F453753

General Info

Members Datasets Scaffolds Average Seq Length
489 357 978 215

Family's Representative Sequence

Representative Sequence 3300006186|Ga0075369_10031118|Ga0075369_100311182
Length 224
Sequence MSDDPETARQIEELAADNRPLLVLDVDDVVLEFIRPFPHFLKSRGFALTLASFRLTGNIAETASGRLIEQAEVTALLGEFFDAQAEWQSVTDGAAQALATLGGRAEIVLLTAMPHKHRAVRRAHLDALGLTYPLLTTEMAKGPAVAKLRGNKGRPVAFVDDQPHNLVSVRSSVADAHLFHLMADNSLRAFLPPVPDGIVTVENWHDAAPKIVTTLGLEAIPGKP

Samples

Sample ID Description Type Environment
1 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
2 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
3 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
4 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
5 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
6 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
13 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
14 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
15 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
16 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
17 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
18 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
19 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
20 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
21 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
22 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
23 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
24 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
25 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
26 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
27 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
28 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
29 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
30 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
31 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
32 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
33 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
34 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
35 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
36 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
37 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
38 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
39 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
40 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
41 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
42 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
43 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
44 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
45 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
46 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
47 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
48 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
65 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
66 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
67 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
68 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
69 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
70 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
71 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
72 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
73 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
74 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
75 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
76 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
77 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
78 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
79 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
80 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
81 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
82 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
83 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
84 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
85 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
86 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
87 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
88 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
89 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
90 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
91 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
92 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
93 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
94 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
95 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
96 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
97 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
98 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
99 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
100 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
101 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
102 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
103 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
104 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
105 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
106 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
107 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
108 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
109 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
110 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
111 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
112 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
113 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
114 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
115 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
116 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
117 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
118 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
119 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
120 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
121 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
122 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
123 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
124 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
125 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
126 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
127 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
128 2512875024
129 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
130 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
