984568121 2984564862 Bacteria 4339992
486 2990266502 2990265787 Bacteria 3943888
487 2993359167 2993356040 Bacteria 4247105
488 2993695700 2993693658 Bacteria 4040749
489 8057101616 8057101203 Bacteria 5034064
490 Ga0065165_1013223
491 JGI24741J21665_1001599
492 JGI24740J21852_10001016
493 JGI24739J22299_10003240
494 JGI24737J22298_10007353
495 JGI24735J21928_10001895
496 JGI25150J39212_1000213
497 JGI25165J46597_1000012
498 JGI25153J46596_10000016
499 JGI25153J46596_10000036
500 JGI25153J46596_10019190
501 rootL2_10073233
502 Ga0055525_1000035
503 Ga0055542_1000060
504 Ga0055529_1000043
505 Ga0055526_1000409
506 Ga0055537_1001711
507 Ga0055524_1000180
508 Ga0055536_1007858
509 Ga0055536_1013724
510 Ga0055534_1005916
511 Ga0055530_10001368
512 Ga0055530_10001487
513 Ga0055530_10002465
514 Ga0055530_10024347
515 Ga0055540_1001419
516 Ga0055531_10000161
517 Ga0055531_10004136
518 Ga0055531_10005830
519 Ga0065165_1001869
520 Ga0065165_1036037
521 Ga0065704_10003107
522 Ga0065704_10008828
523 Ga0065707_10097428
524 Ga0070658_10004796
525 Ga0070658_10071050
526 Ga0070670_100122766
527 Ga0070660_100059270
528 Ga0070660_100158547
529 Ga0070661_100075829
530 Ga0070668_100000034
531 Ga0070668_100001336
532 Ga0070668_100074579
533 Ga0070668_100153325
534 Ga0070669_100007849
535 Ga0070669_100016403
536 Ga0070675_100105737
537 Ga0070675_100227503
538 Ga0070675_100414224
539 Ga0070671_100000135
540 Ga0070671_100056233
541 Ga0070671_100210771
542 Ga0070674_100000171
543 Ga0070674_100005971
544 Ga0070674_100091746
545 Ga0070659_100071925
546 Ga0070659_100073734
547 Ga0070667_100000062
548 Ga0070663_100001785
549 Ga0070678_100008672
550 Ga0070662_100175187
551 Ga0068853_100025588
552 Ga0068853_100126482
553 Ga0070665_100000186
554 Ga0070665_100129458
555 Ga0070665_100148734
556 Ga0068855_100094729
557 Ga0068855_100106364
558 Ga0068855_100393071
559 Ga0070664_100038821
560 Ga0068857_100322231
561 Ga0068854_100137628
562 Ga0068856_100078600
563 Ga0068856_100078868
564 Ga0068852_100299991
565 Ga0068859_100034578
566 Ga0068859_100206155
567 Ga0068864_100000425
568 Ga0068861_100012369
569 Ga0068851_10020627
570 Ga0068851_10056412
571 Ga0068851_10163700
572 Ga0068863_100000020
573 Ga0068863_100000054
574 Ga0068858_100000583
575 Ga0068858_100005885
576 Ga0068860_100059211
577 Ga0068862_100031100
578 Ga0068862_100306894
579 Ga0081539_10114273
580 Ga0075368_10000299
581 Ga0075363_100010883
582 Ga0075362_10006792
583 Ga0075367_10000054
584 Ga0075369_10016719
585 Ga0075370_10071801
586 Ga0075429_100058702
587 Ga0097620_100034578
588 Ga0097620_100206152
589 Ga0105240_10004825
590 Ga0105245_10022875
591 Ga0114129_10103028
592 Ga0105243_10000082
593 Ga0105241_10002257
594 Ga0105241_10002409
595 Ga0105248_10064706
596 Ga0105248_10069413
597 Ga0105248_10100971
598 Ga0105237_10064114
599 Ga0105237_10211912
600 Ga0105237_10323768
601 Ga0105238_10076513
602 Ga0105238_10094365
603 Ga0105249_10008089
604 Ga0105148_100027
605 Ga0105239_10056462
606 Ga0157373_10083077
607 Ga0157371_10000030
608 Ga0157371_10040274
609 Ga0157370_10529932
610 Ga0157369_10223869
611 Ga0157374_10119131
612 Ga0157378_10322158
613 Ga0163162_10031283
614 Ga0163163_10295372
615 Ga0157380_10028757
616 Ga0163161_10015537
617 Ga0213872_10001033
618 Ga0209674_104180
619 Ga0209563_100047
620 Ga0207425_1000037
621 Ga0207425_1011771
622 Ga0209148_1000017
623 Ga0209129_1000363
624 Ga0209233_1000058
625 Ga0209565_1000012
626 Ga0209565_1000427
627 Ga0209455_1000005
628 Ga0209673_1002832
629 Ga0209675_1000097
630 Ga0209676_1000060
631 Ga0209676_1000175
632 Ga0209676_1000298
633 Ga0209025_1000117
634 Ga0209025_1033286
635 Ga0209758_1000035
636 Ga0209758_1000103
637 Ga0209050_1000001
638 Ga0209050_1000014
