F453754

General Info

Members Datasets Scaffolds Average Seq Length
489 300 978 176

Family's Representative Sequence

Representative Sequence 3300006358|Ga0068871_100723415|Ga0068871_1007234152
Length 191
Sequence MAASVWAATTEVLAAEFSDVPDLPQVLRIAVRLLLASVLGFLLGFEREQHGKAAGVRTHMLVAIGSAMFVLVPQQAGIAPADMSRVIQGLVAGVGFLCAGTILKQGRDEQHVQGLTTAAGLWMTAAIGMACGLGRELTAILSALLALAVLALVPRLVALMERVVGPPGDEDGATRVIAAADDNKGERPPPR

Samples

Sample ID Description Type Environment
1 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
4 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
5 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
6 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
7 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
10 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
11 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
12 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
13 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
14 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
15 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
16 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
17 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
18 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
19 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
20 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
21 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
22 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
23 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
24 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
25 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
26 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
27 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
28 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
29 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
30 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
31 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
32 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
46 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
47 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
48 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
49 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
50 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
51 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
52 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
53 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
54 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
64 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
67 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
68 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
69 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
70 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
71 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
72 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
73 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
74 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
75 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
79 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
81 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
82 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
83 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
84 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
85 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
87 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
88 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
89 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
91 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
92 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
114 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
115 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
116 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
117 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
118 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
119 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
120 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
121 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
122 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
123 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
124 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
125 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
126 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
127 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
128 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
129 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
130 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
131 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
132 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
133 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
134 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
135 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
136 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
137 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
138 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
139 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
140 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
141 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
142 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
143 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
144 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
145 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
146 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
147 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
148 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