131 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
132 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
133 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
134 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
135 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
136 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
137 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
138 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
139 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
140 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
141 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
142 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
143 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
144 2738543024 Aminobacter sp. AP02 Isolate Unclassified
145 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
146 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
147 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
148 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
149 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
150 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
151 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
152 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
153 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
154 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
155 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
156 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
157 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
158 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
159 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
160 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
161 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
162 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
163 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
164 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
165 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
166 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
167 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
168 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
169 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
170 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
171 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
172 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
173 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
174 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
175 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
176 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
177 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
178 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
179 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
180 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
181 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
182 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
183 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
184 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
185 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
186 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
187 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
188 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
189 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
190 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
191 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
192 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
193 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
194 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
195 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
196 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
197 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
198 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
199 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
200 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
201 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
202 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
203 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
204 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
205 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
206 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
207 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
208 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
209 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
210 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
211 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
212 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
213 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
214 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
215 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
216 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
217 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
218 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
219 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
220 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
221 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
222 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
223 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
224 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
225 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
226 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
227 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
228 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
229 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
230 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
231 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
232 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
233 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
234 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
235 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
236 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
237 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
238 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
239 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
240 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
241 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
242 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
243 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
244 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
245 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
246 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
247 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
248 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
249 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
250 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
251 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
252 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
253 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
254 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
255 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
256 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
257 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
258 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
259 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
260 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
261 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
262 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
263 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
264 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
265 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
266 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
267 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
268 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
269 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
270 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
271 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
272 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
273 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
274 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
275 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
276 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
277 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
278 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
279 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
280 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
281 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
282 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
283 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
284 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
285 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
286 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
287 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
288 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
289 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
290 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
291 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
292 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
293 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
294 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
295 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
296 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
297 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
298 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
299 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
300 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
301 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
302 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
303 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
304 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
305 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
306 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
307 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
308 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
309 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
310 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
311 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
312 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
313 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
314 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
315 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
316 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
317 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
318 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
319 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
320 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
321 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
322 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
323 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
324 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
325 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
326 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
327 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
328 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
329 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
330 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
331 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
332 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
333 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
334 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
335 3004167301 Mesorhizobium loti 582 Isolate Unclassified
336 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
337 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
338 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
339 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
340 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
341 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
342 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
343 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
344 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
345 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
346 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
347 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
348 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
349 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
350 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
351 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
352 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
353 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
354 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
355 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
356 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
357 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 51.12
Metatranscriptomes 0
Isolates 48.88

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.95