639 Ga0209050_1001389
640 Ga0209050_1002628
641 Ga0209050_1013680
642 Ga0209256_1000012
643 Ga0207426_1016065
644 Ga0209051_1000296
645 Ga0209257_1000019
646 Ga0209257_1000174
647 Ga0209257_1002738
648 Ga0209257_1007152
649 Ga0209257_1022060
650 Ga0207656_10027945
651 Ga0207647_10010060
652 Ga0207647_10017188
653 Ga0207705_10000163
654 Ga0207654_10000852
655 Ga0207654_10014870
656 Ga0207695_10003499
657 Ga0207695_10007334
658 Ga0207695_10069230
659 Ga0207671_10003706
660 Ga0207671_10013937
661 Ga0207657_10043876
662 Ga0207657_10127916
663 Ga0207649_10000199
664 Ga0207681_10144544
665 Ga0207681_10219763
666 Ga0207694_10049753
667 Ga0207694_10069396
668 Ga0207650_10044563
669 Ga0207650_10127169
670 Ga0207659_10404816
671 Ga0207687_10008492
672 Ga0207644_10000162
673 Ga0207690_10042487
674 Ga0207706_10042199
675 Ga0207706_10049344
676 Ga0207709_10000083
677 Ga0207669_10000071
678 Ga0207669_10006089
679 Ga0207711_10010157
680 Ga0207711_10065252
681 Ga0207711_10348315
682 Ga0207661_10448964
683 Ga0207679_10011396
684 Ga0207667_10000004
685 Ga0207667_10015604
686 Ga0207667_10085471
687 Ga0207712_10009153
688 Ga0207668_10000163
689 Ga0207668_10000924
690 Ga0207668_10002756
691 Ga0207668_10039017
692 Ga0207640_10027036
693 Ga0207658_10000039
694 Ga0207703_10000715
695 Ga0207703_10002552
696 Ga0207639_10000138
697 Ga0207639_10000414
698 Ga0207639_10000510
699 Ga0207639_10000631
700 Ga0207639_10005262
701 Ga0207639_10319584
702 Ga0207678_10002459
703 Ga0207678_10003700
704 Ga0207702_10003043
705 Ga0207702_10005770
706 Ga0207702_10104786
707 Ga0207641_10000001
708 Ga0207641_10000095
709 Ga0207676_10001886
710 Ga0207674_10010631
711 Ga0207675_100021165
712 Ga0207675_100223153
713 Ga0207698_10001107
714 Ga0207698_10047114
715 Ga0209813_10000063
716 Ga0268266_10000002
717 Ga0268266_10353055
718 Ga0268264_10005348
719 Ga0268264_10043149
720 Ga0307517_10026574
721 Ga0307513_10015055
722 Ga0307513_10097818
723 Ga0307509_10310936
724 Ga0307408_100014405
725 Ga0307508_10000479
726 Ga0307405_10009290
727 Ga0307405_10200823
728 Ga0307405_10221058
729 Ga0307413_10057315
730 Ga0307413_10079583
731 Ga0307413_10092406
732 Ga0307410_10044751
733 Ga0307410_10081574
734 Ga0307406_10100440
735 Ga0307406_10200761
736 Ga0307406_10217122
737 Ga0307412_10000247
738 Ga0307412_10000958
739 Ga0307412_10023257
740 Ga0307412_10052540
741 Ga0307409_100066548
742 Ga0307414_10000177
743 Ga0307414_10000402
744 Ga0307414_10064924
745 Ga0307414_10501204
746 Ga0307411_10139116
747 Ga0307510_10009662
748 Ga0307510_10036939
749 Ga0395899_0058419
750 Ga0395901_0088772
751 Ga0395901_0124648
752 Ga0436360_0717004
753 Ga0436361_0050556
754 Ga0436361_0794380
755 Ga0439436_0024781
756 Ga0439461_0001007
757 Ga0439465_0004377
758 Ga0451800_1337823
759 Ga0451807_0805410
760 Ga0439431_0004112
761 Ga0439431_0007752
762 Ga0439442_013518
763 Ga0439445_0004806
764 Ga0439457_006077
765 Ga0439462_0005961
766 Ga0439434_0011910
767 Ga0466968_0139765
768 Ga0495617_022657
769 Ga0495627_000193
770 Ga0495627_000478
771 Ga0495638_0000021
772 Ga0495638_0000350
773 Ga0495638_0090518
774 Ga0495650_0000373
775 Ga0495650_0002647
776 Ga0495585_0001259
777 Ga0495583_0000143
778 Ga0495583_0001602
779 Ga0495583_0013051
780 Ga0495583_0050529
781 Ga0495606_0000591
782 Ga0495610_0001092
783 Ga0495616_0000018
784 Ga0495632_0000042
785 Ga0495632_0001405
786 Ga0495637_0000626
787 Ga0495643_0000005
788 Ga0495643_0008338
789 Ga0495643_0024998
790 Ga0495643_0038986
791 Ga0495643_0055662
792 Ga0495643_0115908
793 Ga0495648_0000071
794 Ga0495648_0000115
795 Ga0495648_0011981
796 Ga0495648_0034351
797 Ga0495648_0045407
798 Ga0495648_0099324
799 Ga0495648_0131193
800 Ga0495663_0000015
801 Ga0495663_0057350