149 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
150 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
151 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
152 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
153 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
154 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
155 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
156 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
157 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
158 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
159 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
160 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
161 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
162 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
163 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
164 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
165 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
166 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
167 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
168 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
169 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
170 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
171 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
172 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
173 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
174 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
175 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
176 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
177 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
178 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
179 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
180 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
181 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
182 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
183 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
184 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
185 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
186 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
187 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
188 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
189 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
190 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
191 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
192 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
193 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
194 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
195 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
196 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
197 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
198 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
199 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
200 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
201 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
202 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
203 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
204 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
205 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
206 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
207 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
208 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
209 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
210 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
211 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
212 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
213 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
214 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
215 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
216 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
217 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
218 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
219 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
220 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
221 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
222 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
223 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
224 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
225 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
226 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
227 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
228 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
229 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
230 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
231 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
232 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
233 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
234 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
235 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
236 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
237 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
238 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
239 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
240 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
241 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
242 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
243 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
244 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
245 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
246 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
247 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
248 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
249 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
250 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
251 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
252 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
253 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
254 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
255 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
256 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
257 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
258 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
259 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
260 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
261 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
262 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
263 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
264 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
265 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
266 2643221672 Variovorax sp. Root434 Isolate Unclassified
267 2643221683 Variovorax sp. Root473 Isolate Unclassified
268 2738541277 Variovorax sp. GV051 Isolate Unclassified
269 2738541307 Variovorax sp. GV008 Isolate Unclassified
270 2738543013 Variovorax sp. BT01 Isolate Unclassified
271 2738543019 Variovorax sp. GV040 Isolate Unclassified
272 2818991446 Variovorax sp. 1180 Isolate Unclassified
273 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
274 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
275 2842677519 Variovorax sp. R-72495 Isolate Unclassified
276 2842733646 Variovorax sp. R-72446 Isolate Unclassified
277 2842747753 Variovorax sp. R-72060 Isolate Unclassified
278 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
279 2885198086 Variovorax sp. 679 Isolate Unclassified
280 2885211737 Variovorax sp. 553 Isolate Unclassified
281 2899924645 Variovorax sp. 369 Isolate Unclassified
282 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
283 2904456579 Variovorax sp. 2002 Isolate Unclassified
284 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
285 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
286 2928037797 Variovorax sp. 1126 Isolate Unclassified
287 2928044640 Variovorax sp. 1128 Isolate Unclassified
288 2928051484 Variovorax sp. 1133 Isolate Unclassified
289 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
290 2928070936 Variovorax gossypii 1167 Isolate Unclassified
291 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
292 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
293 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
294 2929520902 Variovorax beijingensis 502 Isolate Unclassified
295 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
296 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
297 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
298 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
299 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
300 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.8
Metatranscriptomes 0.82
Isolates 8.38

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 32.92
Nodule 0.82
Rhizoplane 4.7
Rhizosphere 50.51
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068871_100723415 3300006358 Bacteria 913
2 JGI24739J22299_10034404 3300001989 Bacteria 1727
3 JGI25152J39213_1008454 3300002773 Bacteria 2554
4 JGI25152J39213_1011392 3300002773 Bacteria 1969
5 JGI25150J39212_1001338 3300002774 Bacteria 7002
6 JGI25150J39212_1025187 3300002774 Bacteria 870
7 JGI25159J45721_1019865 3300002987 Bacteria 1311
8 JGI25151J46595_10008110 3300003187 Bacteria 5087
9 JGI25151J46595_10024029 3300003187 Bacteria 2500
10 JGI25153J46596_10018236 3300003215 Bacteria 2734
11 rootH1_10061875 3300003323 Bacteria 2631
12 rootH1_10067267 3300003323 Bacteria 2720
13 rootH1_10401955 3300003323 Bacteria 1169
14 JGI25160J50197_1022931 3300003354 Bacteria 1818
15 JGI25161J50226_1001469 3300003374 Bacteria 7056
16 Ga0006562J51391_1022160 3300003578 Bacteria 2860
17 Ga0006562J51391_1022162 3300003578 Bacteria 3440
18 Ga0006562J51391_1080333 3300003578 Bacteria 9052
19 Ga0006562J51391_1080335 3300003578 Bacteria 5850
20 Ga0055535_1000069 3300003761 Bacteria 115207
21 Ga0055542_1000084 3300003762 Bacteria 125518
22 Ga0055526_1005138 3300003771 Bacteria 7626
23 Ga0055537_1000232 3300003773 Bacteria 40738
24 Ga0055537_1002044 3300003773 Bacteria 7119
25 Ga0055524_1003484 3300003775 Bacteria 7626
26 Ga0055536_1007752 3300003781 Bacteria 4748
27 Ga0055536_1021169 3300003781 Bacteria 1983
28 Ga0055534_1000212 3300003784 Bacteria 42993
29 Ga0055534_1000240 3300003784 Bacteria 39034
30 Ga0055534_1007758 3300003784 Bacteria 2513
31 Ga0055534_1033401 3300003784 Bacteria 783
32 Ga0055528_1004089 3300003790 Bacteria 7119
33 Ga0055528_1007620 3300003790 Bacteria 4758
34 Ga0055530_10001195 3300003791 Bacteria 20077
35 Ga0055540_1001630 3300003792 Bacteria 13027
36 Ga0055540_1002823 3300003792 Bacteria 8875
37 Ga0055540_1003994 3300003792 Bacteria 6870
38 Ga0055540_1009083 3300003792 Bacteria 3486
39 Ga0055540_1017682 3300003792 Bacteria 1981
40 Ga0055531_10001733 3300003794 Bacteria 15608
41 Ga0055531_10019548 3300003794 Bacteria 2734
42 Ga0055531_10027677 3300003794 Bacteria 1981
43 Ga0055543_1000698 3300004625 Bacteria 17147
44 Ga0065165_1004952 3300005262 Bacteria 7835
45 Ga0065165_1020984 3300005262 Bacteria 2280
46 Ga0065714_10006388 3300005288 Bacteria 3931
47 Ga0065704_10133246 3300005289 Bacteria 1602
48 Ga0070666_10176067 3300005335 Bacteria 1500
49 Ga0068868_100310334 3300005338 Bacteria 1342
50 Ga0070660_100463867 3300005339 Bacteria 1052
51 Ga0070661_100093447 3300005344 Bacteria 2229
52 Ga0070668_100145027 3300005347 Bacteria 1916
53 Ga0070669_100016550 3300005353 Bacteria 5263
54 Ga0070671_100030070 3300005355 Bacteria 4482
55 Ga0070674_100383050 3300005356 Bacteria 1145
56 Ga0070674_100524837 3300005356 Bacteria 990