Nodule 41.72
Rhizoplane 0.82
Rhizosphere 41.31
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075369_10031118 3300006186 Bacteria 2250
2 JGI25156J39149_1001861 3300002705 Bacteria 8253
3 JGI25157J39369_1000922 3300002741 Bacteria 13985
4 JGI25165J46597_1000200 3300003214 Bacteria 87751
5 rootH1_10073558 3300003316 Bacteria 3433
6 Ga0055542_1001532 3300003762 Bacteria 11108
7 Ga0070658_10118806 3300005327 Bacteria 2195
8 Ga0070676_10106318 3300005328 Bacteria 1741
9 Ga0070668_100205900 3300005347 Bacteria 1616
10 Ga0070671_100132917 3300005355 Bacteria 2096
11 Ga0070674_100495958 3300005356 Bacteria 1016
12 Ga0070663_100011596 3300005455 Bacteria 5540
13 Ga0070663_100098254 3300005455 Bacteria 2181
14 Ga0068853_100009930 3300005539 Bacteria 7685
15 Ga0068853_100350195 3300005539 Bacteria 1374
16 Ga0068853_100677458 3300005539 Bacteria 983
17 Ga0070665_100108420 3300005548 Bacteria 2779
18 Ga0070665_100185882 3300005548 Bacteria 2079
19 Ga0070665_100237100 3300005548 Bacteria 1825
20 Ga0070665_100290385 3300005548 Bacteria 1638
21 Ga0070665_101298880 3300005548 Bacteria 738
22 Ga0068855_100201574 3300005563 Bacteria 2240
23 Ga0068857_100149324 3300005577 Bacteria 2117
24 Ga0068854_100851936 3300005578 Bacteria 798
25 Ga0068852_100041026 3300005616 Bacteria 3908
26 Ga0068852_101331911 3300005616 Bacteria 740
27 Ga0075365_10001245 3300006038 Bacteria 11285
28 Ga0075365_10017425 3300006038 Bacteria 4394
29 Ga0075365_10027073 3300006038 Bacteria 3644
30 Ga0075368_10003017 3300006042 Bacteria 5565
31 Ga0075363_100019864 3300006048 Bacteria 3363
32 Ga0075362_10009720 3300006177 Bacteria 3729
33 Ga0075367_10062397 3300006178 Bacteria 2226
34 Ga0075367_10065148 3300006178 Bacteria 2181
35 Ga0075367_10082156 3300006178 Bacteria 1950
36 Ga0075369_10154024 3300006186 Bacteria 1051
37 Ga0075370_10019640 3300006353 Bacteria 3683
38 Ga0075370_10215404 3300006353 Bacteria 1134
39 Ga0105240_10199733 3300009093 Bacteria 2344
40 Ga0105240_10302241 3300009093 Bacteria 1830
41 Ga0105243_10151405 3300009148 Bacteria 1990
42 Ga0105241_10045348 3300009174 Bacteria 3335
43 Ga0105242_10390891 3300009176 Bacteria 1295
44 Ga0105248_10226019 3300009177 Bacteria 2107
45 Ga0105237_10073454 3300009545 Bacteria 3412
46 Ga0105238_10033160 3300009551 Bacteria 5255
47 Ga0105238_10204910 3300009551 Bacteria 1948
48 Ga0105238_10434609 3300009551 Bacteria 1308
49 Ga0105238_10514947 3300009551 Bacteria 1198
50 Ga0105249_10608768 3300009553 Bacteria 1148
51 Ga0105239_10078115 3300010375 Bacteria 3643
52 Ga0105239_10110564 3300010375 Bacteria 3046
53 Ga0105239_10170046 3300010375 Bacteria 2437
54 Ga0105239_10561373 3300010375 Bacteria 1300
55 Ga0157369_10111816 3300013105 Bacteria 2903
56 Ga0157374_10215152 3300013296 Bacteria 1885
57 Ga0157374_10384177 3300013296 Bacteria 1399
58 Ga0157372_10241133 3300013307 Bacteria 2098
59 Ga0182008_10216725 3300014497 Bacteria 978
60 Ga0157379_10408221 3300014968 Bacteria 1249
61 Ga0157376_10331177 3300014969 Bacteria 1451
62 Ga0182006_1086888 3300015261 Bacteria 1131
63 Ga0163161_10441688 3300017792 Bacteria 1050
64 Ga0209026_1000024 3300025250 Bacteria 355839
65 Ga0209148_1000050 3300025254 Bacteria 413178
66 Ga0209759_1000302 3300025256 Bacteria 67678
67 Ga0209233_1000027 3300025261 Bacteria 652089
68 Ga0209233_1011519 3300025261 Bacteria 2603
69 Ga0209455_1000507 3300025272 Bacteria 27901
70 Ga0209758_1047261 3300025297 Bacteria 1542
71 Ga0207647_10386995 3300025904 Bacteria 789
72 Ga0207705_10084423 3300025909 Bacteria 2318
73 Ga0207654_10027942 3300025911 Bacteria 3071
74 Ga0207695_10238458 3300025913 Bacteria 1721
75 Ga0207695_10581802 3300025913 Bacteria 1001
76 Ga0207671_10130205 3300025914 Bacteria 1931
77 Ga0207657_10100140 3300025919 Bacteria 2406
78 Ga0207657_10108925 3300025919 Bacteria 2290
79 Ga0207694_10018412 3300025924 Bacteria 5279
80 Ga0207687_10220373 3300025927 Bacteria 1493
81 Ga0207667_10465096 3300025949 Bacteria 1284
82 Ga0207712_10884538 3300025961 Bacteria 789
83 Ga0207639_10410115 3300026041 Bacteria 1222
84 Ga0207639_10479025 3300026041 Bacteria 1134
85 Ga0207678_10022085 3300026067 Bacteria 5576
86 Ga0207678_10065457 3300026067 Bacteria 3121
87 Ga0207678_10065600 3300026067 Bacteria 3117
88 Ga0207648_10319806 3300026089 Bacteria 1394
89 Ga0207683_10304906 3300026121 Bacteria 1457
90 Ga0207698_10097652 3300026142 Bacteria 2425
91 Ga0268266_10064627 3300028379 Bacteria 3162
92 Ga0268266_10272703 3300028379 Bacteria 1571
93 Ga0268266_10417406 3300028379 Bacteria 1271
94 Ga0268266_10827412 3300028379 Bacteria 895
95 Ga0307515_10366266 3300028794 Bacteria 1080
96 Ga0307412_10230019 3300031911 Bacteria 1427
97 Ga0395899_0000213 3300037312 Bacteria 83403
98 Ga0395899_0556596 3300037312 Bacteria 736
99 Ga0395900_0000121 3300037418 Bacteria 135026
100 Ga0395900_0279656 3300037418 Bacteria 1661
101 Ga0395900_0291315 3300037418 Bacteria 1621
102 Ga0395900_0402607 3300037418 Bacteria 1332
103 Ga0395898_0000247 3300037466 Bacteria 135026
104 Ga0395898_0091534 3300037466 Bacteria 2926
105 Ga0395898_0198229 3300037466 Bacteria 1918
106 Ga0395905_0000112 3300037471 Bacteria 135010
107 Ga0395905_0177489 3300037471 Bacteria 1999
108 Ga0395905_0267307 3300037471 Bacteria 1596
109 Ga0395901_0000078 3300038443 Bacteria 135026
110 Ga0395901_0119893 3300038443 Bacteria 2764
111 Ga0395901_0139805 3300038443 Bacteria 2545
112 Ga0395901_0168403 3300038443 Bacteria 2299
113 Ga0395901_0365856 3300038443 Bacteria 1486
114 Ga0395901_0951639 3300038443 Bacteria 837
115 Ga0466972_0052681 3300044658 Bacteria 1960
116 Ga0495638_0063031 3300046460 Bacteria 2287
117 Ga0495638_0144602 3300046460 Bacteria 1384
118 Ga0495668_0087894 3300046616 Bacteria 1704
119 Ga0496102_0737644 3300048905 Bacteria 908
120 Ga0496112_0128498 3300048915 Bacteria 2505
121 Ga0496115_0093064 3300048918 Bacteria 2465
122 Ga0496118_0205075 3300048921 Bacteria 1163
123 Ga0496119_0052211 3300048922 Bacteria 2506
124 Ga0496119_0126717 3300048922 Bacteria 1396
125 Ga0496120_0000863 3300048923 Bacteria 42869
126 Ga0496120_0140191 3300048923 Bacteria 1228
127 Ga0496120_0256656 3300048923 Bacteria 818
128 Ga0496121_0072153 3300048924 Bacteria 2773
129 Ga0496125_0072308 3300048928 Bacteria 2688
130 Ga0496126_0032383 3300048929 Bacteria 4926
131 Ga0501031_0000019 3300049568 Bacteria 104793
132 Ga0501031_0022870 3300049568 Bacteria 4076
133 Ga0501031_0026496 3300049568 Bacteria 3779
134 Ga0501031_0272774 3300049568 Bacteria 1098
135 Ga0501032_0000009 3300049569 Bacteria 228107
136 Ga0501032_0002799 3300049569 Bacteria 13565
137 Ga0501032_0014482 3300049569 Bacteria 5584
138 Ga0501032_0033159 3300049569 Bacteria 3540