802 Ga0495666_0087396
803 Ga0495622_0004489
804 Ga0495633_0000197
805 Ga0495633_0000262
806 Ga0495633_0002089
807 Ga0495633_0002581
808 Ga0495668_0000001
809 Ga0495668_0000007
810 Ga0495668_0018406
811 Ga0495611_0010003
812 Ga0495625_0000390
813 Ga0495625_0000503
814 Ga0495625_0001297
815 Ga0495625_0003168
816 Ga0495625_0005011
817 Ga0495625_0134298
818 Ga0495625_0145317
819 Ga0495669_0000268
820 Ga0495670_0000066
821 Ga0495670_0130809
822 Ga0495671_0000007
823 Ga0495671_0000046
824 Ga0495671_0007536
825 Ga0495649_0012633
826 Ga0495600_0004421
827 Ga0495683_0006685
828 Ga0495687_000044
829 Ga0495687_000055
830 Ga0495677_0023603
831 Ga0495677_0050943
832 Ga0495673_0000066
833 Ga0495681_0000032
834 Ga0495681_0002596
835 Ga0495681_0011440
836 Ga0495681_0074113
837 Ga0495686_0001453
838 Ga0495686_0022900
839 Ga0495686_0091502
840 Ga0495686_0152824
841 Ga0496102_0006661
842 Ga0496103_0000151
843 Ga0496104_0017788
844 Ga0496105_0002067
845 Ga0496108_0002067
846 Ga0496108_0026301
847 Ga0496109_0027708
848 Ga0496110_0053058
849 Ga0496111_0263986
850 Ga0496113_0004996
851 Ga0496114_0035635
852 Ga0496115_0000018
853 Ga0496115_0005756
854 Ga0496116_0010565
855 Ga0496116_0038657
856 Ga0496116_0040418
857 Ga0496117_0000408
858 Ga0496117_0037057
859 Ga0496117_0128431
860 Ga0496118_0000600
861 Ga0496118_0001927
862 Ga0496119_0029228
863 Ga0496120_0042730
864 Ga0496121_0000208
865 Ga0496121_0000237
866 Ga0496121_0001774
867 Ga0496121_0037492
868 Ga0496121_0138315
869 Ga0496121_0248036
870 Ga0496122_0029719
871 Ga0496122_0065696
872 Ga0496122_0072518
873 Ga0496123_0014667
874 Ga0496123_0123405
875 Ga0496124_0000099
876 Ga0496124_0000186
877 Ga0496124_0012427
878 Ga0496124_0013584
879 Ga0496124_0058874
880 Ga0496124_0218929
881 Ga0496125_0001436
882 Ga0496125_0052446
883 Ga0496125_0058345
884 Ga0496125_0061849
885 Ga0496126_0000507
886 Ga0496126_0051333
887 Ga0496126_0201957
888 Ga0501031_0030695
889 Ga0501032_0072434
890 Ga0501033_0038196
891 Ga0501033_0198214
892 Ga0501034_0027308
893 Ga0501034_0119959
894 Ga0501036_0089051
895 Ga0501037_0007067
896 Ga0501047_0035738
897 Ga0501069_0093507
898 Ga0501223_000004
899 Ga0501223_001007
900 Ga0501224_000001
901 Ga0501233_000100
902 Ga0501235_002500
903 Ga0501246_000475
904 Ga0501225_0000003
905 Ga0501225_0000185
906 Ga0501225_0002828
907 Ga0501234_000756
908 Ga0501241_001451
909 Ga0501044_0031887
910 Ga0501226_000043
911 nmdc:mga03683_64761_c1
912 nmdc:mga03n38_24081_c1
913 nmdc:mga06z11_27_c1
914 nmdc:mga04h51_147_c1
915 nmdc:mga07m45_306781_c1
916 nmdc:mga07m45_44560_c1
917 nmdc:mga05p37_90313_c1
918 nmdc:mga0sz30_4297_c1
919 Ga0500610_0000107
920 Ga0500643_000081
921 Ga0500643_004504
922 Ga0500643_023414
923 Ga0500583_0134785
924 Ga0500566_0020724
925 Ga0500641_0014498
926 Ga0500595_000618
927 Ga0500608_000363
928 Ga0500642_0000116
929 Ga0500658_0000581
930 Ga0500658_0002030
931 Ga0500559_0056573
932 Ga0500568_0004250
933 Ga0500568_0080238
934 Ga0500573_0000046
935 Ga0500573_0089291
936 Ga0500604_0004967
937 Ga0500604_0009817
938 Ga0500616_0066878
939 Ga0500622_0083631
940 Ga0500624_000053
941 Ga0500627_0000054
942 Ga0500567_000369
943 Ga0500625_000019
944 Ga0500645_000009
945 Ga0500645_012547
946 Ga0500596_002336
947 2512644712
948 2600200731
949 2600226595
950 2643822903
951 2643832491
952 2644053714
953 2644126953
954 2739649226
955 2740027699
956 2753765131
957 2778123879
958 2809062197
959 2809078463
960 2809082586
961 2819713105
962 2830077135
963 2852654836
964 2852681641
965 2879164490
966 2880518996
967 2885430070
968 2919711692
969 2928029588
970 2928527646
971 2928971722
972 2946788263
973 2984557515
974 2984568121
975 2990266502
976 2993359167
977 2993695700
978 8057101616