57 Ga0070659_100659215 3300005366 Bacteria 903
58 Ga0070659_101499318 3300005366 Bacteria 601
59 Ga0070667_100095104 3300005367 Bacteria 2568
60 Ga0070667_100211750 3300005367 Bacteria 1723
61 Ga0070678_100226468 3300005456 Bacteria 1557
62 Ga0070678_100257174 3300005456 Bacteria 1467
63 Ga0070662_100068200 3300005457 Bacteria 2614
64 Ga0070662_100769609 3300005457 Bacteria 817
65 Ga0068867_100805987 3300005459 Bacteria 838
66 Ga0068853_100239204 3300005539 Bacteria 1663
67 Ga0068855_100043769 3300005563 Bacteria 5301
68 Ga0070664_100006820 3300005564 Bacteria 9209
69 Ga0068854_100655687 3300005578 Bacteria 902
70 Ga0068852_100144373 3300005616 Bacteria 2206
71 Ga0068852_100294452 3300005616 Bacteria 1569
72 Ga0068851_10006495 3300005834 Bacteria 5339
73 Ga0075365_10027126 3300006038 Bacteria 3641
74 Ga0075363_100002982 3300006048 Bacteria 7067
75 Ga0075363_100008315 3300006048 Bacteria 4826
76 Ga0075363_100069599 3300006048 Bacteria 1909
77 Ga0075363_100105678 3300006048 Bacteria 1561
78 Ga0075363_100325339 3300006048 Bacteria 895
79 Ga0075364_10008381 3300006051 Bacteria 6177
80 Ga0075364_10228577 3300006051 Bacteria 1263
81 Ga0075432_10003135 3300006058 Bacteria 5583
82 Ga0075362_10005466 3300006177 Bacteria 4651
83 Ga0075362_10011171 3300006177 Bacteria 3531
84 Ga0075362_10058674 3300006177 Bacteria 1736
85 Ga0075362_10102834 3300006177 Bacteria 1337
86 Ga0075366_10002056 3300006195 Bacteria 10216
87 Ga0075366_10023943 3300006195 Bacteria 3558
88 Ga0075366_10051080 3300006195 Bacteria 2457
89 Ga0075366_10063212 3300006195 Bacteria 2200
90 Ga0075366_10128515 3300006195 Bacteria 1529
91 Ga0075370_10000501 3300006353 Bacteria 14852
92 Ga0075370_10001916 3300006353 Bacteria 9367
93 Ga0075370_10014095 3300006353 Bacteria 4258
94 Ga0075370_10029649 3300006353 Bacteria 3048
95 Ga0075370_10121749 3300006353 Bacteria 1519
96 Ga0075370_10187951 3300006353 Bacteria 1217
97 Ga0075370_10200331 3300006353 Bacteria 1177
98 Ga0068871_100169454 3300006358 Bacteria 1871
99 Ga0068871_100193530 3300006358 Bacteria 1753
100 Ga0099826_10000873 3300006948 Bacteria 16445
101 Ga0099826_10124680 3300006948 Bacteria 1511
102 Ga0105244_10005868 3300009036 Bacteria 8061
103 Ga0105240_10077823 3300009093 Bacteria 4086
104 Ga0105245_10209977 3300009098 Bacteria 1873
105 Ga0105243_10004578 3300009148 Bacteria 10909
106 Ga0105243_10008424 3300009148 Bacteria 7914
107 Ga0105243_10102686 3300009148 Bacteria 2376
108 Ga0105242_11428300 3300009176 Bacteria 720
109 Ga0105248_11062524 3300009177 Bacteria 915
110 Ga0105237_10061664 3300009545 Bacteria 3749
111 Ga0105238_10500816 3300009551 Bacteria 1215
112 Ga0105239_10084524 3300010375 Bacteria 3496
113 Ga0157373_10013592 3300013100 Bacteria 5971
114 Ga0157373_10605655 3300013100 Bacteria 798
115 Ga0157370_10020546 3300013104 Bacteria 6593
116 Ga0157370_10762022 3300013104 Bacteria 882
117 Ga0157375_10101939 3300013308 Bacteria 2954
118 Ga0163163_10402265 3300014325 Bacteria 1427
119 Ga0182008_10000065 3300014497 Bacteria 88652
120 Ga0182008_10001055 3300014497 Bacteria 19093
121 Ga0182008_10002045 3300014497 Bacteria 12942
122 Ga0182008_10003530 3300014497 Bacteria 9401
123 Ga0182008_10026117 3300014497 Bacteria 2962
124 Ga0182008_10026495 3300014497 Bacteria 2940
125 Ga0157376_11154099 3300014969 Bacteria 802
126 Ga0182006_1000912 3300015261 Bacteria 19708
127 Ga0182006_1037433 3300015261 Bacteria 1923
128 Ga0182006_1190196 3300015261 Bacteria 682
129 Ga0182007_10000369 3300015262 Bacteria 28440
130 Ga0182007_10141774 3300015262 Bacteria 813
131 Ga0182005_1045924 3300015265 Bacteria 1186
132 Ga0182005_1049787 3300015265 Bacteria 1139
133 Ga0183362_10003 3300015683 Bacteria 977584
134 Ga0163161_10001053 3300017792 Bacteria 20949
135 Ga0163161_10166953 3300017792 Bacteria 1681
136 Ga0163161_10892754 3300017792 Bacteria 752
137 Ga0209436_101775 3300025208 Bacteria 7061
138 Ga0209672_100822 3300025228 Bacteria 14569
139 Ga0209147_100554 3300025229 Bacteria 21099
140 Ga0209258_100093 3300025242 Bacteria 223559
141 Ga0207425_1000552 3300025245 Bacteria 22339
142 Ga0207425_1012510 3300025245 Bacteria 1989
143 Ga0209148_1000007 3300025254 Bacteria 1592273
144 Ga0209129_1000147 3300025258 Bacteria 115120
145 Ga0209565_1000117 3300025263 Bacteria 113536
146 Ga0209565_1000282 3300025263 Bacteria 50138
147 Ga0209565_1009059 3300025263 Bacteria 2559
148 Ga0209673_1000218 3300025273 Bacteria 113542
149 Ga0209673_1001256 3300025273 Bacteria 26191
150 Ga0209130_1001555 3300025284 Bacteria 14566
151 Ga0209130_1007259 3300025284 Bacteria 3451
152 Ga0209675_1000113 3300025291 Bacteria 113542
153 Ga0209675_1000745 3300025291 Bacteria 21972
154 Ga0209675_1006270 3300025291 Bacteria 4806
155 Ga0209675_1037842 3300025291 Bacteria 1080
156 Ga0209676_1000028 3300025292 Bacteria 559745
157 Ga0209676_1000135 3300025292 Bacteria 182756
158 Ga0209676_1000216 3300025292 Bacteria 125759
159 Ga0209676_1000486 3300025292 Bacteria 64563
160 Ga0209676_1005087 3300025292 Bacteria 7023
161 Ga0209025_1000503 3300025294 Bacteria 75048
162 Ga0209025_1001127 3300025294 Bacteria 38261
163 Ga0209025_1015406 3300025294 Bacteria 4610
164 Ga0209025_1073805 3300025294 Bacteria 1195
165 Ga0209564_1000327 3300025295 Bacteria 92740
166 Ga0209758_1000199 3300025297 Bacteria 133164
167 Ga0209758_1010766 3300025297 Bacteria 5417
168 Ga0209050_1000072 3300025298 Bacteria 293619
169 Ga0209050_1000100 3300025298 Bacteria 231385
170 Ga0209050_1000133 3300025298 Bacteria 184688
171 Ga0209050_1011456 3300025298 Bacteria 4199
172 Ga0209050_1076348 3300025298 Bacteria 728
173 Ga0209256_1000206 3300025299 Bacteria 111425
174 Ga0207426_1000049 3300025302 Bacteria 401954
175 Ga0209051_1000015 3300025303 Bacteria 546798
176 Ga0209051_1000067 3300025303 Bacteria 227181
177 Ga0209051_1000255 3300025303 Bacteria 89418