139 Ga0501032_0189522 3300049569 Bacteria 1344
140 Ga0501032_0285994 3300049569 Bacteria 1067
141 Ga0501033_0000019 3300049570 Bacteria 204699
142 Ga0501033_0001826 3300049570 Bacteria 18559
143 Ga0501033_0033623 3300049570 Bacteria 3850
144 Ga0501033_0041587 3300049570 Bacteria 3428
145 Ga0501033_0089761 3300049570 Bacteria 2248
146 Ga0501033_0108213 3300049570 Bacteria 2025
147 Ga0501033_0448384 3300049570 Bacteria 896
148 Ga0501034_0000044 3300049571 Bacteria 227982
149 Ga0501034_0001700 3300049571 Bacteria 28349
150 Ga0501034_0022422 3300049571 Bacteria 6435
151 Ga0501034_0042922 3300049571 Bacteria 4577
152 Ga0501034_0096699 3300049571 Bacteria 2949
153 Ga0501034_0139770 3300049571 Bacteria 2402
154 Ga0501034_0252802 3300049571 Bacteria 1706
155 Ga0501036_0000008 3300049572 Bacteria 228106
156 Ga0501036_0038867 3300049572 Bacteria 4028
157 Ga0501036_0263479 3300049572 Bacteria 1444
158 Ga0501036_0418953 3300049572 Bacteria 1117
159 Ga0501037_0000086 3300049573 Bacteria 85419
160 Ga0501037_0000216 3300049573 Bacteria 50948
161 Ga0501037_0050229 3300049573 Bacteria 3052
162 Ga0501038_0000006 3300049574 Bacteria 228107
163 Ga0501038_0068819 3300049574 Bacteria 3009
164 Ga0501038_0323982 3300049574 Bacteria 1205
165 Ga0501039_0000014 3300049575 Bacteria 228107
166 Ga0501039_0090199 3300049575 Bacteria 2389
167 Ga0501040_0012588 3300049576 Bacteria 5546
168 Ga0501040_0014403 3300049576 Bacteria 5210
169 Ga0501042_0438572 3300049578 Bacteria 947
170 Ga0501043_0000132 3300049579 Bacteria 69702
171 Ga0501043_0000399 3300049579 Bacteria 39006
172 Ga0501043_0106869 3300049579 Bacteria 2198
173 Ga0501043_0145264 3300049579 Bacteria 1857
174 Ga0501043_0331326 3300049579 Bacteria 1159
175 Ga0501046_0021894 3300049580 Bacteria 5269
176 Ga0501047_0003906 3300049581 Bacteria 14013
177 Ga0501047_0015048 3300049581 Bacteria 7362
178 Ga0501047_0030572 3300049581 Bacteria 5191
179 Ga0501047_0093812 3300049581 Bacteria 2881
180 Ga0501047_0143026 3300049581 Bacteria 2270
181 Ga0501047_0186038 3300049581 Bacteria 1942
182 Ga0501047_0294214 3300049581 Bacteria 1467
183 Ga0501047_0407115 3300049581 Bacteria 1193
184 Ga0501048_0035654 3300049582 Bacteria 3580
185 Ga0501067_0077890 3300049583 Bacteria 1837
186 Ga0501067_0087583 3300049583 Bacteria 1728
187 Ga0501068_0005109 3300049584 Bacteria 7150
188 Ga0501068_0020874 3300049584 Bacteria 3822
189 Ga0501069_0000051 3300049585 Bacteria 70783
190 Ga0501069_0004367 3300049585 Bacteria 7299
191 Ga0501069_0160528 3300049585 Bacteria 1294
192 Ga0501070_0000291 3300049586 Bacteria 46988
193 Ga0501070_0007121 3300049586 Bacteria 9497
194 Ga0501070_0015231 3300049586 Bacteria 6472
195 Ga0501070_0034751 3300049586 Bacteria 4213
196 Ga0501070_0118450 3300049586 Bacteria 2188
197 Ga0501070_0179483 3300049586 Bacteria 1743
198 Ga0501070_0230029 3300049586 Bacteria 1519
199 Ga0501070_0263122 3300049586 Bacteria 1409
200 Ga0501070_0299795 3300049586 Bacteria 1309
201 Ga0501071_0015403 3300049587 Bacteria 5249
202 Ga0501071_0802678 3300049587 Bacteria 726
203 Ga0501072_0218045 3300049588 Bacteria 1521
204 Ga0501073_0032551 3300049589 Bacteria 3717
205 Ga0501073_0050354 3300049589 Bacteria 2919
206 Ga0501073_0087656 3300049589 Bacteria 2164
207 Ga0501073_0477383 3300049589 Bacteria 862
208 Ga0501074_0000043 3300049590 Bacteria 59245
209 Ga0501074_0009315 3300049590 Bacteria 7133
210 Ga0501079_0061425 3300049741 Bacteria 2899
211 Ga0501080_0000551 3300049742 Bacteria 29597
212 Ga0501080_0020408 3300049742 Bacteria 6132
213 Ga0501080_0050737 3300049742 Bacteria 3861
214 Ga0501080_0060263 3300049742 Bacteria 3532
215 Ga0501080_0101326 3300049742 Bacteria 2672
216 Ga0501080_0582088 3300049742 Bacteria 995
217 Ga0501083_0008038 3300049744 Bacteria 7462
218 Ga0501083_0038990 3300049744 Bacteria 3228
219 Ga0501035_0000151 3300049822 Bacteria 85429
220 Ga0501035_0000280 3300049822 Bacteria 60510
221 Ga0501035_0001157 3300049822 Bacteria 27532
222 Ga0501035_0002892 3300049822 Bacteria 16543
223 Ga0501035_0018864 3300049822 Bacteria 6355
224 Ga0501035_0024938 3300049822 Bacteria 5483
225 Ga0501035_0040203 3300049822 Bacteria 4228
226 Ga0501035_0209746 3300049822 Bacteria 1667
227 Ga0501035_0491065 3300049822 Bacteria 1011
228 Ga0501035_0556968 3300049822 Bacteria 938
229 Ga0501044_0000017 3300049823 Bacteria 228107
230 Ga0501044_0000037 3300049823 Bacteria 161924
231 Ga0501044_0004973 3300049823 Bacteria 14865
232 Ga0501044_0035619 3300049823 Bacteria 5211
233 Ga0501044_0155401 3300049823 Bacteria 2267
234 Ga0501044_0286633 3300049823 Bacteria 1579
235 Ga0501044_0310599 3300049823 Bacteria 1503
236 Ga0501045_0009380 3300049824 Bacteria 6842
237 nmdc:mga03n38_89724_c1 3300050490 Bacteria 1461
238 nmdc:mga0yw44_19582_c1 3300050492 Bacteria 3735
239 nmdc:mga0yw44_3641_c1 3300050492 Bacteria 6886
240 nmdc:mga06z11_29762_c1 3300050494 Bacteria 2634
241 nmdc:mga04h51_20364_c1 3300050495 Bacteria 1979
242 nmdc:mga07m45_36780_c1 3300050496 Bacteria 2728
243 Ga0500610_0148173 3300053079 Bacteria 1178
244 Ga0500658_0240760 3300053134 Bacteria 831
245 Ga0500568_0000062 3300053139 Bacteria 106840
246 Ga0500568_0057481 3300053139 Bacteria 1514
247 Ga0500604_0054123 3300053151 Bacteria 1245
248 Ga0500616_0012215 3300053153 Bacteria 5032
249 Ga0500616_0090819 3300053153 Bacteria 1513
250 Ga0500620_000229 3300053155 Bacteria 11160
251 2503202135 2503198000 Bacteria 6884444
252 2509117080 2508501123 Bacteria 6283661
253 2509370800 2509276018 Bacteria 6910194
254 2509396779 2509276022 Bacteria 6200534
255 2510317585 2510065059 Bacteria 6847884
256 2512930968 2512875016 Bacteria 6529530
257 2512958699 2512875024 Bacteria 7195110
258 2513610143 2513237090 Bacteria 7096802
259 2514034886 2513237164 Bacteria 7563725
260 2514418665 2513237305 Bacteria 7293571
261 2588516653 2588253730 Bacteria 6881675
262 2599940428 2599185301 Bacteria 6161860
263 2643773567 2643221550 Bacteria 4619371
264 2643775430 2643221551 Bacteria 3750538
265 2643793876 2643221555 Bacteria 3749717
266 2643837233 2643221564 Bacteria 4193379
267 2643989309 2643221595 Bacteria 6565519
268 2644152881 2643221627 Bacteria 6761570
269 2688599515 2687453392 Bacteria 6880454
270 2694629713 2693429783 Bacteria 7019804
271 2694636414 2693429784 Bacteria 7241525
272 2723575889 2721755686 Bacteria 7343952
273 2739308026 2738543024 Bacteria 5603683
274 2756677228 2756170246 Bacteria 7451806
275 2792749885 2791355123 Bacteria 8049106
276 2844006353 2844002411 Bacteria 7168230
277 2844014789 2844009547 Bacteria 6728125
278 2847676094 2847670302 Bacteria 6165597
279 2847692740 2847686936 Bacteria 6278406
280 2856315880 2856314179 Bacteria 6477897