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00561

Abhydrolase_1

alpha/beta hydrolase fold

35

277

0.81

PF12146

Hydrolase_4

Serine aminopeptidase, S33

31

180

0.8

PF12697

Abhydrolase_6

Alpha/beta hydrolase family

37

283

0.65

Structural Annotation

Top 5 Hits

ID Description Score Start End
3bwx-assembly1.cif.gz_A crystal structure of an alpha/beta hydrolase (yp_496220.1) from novosphingobium aromaticivorans dsm 12444 at 1.50 a resolution 0.9632 1 285
3bwx-assembly1.cif.gz_A crystal structure of an alpha/beta hydrolase (yp_496220.1) from novosphingobium aromaticivorans dsm 12444 at 1.50 a resolution 0.9533 1 285
8b6o-assembly1.cif.gz_A x-ray structure of the haloalkane dehalogenase halotag7 circular permutated at positions 141-156 (cphalotagdelta) fused to m13 0.9248 4 127
8b6n-assembly1.cif.gz_A x-ray structure of the haloalkane dehalogenase halotag7 circular permutated at positions 141-156 (cphalotagdelta) 0.91 1 127
8b6p-assembly1.cif.gz_A x-ray structure of the haloalkane dehalogenase halotag7 circular permutated at positions 154-156 (cphalotag7_154-156) 0.9093 1 127
ID Description Score Start End Superfamily
3bwxA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9555 1 285 3.40.50.1820
3bwxA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9487 1 285 3.40.50.1820
af_Q54CU1_1_267_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9045 19 122 3.40.50.1820
af_Q9NQF3_11_190_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8943 5 122 3.40.50.1820
4oseB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8779 3 285 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A3D2E6D3-F1-model_v4 deleted 0.9619 2 286
AF-A0A317DZK5-F1-model_v4 Alpha/beta hydrolase 0.9554 1 286 GO:0016020
GO:0016787
AF-A0A251X4B7-F1-model_v4 Alpha/beta hydrolase 0.9536 11 285 GO:0016787
AF-A0A317FCJ3-F1-model_v4 Alpha/beta hydrolase 0.953 2 284 GO:0016020
GO:0016787
AF-A0A2W4MFK7-F1-model_v4 Alpha/beta hydrolase 0.9528 1 286 GO:0016787

Map