178 Ga0209051_1000370 3300025303 Bacteria 64642
179 Ga0209051_1000440 3300025303 Bacteria 56410
180 Ga0209051_1012891 3300025303 Bacteria 4015
181 Ga0209257_1000037 3300025304 Bacteria 612915
182 Ga0209257_1000095 3300025304 Bacteria 259437
183 Ga0209257_1006840 3300025304 Bacteria 7161
184 Ga0209257_1020393 3300025304 Bacteria 2452
185 Ga0207656_10003746 3300025321 Bacteria 5265
186 Ga0207655_1000689 3300025728 Bacteria 39302
187 Ga0207680_10119142 3300025903 Bacteria 1724
188 Ga0207671_10058924 3300025914 Bacteria 2847
189 Ga0207657_10196983 3300025919 Bacteria 1622
190 Ga0207681_10123126 3300025923 Bacteria 1905
191 Ga0207694_10035770 3300025924 Bacteria 3810
192 Ga0207706_10039768 3300025933 Bacteria 4170
193 Ga0207709_10000320 3300025935 Bacteria 52414
194 Ga0207709_10001078 3300025935 Bacteria 20070
195 Ga0207709_10137286 3300025935 Bacteria 1676
196 Ga0207689_10440047 3300025942 Bacteria 1089
197 Ga0207679_10013445 3300025945 Bacteria 5367
198 Ga0207667_10026911 3300025949 Bacteria 6274
199 Ga0207651_10586662 3300025960 Bacteria 973
200 Ga0207658_10015383 3300025986 Bacteria 5249
201 Ga0207658_10283979 3300025986 Bacteria 1420
202 Ga0207677_10536402 3300026023 Bacteria 1017
203 Ga0207677_10741722 3300026023 Bacteria 875
204 Ga0207639_10002635 3300026041 Bacteria 12045
205 Ga0207674_10945018 3300026116 Bacteria 830
206 Ga0207683_10035227 3300026121 Bacteria 4353
207 Ga0207683_10214093 3300026121 Bacteria 1754
208 Ga0207698_10579277 3300026142 Bacteria 1104
209 Ga0207698_10875541 3300026142 Bacteria 904
210 Ga0209282_1000188 3300027666 Bacteria 32983
211 Ga0207428_10052866 3300027907 Bacteria 3241
212 Ga0307515_10004165 3300028794 Bacteria 30102
213 Ga0316177_1013268 3300030731 Bacteria 2828
214 Ga0314311_1021624 3300030733 Bacteria 8363
215 Ga0316179_1047388 3300030734 Bacteria 1911
216 Ga0316178_1101787 3300030735 Bacteria 822
217 Ga0316183_1001871 3300030742 Bacteria 11499
218 Ga0316181_1002978 3300030744 Bacteria 2419
219 Ga0316182_1278050 3300030745 Bacteria 4024
220 Ga0316182_1385976 3300030745 Bacteria 3640
221 Ga0265331_10013942 3300031250 Bacteria 4299
222 Ga0265327_10011972 3300031251 Bacteria 5910
223 Ga0307408_100000167 3300031548 Bacteria 73538
224 Ga0307408_100031931 3300031548 Bacteria 3669
225 Ga0307408_100070783 3300031548 Bacteria 2576
226 Ga0307408_100946052 3300031548 Bacteria 791
227 Ga0307514_10013497 3300031649 Bacteria 6774
228 Ga0307405_10081138 3300031731 Bacteria 2119
229 Ga0307405_10349844 3300031731 Bacteria 1139
230 Ga0307405_10881905 3300031731 Bacteria 755
231 Ga0307413_10772361 3300031824 Bacteria 805
232 Ga0307406_10003412 3300031901 Bacteria 8653
233 Ga0307406_10003983 3300031901 Bacteria 8033
234 Ga0307406_10516157 3300031901 Bacteria 971
235 Ga0307407_10896603 3300031903 Bacteria 680
236 Ga0307412_10007802 3300031911 Bacteria 6090
237 Ga0307412_10018922 3300031911 Bacteria 4157
238 Ga0307412_10109485 3300031911 Bacteria 1969
239 Ga0307414_10091756 3300032004 Bacteria 2258
240 Ga0307411_10085490 3300032005 Bacteria 2185
241 Ga0307411_10098085 3300032005 Bacteria 2064
242 Ga0307411_10163994 3300032005 Bacteria 1668
243 Ga0307411_10234157 3300032005 Bacteria 1433
244 Ga0307411_10236825 3300032005 Bacteria 1426
245 Ga0307411_10372355 3300032005 Bacteria 1172
246 Ga0307411_10724277 3300032005 Bacteria 869
247 Ga0439436_0009076 3300041404 Bacteria 3049
248 Ga0439436_0133061 3300041404 Bacteria 697
249 Ga0439438_042940 3300041405 Bacteria 1168
250 Ga0439438_044134 3300041405 Bacteria 1149
251 Ga0439439_0011018 3300041406 Bacteria 2169
252 Ga0439439_0045752 3300041406 Bacteria 1142
253 Ga0439447_025524 3300041407 Bacteria 1522
254 Ga0439447_054862 3300041407 Bacteria 945
255 Ga0439461_0009560 3300041410 Bacteria 1761
256 Ga0439461_0088585 3300041410 Bacteria 739
257 Ga0439466_0014983 3300041411 Bacteria 2817
258 Ga0439466_0023860 3300041411 Bacteria 2148
259 Ga0439466_0072464 3300041411 Bacteria 1095
260 Ga0439465_0011259 3300041413 Bacteria 2808
261 Ga0439465_0058969 3300041413 Bacteria 1269
262 Ga0451789_0403566 3300041443 Bacteria 737
263 Ga0451793_0651684 3300041452 Bacteria 926
264 Ga0451807_1200035 3300041486 Bacteria 725
265 Ga0439431_0030534 3300041997 Bacteria 1335
266 Ga0439433_0000209 3300041999 Bacteria 9561
267 Ga0439433_0031256 3300041999 Bacteria 1218
268 Ga0439442_006709 3300042002 Bacteria 2312
269 Ga0439445_0023153 3300042004 Bacteria 1571
270 Ga0439445_0029524 3300042004 Bacteria 1417
271 Ga0439445_0045881 3300042004 Bacteria 1170
272 Ga0439445_0065911 3300042004 Bacteria 997
273 Ga0439432_000191 3300042006 Bacteria 21948
274 Ga0439432_036257 3300042006 Bacteria 1578
275 Ga0439432_037055 3300042006 Bacteria 1558
276 Ga0439449_0002334 3300042007 Bacteria 7438
277 Ga0439449_0002704 3300042007 Bacteria 6904
278 Ga0439449_0018145 3300042007 Bacteria 2640
279 Ga0439449_0031768 3300042007 Bacteria 1968
280 Ga0439452_000437 3300042010 Bacteria 23932
281 Ga0439452_039728 3300042010 Bacteria 1112
282 Ga0439455_0088838 3300042012 Bacteria 846
283 Ga0439457_026395 3300042014 Bacteria 1286
284 Ga0439462_0029044 3300042015 Bacteria 1462
285 Ga0439462_0035855 3300042015 Bacteria 1319
286 Ga0450911_015435 3300042115 Bacteria 1011
287 Ga0450911_017100 3300042115 Bacteria 957
288 Ga0450921_000516 3300042123 Bacteria 1865
289 Ga0450923_005013 3300042125 Bacteria 2115
290 Ga0450923_028185 3300042125 Bacteria 1133
291 Ga0450897_001043 3300042128 Bacteria 1773
292 Ga0450894_008386 3300042131 Bacteria 1336
293 Ga0450898_003338 3300042134 Bacteria 2300
294 Ga0450906_000680 3300042145 Bacteria 7278
295 Ga0450907_015492 3300042146 Bacteria 1273
296 Ga0450910_001755 3300042147 Bacteria 2785
297 Ga0439446_0021480 3300042156 Bacteria 1824
298 Ga0439446_0126779 3300042156 Bacteria 825
299 Ga0450908_008597 3300042184 Bacteria 1911
300 Ga0450908_030045 3300042184 Bacteria 944
301 Ga0450909_002329 3300042185 Bacteria 2693