281 2856325765 2856320880 Bacteria 7263508
282 2856329067 2856328259 Bacteria 6528202
283 2856338520 2856334872 Bacteria 7037011
284 2856370644 2856364286 Bacteria 6939991
285 2857370533 2857367948 Bacteria 6965560
286 2869167443 2869162929 Bacteria 6399702
287 2869235579 2869234852 Bacteria 6654993
288 2869247267 2869242130 Bacteria 6609239
289 2869255240 2869249662 Bacteria 6868783
290 2869260560 2869256925 Bacteria 6981691
291 2869264220 2869264136 Bacteria 6880765
292 2869271342 2869271264 Bacteria 6908218
293 2869279383 2869278585 Bacteria 7077053
294 2869291628 2869285874 Bacteria 6901219
295 2871434838 2871429161 Bacteria 6547891
296 2871443016 2871435913 Bacteria 6880295
297 2871453006 2871451962 Bacteria 7336357
298 2871461248 2871459585 Bacteria 6866887
299 2871471738 2871466892 Bacteria 6923287
300 2871484235 2871481445 Bacteria 6700002
301 2871495462 2871488783 Bacteria 6929816
302 2871501802 2871495908 Bacteria 6935695
303 2874103075 2874102143 Bacteria 6342645
304 2874109334 2874109183 Bacteria 6517025
305 2874118302 2874116593 Bacteria 6674494
306 2874130995 2874123672 Bacteria 7238285
307 2874138488 2874131515 Bacteria 6820270
308 2874145132 2874139085 Bacteria 7021506
309 2874149228 2874146452 Bacteria 7533118
310 2874157492 2874155637 Bacteria 6724144
311 2874166739 2874162495 Bacteria 6174670
312 2874176119 2874168670 Bacteria 8062617
313 2876365882 2876363079 Bacteria 6544991
314 2876370891 2876369609 Bacteria 6807521
315 2876391647 2876386047 Bacteria 6698674
316 2876394737 2876392853 Bacteria 6660880
317 2876402601 2876399893 Bacteria 6927900
318 2876407415 2876406927 Bacteria 6191900
319 2876415694 2876413966 Bacteria 6831344
320 2876425462 2876420981 Bacteria 6687741
321 2878040148 2878035449 Bacteria 6555736
322 2878734996 2878730984 Bacteria 6380721
323 2878743329 2878738818 Bacteria 7136951
324 2878751972 2878745973 Bacteria 6867388
325 2878757914 2878753008 Bacteria 6922523
326 2878765694 2878760144 Bacteria 6823465
327 2878772885 2878767105 Bacteria 6898628
328 2878779531 2878774303 Bacteria 6108671
329 2878785663 2878781027 Bacteria 6834456
330 2881152092 2881147464 Bacteria 7779814
331 2881155805 2881155292 Bacteria 6461656
332 2881168067 2881161766 Bacteria 7127907
333 2881850207 2881845957 Bacteria 6611900
334 2881856432 2881853255 Bacteria 6698367
335 2881865034 2881861095 Bacteria 7128710
336 2882635872 2882632389 Bacteria 8154593
337 2882914056 2882912400 Bacteria 6801539
338 2885309947 2885305155 Bacteria 7348390
339 2885317032 2885312484 Bacteria 6415165
340 2885323908 2885318864 Bacteria 6729568
341 2885331906 2885326080 Bacteria 7134805
342 2885346434 2885342637 Bacteria 7011821
343 2888340060 2888337043 Bacteria 6629336
344 2888356318 2888350351 Bacteria 7372807
345 2889011233 2889010040 Bacteria 6749192
346 2889017041 2889016732 Bacteria 6700763
347 2903451953 2903448605 Bacteria 7357801
348 2903493469 2903492973 Bacteria 13473544
349 2903506660 2903492973 Bacteria 13473544
350 2903523794 2903521522 Bacteria 6525694
351 2903534345 2903528002 Bacteria 6586099
352 2903546640 2903540706 Bacteria 7062119
353 2904661369 2904659560 Bacteria 6685615
354 2906314366 2906308376 Bacteria 6841989
355 2906327535 2906321335 Bacteria 6579571
356 2906329017 2906328253 Bacteria 6585166
357 2906365394 2906363423 Bacteria 6856682
358 2906377266 2906370794 Bacteria 6881062
359 2906385765 2906378014 Bacteria 6911440
360 2906402376 2906401398 Bacteria 6693206
361 2906414079 2906408224 Bacteria 6162342
362 2906416017 2906414383 Bacteria 6580790
363 2922137724 2922130491 Bacteria 7173936
364 2922153812 2922151315 Bacteria 6902399
365 2922159788 2922158528 Bacteria 6573167
366 2922178024 2922172374 Bacteria 6167644
367 2922193454 2922185730 Bacteria 7113964
368 2924725092 2924718760 Bacteria 6331356
369 2924730418 2924726620 Bacteria 6271473
370 2924737022 2924733363 Bacteria 7574837
371 2924742109 2924741084 Bacteria 6661321
372 2924751351 2924748358 Bacteria 6154725
373 2924766946 2924762789 Bacteria 6561353
374 2924781140 2924776078 Bacteria 7492003
375 2924784628 2924784321 Bacteria 7416538
376 2937816328 2937813078 Bacteria 7783518
377 2937847233 2937843397 Bacteria 5256375
378 2937854951 2937848649 Bacteria 6983481
379 2937863632 2937861824 Bacteria 6660327
380 2937870996 2937868953 Bacteria 6639878
381 2937877564 2937877337 Bacteria 7246526
382 2937891924 2937891427 Bacteria 6357007
383 2937975353 2937972304 Bacteria 7532020
384 2937988194 2937980651 Bacteria 6517427
385 2938000474 2937994558 Bacteria 7036190
386 2938022428 2938014810 Bacteria 6700592
387 2958035523 2958034702 Bacteria 6989922
388 2958043710 2958041894 Bacteria 13082850
389 2958054847 2958041894 Bacteria 13082850
390 2958066907 2958064165 Bacteria 7158582
391 2958084672 2958084443 Bacteria 7312792
392 2958103064 2958100919 Bacteria 6800575
393 2958118934 2958115193 Bacteria 6923548
394 2958136029 2958130278 Bacteria 6897202
395 2958146347 2958144490 Bacteria 6677056
396 2958170869 2958165035 Bacteria 6906348
397 2958173901 2958172287 Bacteria 6716688
398 2958185496 2958179912 Bacteria 6874908
399 2961083874 2961077736 Bacteria 7079850
400 2961116523 2961114664 Bacteria 6680456
401 2961133057 2961127735 Bacteria 7196641
402 2961142123 2961136820 Bacteria 6775228
403 2961169299 2961163497 Bacteria 6901077
404 2961174458 2961170736 Bacteria 7072258
405 2961185613 2961183825 Bacteria 6688536
406 2963648257 2963644680 Bacteria 6530403
407 2965024058 2965018300 Bacteria 6883036
408 2965029616 2965025482 Bacteria 6532201
409 2965046067 2965040258 Bacteria 6855979
410 2965050504 2965047637 Bacteria 6623551
411 2965068157 2965062239 Bacteria 7412989
412 2965104941 2965102966 Bacteria 6800987
413 2965116966 2965110997 Bacteria 6693150
414 2965127019 2965119406 Bacteria 6956431
415 2968000449 2967996073 Bacteria 6787468
416 2968003640 2968003550 Bacteria 6929263
417 2968017929 2968016561 Bacteria 7022047
418 2968087653 2968083720 Bacteria 7351627
419 2968095858 2968091066 Bacteria 6052692
420 2968101016 2968097103 Bacteria 6107094
421 2968112429 2968110612 Bacteria 6814636
422 2968121218 2968117919 Bacteria 6536078
423 2968132806 2968128360 Bacteria 6270294
424 2968146616 2968138860 Bacteria 6605449
425 2968177703 2968171901 Bacteria 6894245
426 2970471896 2970469710 Bacteria 6969209
427 2970492685 2970489779 Bacteria 6517260
428 2970507045 2970503327 Bacteria 7099517
429 2970513055 2970510686 Bacteria 7006402
430 2970539154 2970532167 Bacteria 6553173
431 2970549403 2970547951 Bacteria 6931819
432 2970560549 2970554993 Bacteria 6814252
433 2970593979 2970593180 Bacteria 7073582
434 2970620337 2970619444 Bacteria 6986144
435 2970633771 2970627176 Bacteria 6680862
436 2977822447 2977821940 Bacteria 6906439
437 2977831986 2977828996 Bacteria 7007971
438 2977846563 2977843712 Bacteria 6753583
439 2977851822 2977851361 Bacteria 6694324
440 2977860122 2977858184 Bacteria 6215359
441 2977868727 2977864932 Bacteria 7534097
442 2977874781 2977872689 Bacteria 7270173
443 2977902373 2977898635 Bacteria 6675551
444 2977911765 2977907340 Bacteria 6577984
445 2977922074 2977915119 Bacteria 6829656
446 2977929378 2977922695 Bacteria 6956781
447 2977940165 2977935797 Bacteria 6252826
448 2977947763 2977942078 Bacteria 7570577
449 2977963058 2977957713 Bacteria 6877875
450 2977977524 2977971508 Bacteria 7472917
451 2977991720 2977986579 Bacteria 6581278
452 2977992940 2977986579 Bacteria 6581278
453 2979714021 2979710463 Bacteria 6785254
454 2979770486 2979764755 Bacteria 6610066
455 2979772726 2979772303 Bacteria 6618277
456 2979783061 2979779861 Bacteria 6219781
457 2979799848 2979793036 Bacteria 6808957
458 2979812240 2979808191 Bacteria 7179355
459 2987646279 2987645492 Bacteria 6117018
460 2987653225 2987652177 Bacteria 6969023
461 2987665418 2987659509 Bacteria 6966464
462 2987668713 2987666974 Bacteria 6509233
463 2996311208 2996310559 Bacteria 6357320
464 2996344722 2996341866 Bacteria 6643098
465 2996350825 2996348954 Bacteria 7239054
466 3000138573 3000135777 Bacteria 6891109
467 3004169493 3004167301 Bacteria 8330599
468 3004194502 3004188549 Bacteria 6952365
469 3004201302 3004195979 Bacteria 6776956
470 3004211764 3004211236 Bacteria 7417683
471 3004219011 3004218560 Bacteria 7421728
472 3004236750 3004232784 Bacteria 6662140
473 3004241495 3004239961 Bacteria 6892290
474 3004274648 3004268573 Bacteria 7043476
475 3004277523 3004275668 Bacteria 7114440
476 3004341107 3004334049 Bacteria 8449246
477 637074011 637000159 Bacteria 7596297
478 649874018 649633066 Bacteria 6690028
479 8002286237 8002285264 Bacteria 6717907
480 8004307459 8004300914 Bacteria 6132239
481 8004320795 8004312739 Bacteria 7444653
482 8004364580 8004361976 Bacteria 6858373
483 8004379426 8004374579 Bacteria 6898112
484 8004394644 8004387939 Bacteria 7049250
485 8004640187 8004640170 Bacteria 6723001
486 8004699427 8004695233 Bacteria 6731676
487 8004709836 8004703790 Bacteria 8006957
488 8004720630 8004714634 Bacteria 6776161
489 8004734282 8004727605 Bacteria 6643904
490 Ga0075369_10031118
491 JGI25156J39149_1001861
492 JGI25157J39369_1000922
493 JGI25165J46597_1000200
494 rootH1_10073558
495 Ga0055542_1001532
496 Ga0070658_10118806
497 Ga0070676_10106318
498 Ga0070668_100205900
499 Ga0070671_100132917
500 Ga0070674_100495958
501 Ga0070663_100011596
502 Ga0070663_100098254
503 Ga0068853_100009930
504 Ga0068853_100350195
505 Ga0068853_100677458
506 Ga0070665_100108420
507 Ga0070665_100185882
508 Ga0070665_100237100
509 Ga0070665_100290385
510 Ga0070665_101298880
511 Ga0068855_100201574
512 Ga0068857_100149324
513 Ga0068854_100851936
514 Ga0068852_100041026
515 Ga0068852_101331911
516 Ga0075365_10001245
517 Ga0075365_10017425
518 Ga0075365_10027073
519 Ga0075368_10003017
520 Ga0075363_100019864
521 Ga0075362_10009720
522 Ga0075367_10062397
523 Ga0075367_10065148
524 Ga0075367_10082156
525 Ga0075369_10154024
526 Ga0075370_10019640
527 Ga0075370_10215404
528 Ga0105240_10199733
529 Ga0105240_10302241
530 Ga0105243_10151405
531 Ga0105241_10045348
532 Ga0105242_10390891
533 Ga0105248_10226019
534 Ga0105237_10073454
535 Ga0105238_10033160
536 Ga0105238_10204910
537 Ga0105238_10434609
538 Ga0105238_10514947
539 Ga0105249_10608768
540 Ga0105239_10078115
541 Ga0105239_10110564
542 Ga0105239_10170046
543 Ga0105239_10561373
544 Ga0157369_10111816
545 Ga0157374_10215152
546 Ga0157374_10384177
547 Ga0157372_10241133
548 Ga0182008_10216725
549 Ga0157379_10408221
550 Ga0157376_10331177
551 Ga0182006_1086888
552 Ga0163161_10441688
553 Ga0209026_1000024
554 Ga0209148_1000050
555 Ga0209759_1000302
556 Ga0209233_1000027
557 Ga0209233_1011519
558 Ga0209455_1000507
559 Ga0209758_1047261
560 Ga0207647_10386995
561 Ga0207705_10084423
562 Ga0207654_10027942
563 Ga0207695_10238458
564 Ga0207695_10581802
565 Ga0207671_10130205
566 Ga0207657_10100140
567 Ga0207657_10108925
568 Ga0207694_10018412
569 Ga0207687_10220373
570 Ga0207667_10465096
571 Ga0207712_10884538
572 Ga0207639_10410115
573 Ga0207639_10479025
574 Ga0207678_10022085
575 Ga0207678_10065457
576 Ga0207678_10065600
577 Ga0207648_10319806
578 Ga0207683_10304906
579 Ga0207698_10097652
580 Ga0268266_10064627
581 Ga0268266_10272703
582 Ga0268266_10417406
583 Ga0268266_10827412
584 Ga0307515_10366266
585 Ga0307412_10230019
586 Ga0395899_0000213
587 Ga0395899_0556596
588 Ga0395900_0000121
589 Ga0395900_0279656
590 Ga0395900_0291315
591 Ga0395900_0402607
592 Ga0395898_0000247
593 Ga0395898_0091534
594 Ga0395898_0198229
595 Ga0395905_0000112
596 Ga0395905_0177489
597 Ga0395905_0267307
598 Ga0395901_0000078
599 Ga0395901_0119893
600 Ga0395901_0139805
601 Ga0395901_0168403
602 Ga0395901_0365856
603 Ga0395901_0951639
604 Ga0466972_0052681
605 Ga0495638_0063031
606 Ga0495638_0144602
607 Ga0495668_0087894
608 Ga0496102_0737644
609 Ga0496112_0128498
610 Ga0496115_0093064
611 Ga0496118_0205075
612 Ga0496119_0052211
613 Ga0496119_0126717
614 Ga0496120_0000863
615 Ga0496120_0140191
616 Ga0496120_0256656
617 Ga0496121_0072153
618 Ga0496125_0072308
619 Ga0496126_0032383
620 Ga0501031_0000019
621 Ga0501031_0022870
622 Ga0501031_0026496
623 Ga0501031_0272774
624 Ga0501032_0000009
625 Ga0501032_0002799
626 Ga0501032_0014482
627 Ga0501032_0033159
628 Ga0501032_0189522
629 Ga0501032_0285994
630 Ga0501033_0000019
631 Ga0501033_0001826
632 Ga0501033_0033623
633 Ga0501033_0041587
634 Ga0501033_0089761
635 Ga0501033_0108213
636 Ga0501033_0448384
637 Ga0501034_0000044
638 Ga0501034_0001700
639 Ga0501034_0022422
640 Ga0501034_0042922
641 Ga0501034_0096699
642 Ga0501034_0139770
643 Ga0501034_0252802
644 Ga0501036_0000008
645 Ga0501036_0038867
646 Ga0501036_0263479
647 Ga0501036_0418953
648 Ga0501037_0000086
649 Ga0501037_0000216
650 Ga0501037_0050229
651 Ga0501038_0000006
652 Ga0501038_0068819
653 Ga0501038_0323982
654 Ga0501039_0000014
655 Ga0501039_0090199
656 Ga0501040_0012588
657 Ga0501040_0014403
658 Ga0501042_0438572
659 Ga0501043_0000132
660 Ga0501043_0000399
661 Ga0501043_0106869
662 Ga0501043_0145264
663 Ga0501043_0331326
664 Ga0501046_0021894
665 Ga0501047_0003906
666 Ga0501047_0015048
667 Ga0501047_0030572
668 Ga0501047_0093812
669 Ga0501047_0143026
670 Ga0501047_0186038
671 Ga0501047_0294214
672 Ga0501047_0407115
673 Ga0501048_0035654
674 Ga0501067_0077890
675 Ga0501067_0087583
676 Ga0501068_0005109
677 Ga0501068_0020874
678 Ga0501069_0000051