302 Ga0439434_0001295 3300042435 Bacteria 7199
303 Ga0439434_0039193 3300042435 Bacteria 1453
304 Ga0450918_008738 3300042531 Bacteria 1779
305 Ga0450893_0010795 3300042532 Bacteria 1504
306 Ga0450893_0049542 3300042532 Bacteria 785
307 Ga0466965_0017935 3300044683 Bacteria 3387
308 Ga0466957_1074514 3300044842 Bacteria 580
309 Ga0495627_006153 3300046453 Bacteria 4732
310 Ga0495629_0360920 3300046459 Bacteria 990
311 Ga0495629_0509214 3300046459 Bacteria 811
312 Ga0495638_0006266 3300046460 Bacteria 8685
313 Ga0495638_0007557 3300046460 Bacteria 7775
314 Ga0495639_0005608 3300046475 Bacteria 5404
315 Ga0495594_0252249 3300046499 Bacteria 1005
316 Ga0495607_0022049 3300046501 Bacteria 4004
317 Ga0495606_0103600 3300046507 Bacteria 1728
318 Ga0495610_0007865 3300046512 Bacteria 7010
319 Ga0495616_0004664 3300046513 Bacteria 8599
320 Ga0495620_0006209 3300046515 Bacteria 6583
321 Ga0495631_0000007 3300046518 Bacteria 130158
322 Ga0495631_0206010 3300046518 Bacteria 841
323 Ga0495632_0009981 3300046519 Bacteria 5665
324 Ga0495637_0002632 3300046520 Bacteria 9835
325 Ga0495637_0008941 3300046520 Bacteria 4902
326 Ga0495637_0037944 3300046520 Bacteria 2088
327 Ga0495643_0047620 3300046522 Bacteria 2321
328 Ga0495663_0027560 3300046525 Bacteria 1668
329 Ga0495654_0011667 3300046530 Bacteria 4747
330 Ga0495654_0018839 3300046530 Bacteria 3612
331 Ga0495654_0050512 3300046530 Bacteria 2032
332 Ga0495654_0199956 3300046530 Bacteria 856
333 Ga0495621_0003176 3300046539 Bacteria 4503
334 Ga0495622_0152792 3300046557 Bacteria 1044
335 Ga0495622_0164270 3300046557 Bacteria 1000
336 Ga0495633_0160685 3300046558 Bacteria 1037
337 Ga0495625_0000329 3300046660 Bacteria 72358
338 Ga0495625_0020265 3300046660 Bacteria 5137
339 Ga0495625_0059712 3300046660 Bacteria 2704
340 Ga0495661_0139518 3300046665 Bacteria 1320
341 Ga0495588_0130658 3300046674 Bacteria 1325
342 Ga0495658_0133002 3300046683 Bacteria 1516
343 Ga0495624_0105886 3300046690 Bacteria 1731
344 Ga0495671_0008992 3300046692 Bacteria 5605
345 Ga0495649_0007412 3300046694 Bacteria 6689
346 Ga0495649_0021868 3300046694 Bacteria 3582
347 Ga0495589_0006218 3300046794 Bacteria 6306
348 Ga0495660_0087303 3300046810 Bacteria 1627
349 Ga0495676_0113153 3300047321 Bacteria 1987
350 Ga0495681_0141199 3300047470 Bacteria 1017
351 Ga0495681_0168137 3300047470 Bacteria 909
352 Ga0495593_0121748 3300047673 Bacteria 1327
353 Ga0495602_0137363 3300048088 Bacteria 1940
354 Ga0495614_0015292 3300048089 Bacteria 3345
355 Ga0496100_0004437 3300048903 Bacteria 7438
356 Ga0496101_0001066 3300048904 Bacteria 16227
357 Ga0496101_0051980 3300048904 Bacteria 2953
358 Ga0496102_0018763 3300048905 Bacteria 6083
359 Ga0496103_0003524 3300048906 Bacteria 9563
360 Ga0496104_0000492 3300048907 Bacteria 34067
361 Ga0496105_0018916 3300048908 Bacteria 5548
362 Ga0496106_0040288 3300048909 Bacteria 3498
363 Ga0496107_0082402 3300048910 Bacteria 2346
364 Ga0496107_0967812 3300048910 Bacteria 618
365 Ga0496108_0049069 3300048911 Bacteria 3531
366 Ga0496109_0571048 3300048912 Bacteria 1066
367 Ga0496110_0040648 3300048913 Bacteria 4053
368 Ga0496110_0070394 3300048913 Bacteria 3099
369 Ga0496111_0043617 3300048914 Bacteria 3224
370 Ga0496113_0219179 3300048916 Bacteria 1516
371 Ga0496114_0051259 3300048917 Bacteria 3436
372 Ga0496116_0024915 3300048919 Bacteria 4411
373 Ga0496117_0081223 3300048920 Bacteria 2128
374 Ga0496117_0112833 3300048920 Bacteria 1689
375 Ga0496117_0284600 3300048920 Bacteria 883
376 Ga0496118_0033749 3300048921 Bacteria 4191
377 Ga0496118_0116765 3300048921 Bacteria 1752
378 Ga0496118_0148069 3300048921 Bacteria 1474
379 Ga0496118_0330614 3300048921 Bacteria 822
380 Ga0496121_0043886 3300048924 Bacteria 3865
381 Ga0496121_0096494 3300048924 Bacteria 2293
382 Ga0496122_0000319 3300048925 Bacteria 105543
383 Ga0496122_0189054 3300048925 Bacteria 1218
384 Ga0496122_0193809 3300048925 Bacteria 1196
385 Ga0496123_0000117 3300048926 Bacteria 161679
386 Ga0496123_0032350 3300048926 Bacteria 3789
387 Ga0496123_0110848 3300048926 Bacteria 1569
388 Ga0496123_0207319 3300048926 Bacteria 999
389 Ga0496123_0266256 3300048926 Bacteria 837
390 Ga0496124_0081463 3300048927 Bacteria 2660
391 Ga0496124_0134490 3300048927 Bacteria 1959
392 Ga0496124_0149861 3300048927 Bacteria 1831
393 Ga0496125_0037932 3300048928 Bacteria 4182
394 Ga0495678_174114 3300049459 Bacteria 679
395 Ga0501238_009950 3300049671 Bacteria 1266
396 Ga0501262_002177 3300049759 Bacteria 2219
397 nmdc:mga03683_1258_c1 3300050489 Bacteria 7511
398 nmdc:mga03683_33705_c1 3300050489 Bacteria 2069
399 nmdc:mga03683_48640_c1 3300050489 Bacteria 1763
400 nmdc:mga03683_82147_c1 3300050489 Bacteria 1393
401 nmdc:mga03n38_276698_c1 3300050490 Bacteria 895
402 nmdc:mga00v17_137766_c1 3300050491 Bacteria 1563
403 nmdc:mga00v17_2256_c1 3300050491 Bacteria 9872
404 nmdc:mga0yw44_2645_c1 3300050492 Bacteria 7716
405 nmdc:mga0yw44_334616_c1 3300050492 Bacteria 1018
406 nmdc:mga0k408_159898_c1 3300050493 Bacteria 1342
407 nmdc:mga0k408_385427_c1 3300050493 Bacteria 835
408 nmdc:mga0k408_396365_c1 3300050493 Bacteria 822
409 nmdc:mga0k408_63391_c1 3300050493 Bacteria 2150
410 nmdc:mga0k408_64248_c1 3300050493 Bacteria 2136
411 nmdc:mga0k408_785_c1 3300050493 Bacteria 17469
412 nmdc:mga06z11_214658_c1 3300050494 Bacteria 1122
413 nmdc:mga06z11_348643_c1 3300050494 Bacteria 886
414 nmdc:mga06z11_53589_c1 3300050494 Bacteria 2075
415 nmdc:mga07m45_109529_c1 3300050496 Bacteria 1590
416 nmdc:mga07m45_1301_c1 3300050496 Bacteria 11345
417 nmdc:mga07m45_16187_c1 3300050496 Bacteria 3992
418 nmdc:mga07m45_39113_c1 3300050496 Bacteria 2650
419 nmdc:mga07m45_90044_c1 3300050496 Bacteria 1757
420 nmdc:mga07m45_9092_c1 3300050496 Bacteria 5134
421 nmdc:mga0sz30_3421_c1 3300050516 Bacteria 5716
422 Ga0500610_0003655 3300053079 Bacteria 5955