679 Ga0501069_0004367
680 Ga0501069_0160528
681 Ga0501070_0000291
682 Ga0501070_0007121
683 Ga0501070_0015231
684 Ga0501070_0034751
685 Ga0501070_0118450
686 Ga0501070_0179483
687 Ga0501070_0230029
688 Ga0501070_0263122
689 Ga0501070_0299795
690 Ga0501071_0015403
691 Ga0501071_0802678
692 Ga0501072_0218045
693 Ga0501073_0032551
694 Ga0501073_0050354
695 Ga0501073_0087656
696 Ga0501073_0477383
697 Ga0501074_0000043
698 Ga0501074_0009315
699 Ga0501079_0061425
700 Ga0501080_0000551
701 Ga0501080_0020408
702 Ga0501080_0050737
703 Ga0501080_0060263
704 Ga0501080_0101326
705 Ga0501080_0582088
706 Ga0501083_0008038
707 Ga0501083_0038990
708 Ga0501035_0000151
709 Ga0501035_0000280
710 Ga0501035_0001157
711 Ga0501035_0002892
712 Ga0501035_0018864
713 Ga0501035_0024938
714 Ga0501035_0040203
715 Ga0501035_0209746
716 Ga0501035_0491065
717 Ga0501035_0556968
718 Ga0501044_0000017
719 Ga0501044_0000037
720 Ga0501044_0004973
721 Ga0501044_0035619
722 Ga0501044_0155401
723 Ga0501044_0286633
724 Ga0501044_0310599
725 Ga0501045_0009380
726 nmdc:mga03n38_89724_c1
727 nmdc:mga0yw44_19582_c1
728 nmdc:mga0yw44_3641_c1
729 nmdc:mga06z11_29762_c1
730 nmdc:mga04h51_20364_c1
731 nmdc:mga07m45_36780_c1
732 Ga0500610_0148173
733 Ga0500658_0240760
734 Ga0500568_0000062
735 Ga0500568_0057481
736 Ga0500604_0054123
737 Ga0500616_0012215
738 Ga0500616_0090819
739 Ga0500620_000229
740 2503202135
741 2509117080
742 2509370800
743 2509396779
744 2510317585
745 2512930968
746 2512958699
747 2513610143
748 2514034886
749 2514418665
750 2588516653
751 2599940428
752 2643773567
753 2643775430
754 2643793876
755 2643837233
756 2643989309
757 2644152881
758 2688599515
759 2694629713
760 2694636414
761 2723575889
762 2739308026
763 2756677228
764 2792749885
765 2844006353
766 2844014789
767 2847676094
768 2847692740
769 2856315880
770 2856325765
771 2856329067
772 2856338520
773 2856370644
774 2857370533
775 2869167443
776 2869235579
777 2869247267
778 2869255240
779 2869260560
780 2869264220
781 2869271342
782 2869279383
783 2869291628
784 2871434838
785 2871443016
786 2871453006
787 2871461248
788 2871471738
789 2871484235
790 2871495462
791 2871501802
792 2874103075
793 2874109334
794 2874118302
795 2874130995
796 2874138488
797 2874145132
798 2874149228
799 2874157492
800 2874166739
801 2874176119
802 2876365882
803 2876370891
804 2876391647
805 2876394737
806 2876402601
807 2876407415
808 2876415694
809 2876425462
810 2878040148
811 2878734996
812 2878743329
813 2878751972
814 2878757914
815 2878765694
816 2878772885
817 2878779531
818 2878785663
819 2881152092
820 2881155805
821 2881168067
822 2881850207
823 2881856432
824 2881865034
825 2882635872
826 2882914056
827 2885309947
828 2885317032
829 2885323908
830 2885331906
831 2885346434
832 2888340060
833 2888356318
834 2889011233
835 2889017041
836 2903451953
837 2903493469
838 2903506660
839 2903523794
840 2903534345
841 2903546640
842 2904661369
843 2906314366
844 2906327535
845 2906329017
846 2906365394
847 2906377266
848 2906385765
849 2906402376
850 2906414079
851 2906416017
852 2922137724
853 2922153812
854 2922159788
855 2922178024
856 2922193454
857 2924725092
858 2924730418
859 2924737022
860 2924742109
861 2924751351
862 2924766946
863 2924781140
864 2924784628
865 2937816328
866 2937847233
867 2937854951
868 2937863632
869 2937870996
870 2937877564
871 2937891924
872 2937975353
873 2937988194
874 2938000474
875 2938022428
876 2958035523
877 2958043710
878 2958054847
879 2958066907
880 2958084672
881 2958103064
882 2958118934
883 2958136029
884 2958146347
885 2958170869
886 2958173901
887 2958185496
888 2961083874
889 2961116523
890 2961133057
891 2961142123
892 2961169299
893 2961174458
894 2961185613
895 2963648257
896 2965024058
897 2965029616
898 2965046067
899 2965050504
900 2965068157
901 2965104941
902 2965116966
903 2965127019
904 2968000449
905 2968003640
906 2968017929
907 2968087653
908 2968095858
909 2968101016
910 2968112429
911 2968121218
912 2968132806
913 2968146616
914 2968177703
915 2970471896
916 2970492685
917 2970507045
918 2970513055
919 2970539154
920 2970549403
921 2970560549
922 2970593979
923 2970620337
924 2970633771
925 2977822447
926 2977831986
927 2977846563
928 2977851822
929 2977860122
930 2977868727
931 2977874781
932 2977902373
933 2977911765
934 2977922074
935 2977929378
936 2977940165
937 2977947763
938 2977963058
939 2977977524
940 2977991720
941 2977992940
942 2979714021
943 2979770486
944 2979772726
945 2979783061
946 2979799848
947 2979812240
948 2987646279
949 2987653225
950 2987665418
951 2987668713
952 2996311208
953 2996344722
954 2996350825
955 3000138573
956 3004169493
957 3004194502
958 3004201302
959 3004211764
960 3004219011
961 3004236750
962 3004241495
963 3004274648
964 3004277523
965 3004341107
966 637074011
967 649874018
968 8002286237
969 8004307459
970 8004320795
971 8004364580
972 8004379426
973 8004394644
974 8004640187
975 8004699427
976 8004709836
977 8004720630
978 8004734282

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
3bwv-assembly1.cif.gz_A crystal structure of deoxyribonucleotidase-like protein (np_764060.1) from staphylococcus epidermidis atcc 12228 at 1.55 a resolution 0.7378 19 213
3bwv-assembly1.cif.gz_A crystal structure of deoxyribonucleotidase-like protein (np_764060.1) from staphylococcus epidermidis atcc 12228 at 1.55 a resolution 0.7219 19 213
2iof-assembly1.cif.gz_K crystal structure of phosphonoacetaldehyde hydrolase with sodium borohydride-reduced substrate intermediate 0.687 17 213
2gfh-assembly1.cif.gz_A crystal structure of a n-acetylneuraminic acid phosphatase (nanp) from mus musculus at 1.90 a resolution 0.6756 18 217
4knv-assembly2.cif.gz_B the crystal structure of apo human hdhd4 from se-mad 0.6743 20 213
ID Description Score Start End Superfamily
2no5A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.7284 90 209 3.40.50.1000
af_A0A0R0FMC0_55_182_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.7178 95 139 3.40.30.10
3ddhB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.704 17 211 3.40.50.1000
af_O80568_1_252_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.6964 21 213 3.40.50.1000
af_Q8IHP2_65_208_3.40.50.11730 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peroxisome assembly protein 22 0.6955 16 211 3.40.50.11730
ID Description Score Start End GO Terms
AF-A0A527I7T1-F1-model_v4 HAD family hydrolase 0.9984 153 217
AF-A0A436FFP3-F1-model_v4 HAD family hydrolase 0.9954 47 217
AF-A0A531K478-F1-model_v4 HAD family hydrolase 0.9936 91 215
AF-A0A3S1Q7A2-F1-model_v4 HAD family hydrolase 0.9866 76 217
AF-A0A436FFP3-F1-model_v4 HAD family hydrolase 0.984 47 217

Map