423 Ga0500643_019448 3300053087 Bacteria 2234
424 Ga0500643_060439 3300053087 Bacteria 1065
425 Ga0500651_0003305 3300053093 Bacteria 8782
426 Ga0500569_011150 3300053109 Bacteria 2139
427 Ga0500571_000094 3300053110 Bacteria 28973
428 Ga0500572_059810 3300053111 Bacteria 1156
429 Ga0500592_006961 3300053116 Bacteria 1800
430 Ga0500593_000418 3300053117 Bacteria 16802
431 Ga0500594_0002466 3300053118 Bacteria 4024
432 Ga0500607_007240 3300053121 Bacteria 6883
433 Ga0500608_086187 3300053122 Bacteria 1475
434 Ga0500626_011614 3300053128 Bacteria 3742
435 Ga0500628_064217 3300053129 Bacteria 904
436 Ga0500655_002551 3300053133 Bacteria 3307
437 Ga0500658_0000294 3300053134 Bacteria 22583
438 Ga0500658_0006263 3300053134 Bacteria 4423
439 Ga0500559_0019648 3300053136 Bacteria 2854
440 Ga0500559_0049493 3300053136 Bacteria 1851
441 Ga0500564_021741 3300053138 Bacteria 2940
442 Ga0500568_0000934 3300053139 Bacteria 20169
443 Ga0500616_0024757 3300053153 Bacteria 3332
444 Ga0500634_0005044 3300053161 Bacteria 6217
445 Ga0500634_0100346 3300053161 Bacteria 1450
446 Ga0500638_025511 3300053162 Bacteria 2826
447 Ga0500636_0100672 3300053177 Bacteria 1643
448 Ga0500625_113578 3300053729 Bacteria 1105
449 2599620793 2599185214 Bacteria 8209958
450 2599674092 2599185226 Bacteria 8233575
451 2599678591 2599185227 Bacteria 8246414
452 2599690304 2599185229 Bacteria 8216126
453 2643844575 2643221565 Bacteria 6216018
454 2644161405 2643221628 Bacteria 5745828
455 2644400685 2643221672 Bacteria 6322190
456 2644465927 2643221683 Bacteria 5749203
457 2738720643 2738541277 Bacteria 7458140
458 2738886266 2738541307 Bacteria 8606193
459 2739249510 2738543013 Bacteria 5618633
460 2739279842 2738543019 Bacteria 7459457
461 2819601326 2818991446 Bacteria 7757362
462 2831269747 2831265667 Bacteria 7184833
463 2838055235 2838054893 Bacteria 7451788
464 2842682354 2842677519 Bacteria 5615038
465 2842734069 2842733646 Bacteria 5716726
466 2842749655 2842747753 Bacteria 5578255
467 2885196767 2885192300 Bacteria 5882526
468 2885201678 2885198086 Bacteria 7212419
469 2885215611 2885211737 Bacteria 7212420
470 2899927325 2899924645 Bacteria 7487985
471 2904450963 2904449895 Bacteria 6927402
472 2904459534 2904456579 Bacteria 6819253
473 2904549224 2904541872 Bacteria 8915136
474 2919465493 2919462493 Bacteria 5817112
475 2928042761 2928037797 Bacteria 7273642
476 2928048812 2928044640 Bacteria 7271509
477 2928055144 2928051484 Bacteria 7773759
478 2928068570 2928064002 Bacteria 7419480
479 2928073521 2928070936 Bacteria 8062541
480 2928089776 2928084124 Bacteria 7159212
481 2928117182 2928115317 Bacteria 6477646
482 2929161400 2929160207 Bacteria 9075316
483 2929521648 2929520902 Bacteria 6765052
484 2945914139 2945909444 Bacteria 7065066
485 2945949715 2945945610 Bacteria 5951079
486 2945973740 2945972063 Bacteria 6086495
487 2945990480 2945984333 Bacteria 7358892
488 2954770671 2954767861 Bacteria 5535784
489 8056178407 8056177738 Bacteria 6748268
490 Ga0068871_100723415
491 JGI24739J22299_10034404
492 JGI25152J39213_1008454
493 JGI25152J39213_1011392
494 JGI25150J39212_1001338
495 JGI25150J39212_1025187
496 JGI25159J45721_1019865
497 JGI25151J46595_10008110
498 JGI25151J46595_10024029
499 JGI25153J46596_10018236
500 rootH1_10061875
501 rootH1_10067267
502 rootH1_10401955
503 JGI25160J50197_1022931
504 JGI25161J50226_1001469
505 Ga0006562J51391_1022160
506 Ga0006562J51391_1022162
507 Ga0006562J51391_1080333
508 Ga0006562J51391_1080335
509 Ga0055535_1000069
510 Ga0055542_1000084
511 Ga0055526_1005138
512 Ga0055537_1000232
513 Ga0055537_1002044
514 Ga0055524_1003484
515 Ga0055536_1007752
516 Ga0055536_1021169
517 Ga0055534_1000212
518 Ga0055534_1000240
519 Ga0055534_1007758
520 Ga0055534_1033401
521 Ga0055528_1004089
522 Ga0055528_1007620
523 Ga0055530_10001195
524 Ga0055540_1001630
525 Ga0055540_1002823
526 Ga0055540_1003994
527 Ga0055540_1009083
528 Ga0055540_1017682
529 Ga0055531_10001733
530 Ga0055531_10019548
531 Ga0055531_10027677
532 Ga0055543_1000698
533 Ga0065165_1004952
534 Ga0065165_1020984
535 Ga0065714_10006388
536 Ga0065704_10133246
537 Ga0070666_10176067
538 Ga0068868_100310334
539 Ga0070660_100463867
540 Ga0070661_100093447
541 Ga0070668_100145027
542 Ga0070669_100016550
543 Ga0070671_100030070
544 Ga0070674_100383050
545 Ga0070674_100524837
546 Ga0070659_100659215
547 Ga0070659_101499318
548 Ga0070667_100095104
549 Ga0070667_100211750
550 Ga0070678_100226468
551 Ga0070678_100257174
552 Ga0070662_100068200
553 Ga0070662_100769609
554 Ga0068867_100805987
555 Ga0068853_100239204
556 Ga0068855_100043769
557 Ga0070664_100006820
558 Ga0068854_100655687
559 Ga0068852_100144373
560 Ga0068852_100294452
561 Ga0068851_10006495
562 Ga0075365_10027126
563 Ga0075363_100002982
564 Ga0075363_100008315
565 Ga0075363_100069599
566 Ga0075363_100105678
567 Ga0075363_100325339
568 Ga0075364_10008381
569 Ga0075364_10228577
570 Ga0075432_10003135
571 Ga0075362_10005466
572 Ga0075362_10011171
573 Ga0075362_10058674
574 Ga0075362_10102834
575 Ga0075366_10002056
576 Ga0075366_10023943
577 Ga0075366_10051080
578 Ga0075366_10063212
579 Ga0075366_10128515
580 Ga0075370_10000501
581 Ga0075370_10001916
582 Ga0075370_10014095
583 Ga0075370_10029649
584 Ga0075370_10121749
585 Ga0075370_10187951
586 Ga0075370_10200331
587 Ga0068871_100169454
588 Ga0068871_100193530
589 Ga0099826_10000873
590 Ga0099826_10124680
591 Ga0105244_10005868
592 Ga0105240_10077823
593 Ga0105245_10209977
594 Ga0105243_10004578
595 Ga0105243_10008424
596 Ga0105243_10102686
597 Ga0105242_11428300
598 Ga0105248_11062524
599 Ga0105237_10061664
600 Ga0105238_10500816
601 Ga0105239_10084524
602 Ga0157373_10013592
603 Ga0157373_10605655
604 Ga0157370_10020546
605 Ga0157370_10762022
606 Ga0157375_10101939
607 Ga0163163_10402265
608 Ga0182008_10000065
609 Ga0182008_10001055
610 Ga0182008_10002045
611 Ga0182008_10003530
612 Ga0182008_10026117
613 Ga0182008_10026495
614 Ga0157376_11154099
615 Ga0182006_1000912
616 Ga0182006_1037433
617 Ga0182006_1190196
618 Ga0182007_10000369
619 Ga0182007_10141774
620 Ga0182005_1045924
621 Ga0182005_1049787
622 Ga0183362_10003
623 Ga0163161_10001053
624 Ga0163161_10166953
625 Ga0163161_10892754
626 Ga0209436_101775
627 Ga0209672_100822
628 Ga0209147_100554
629 Ga0209258_100093
630 Ga0207425_1000552
631 Ga0207425_1012510
632 Ga0209148_1000007
633 Ga0209129_1000147
634 Ga0209565_1000117
635 Ga0209565_1000282
636 Ga0209565_1009059
637 Ga0209673_1000218
638 Ga0209673_1001256
639 Ga0209130_1001555
640 Ga0209130_1007259
641 Ga0209675_1000113
642 Ga0209675_1000745
643 Ga0209675_1006270
644 Ga0209675_1037842
645 Ga0209676_1000028
646 Ga0209676_1000135
647 Ga0209676_1000216
648 Ga0209676_1000486
649 Ga0209676_1005087
650 Ga0209025_1000503
651 Ga0209025_1001127
652 Ga0209025_1015406
653 Ga0209025_1073805
654 Ga0209564_1000327
655 Ga0209758_1000199
656 Ga0209758_1010766
657 Ga0209050_1000072
658 Ga0209050_1000100
659 Ga0209050_1000133
660 Ga0209050_1011456
661 Ga0209050_1076348
662 Ga0209256_1000206
663 Ga0207426_1000049
664 Ga0209051_1000015
665 Ga0209051_1000067
666 Ga0209051_1000255
667 Ga0209051_1000370
668 Ga0209051_1000440
669 Ga0209051_1012891
670 Ga0209257_1000037
671 Ga0209257_1000095
672 Ga0209257_1006840
673 Ga0209257_1020393
674 Ga0207656_10003746
675 Ga0207655_1000689
676 Ga0207680_10119142
677 Ga0207671_10058924
678 Ga0207657_10196983
679 Ga0207681_10123126
680 Ga0207694_10035770
681 Ga0207706_10039768
682 Ga0207709_10000320
683 Ga0207709_10001078
684 Ga0207709_10137286
685 Ga0207689_10440047
686 Ga0207679_10013445
687 Ga0207667_10026911
688 Ga0207651_10586662
689 Ga0207658_10015383
690 Ga0207658_10283979
691 Ga0207677_10536402
692 Ga0207677_10741722
693 Ga0207639_10002635
694 Ga0207674_10945018
695 Ga0207683_10035227
696 Ga0207683_10214093
697 Ga0207698_10579277
698 Ga0207698_10875541
699 Ga0209282_1000188
700 Ga0207428_10052866
701 Ga0307515_10004165
702 Ga0316177_1013268
703 Ga0314311_1021624
704 Ga0316179_1047388
705 Ga0316178_1101787
706 Ga0316183_1001871
707 Ga0316181_1002978
708 Ga0316182_1278050
709 Ga0316182_1385976
710 Ga0265331_10013942
711 Ga0265327_10011972
712 Ga0307408_100000167
713 Ga0307408_100031931
714 Ga0307408_100070783
715 Ga0307408_100946052
716 Ga0307514_10013497
717 Ga0307405_10081138
718 Ga0307405_10349844
719 Ga0307405_10881905
720 Ga0307413_10772361
721 Ga0307406_10003412
722 Ga0307406_10003983
723 Ga0307406_10516157
724 Ga0307407_10896603
725 Ga0307412_10007802
726 Ga0307412_10018922
727 Ga0307412_10109485
728 Ga0307414_10091756
729 Ga0307411_10085490
730 Ga0307411_10098085
731 Ga0307411_10163994
732 Ga0307411_10234157
733 Ga0307411_10236825
734 Ga0307411_10372355
735 Ga0307411_10724277
736 Ga0439436_0009076
737 Ga0439436_0133061
738 Ga0439438_042940
739 Ga0439438_044134
740 Ga0439439_0011018
741 Ga0439439_0045752
742 Ga0439447_025524
743 Ga0439447_054862
744 Ga0439461_0009560
745 Ga0439461_0088585
746 Ga0439466_0014983
747 Ga0439466_0023860
748 Ga0439466_0072464
749 Ga0439465_0011259
750 Ga0439465_0058969
751 Ga0451789_0403566
752 Ga0451793_0651684
753 Ga0451807_1200035
754 Ga0439431_0030534
755 Ga0439433_0000209
756 Ga0439433_0031256
757 Ga0439442_006709
758 Ga0439445_0023153
759 Ga0439445_0029524
760 Ga0439445_0045881
761 Ga0439445_0065911
762 Ga0439432_000191
763 Ga0439432_036257
764 Ga0439432_037055
765 Ga0439449_0002334
766 Ga0439449_0002704
767 Ga0439449_0018145
768 Ga0439449_0031768
769 Ga0439452_000437
770 Ga0439452_039728
771 Ga0439455_0088838
772 Ga0439457_026395
773 Ga0439462_0029044
774 Ga0439462_0035855
775 Ga0450911_015435
776 Ga0450911_017100
777 Ga0450921_000516
778 Ga0450923_005013
779 Ga0450923_028185
780 Ga0450897_001043
781 Ga0450894_008386
782 Ga0450898_003338
783 Ga0450906_000680
784 Ga0450907_015492
785 Ga0450910_001755
786 Ga0439446_0021480
787 Ga0439446_0126779
788 Ga0450908_008597
789 Ga0450908_030045
790 Ga0450909_002329
791 Ga0439434_0001295
792 Ga0439434_0039193
793 Ga0450918_008738
794 Ga0450893_0010795
795 Ga0450893_0049542
796 Ga0466965_0017935
797 Ga0466957_1074514
798 Ga0495627_006153
799 Ga0495629_0360920
800 Ga0495629_0509214
801 Ga0495638_0006266
802 Ga0495638_0007557
803 Ga0495639_0005608
804 Ga0495594_0252249
805 Ga0495607_0022049
806 Ga0495606_0103600
807 Ga0495610_0007865
808 Ga0495616_0004664
809 Ga0495620_0006209
810 Ga0495631_0000007
811 Ga0495631_0206010
812 Ga0495632_0009981
813 Ga0495637_0002632
814 Ga0495637_0008941
815 Ga0495637_0037944
816 Ga0495643_0047620
817 Ga0495663_0027560
818 Ga0495654_0011667
819 Ga0495654_0018839
820 Ga0495654_0050512
821 Ga0495654_0199956
822 Ga0495621_0003176
823 Ga0495622_0152792
824 Ga0495622_0164270
825 Ga0495633_0160685
826 Ga0495625_0000329
827 Ga0495625_0020265
828 Ga0495625_0059712
829 Ga0495661_0139518
830 Ga0495588_0130658
831 Ga0495658_0133002
832 Ga0495624_0105886
833 Ga0495671_0008992
834 Ga0495649_0007412
835 Ga0495649_0021868
836 Ga0495589_0006218
837 Ga0495660_0087303
838 Ga0495676_0113153
839 Ga0495681_0141199
840 Ga0495681_0168137
841 Ga0495593_0121748
842 Ga0495602_0137363
843 Ga0495614_0015292
844 Ga0496100_0004437
845 Ga0496101_0001066
846 Ga0496101_0051980
847 Ga0496102_0018763
848 Ga0496103_0003524
849 Ga0496104_0000492
850 Ga0496105_0018916
851 Ga0496106_0040288
852 Ga0496107_0082402
853 Ga0496107_0967812
854 Ga0496108_0049069
855 Ga0496109_0571048
856 Ga0496110_0040648
857 Ga0496110_0070394
858 Ga0496111_0043617
859 Ga0496113_0219179
860 Ga0496114_0051259
861 Ga0496116_0024915
862 Ga0496117_0081223
863 Ga0496117_0112833
864 Ga0496117_0284600
865 Ga0496118_0033749
866 Ga0496118_0116765
867 Ga0496118_0148069
868 Ga0496118_0330614
869 Ga0496121_0043886
870 Ga0496121_0096494
871 Ga0496122_0000319
872 Ga0496122_0189054
873 Ga0496122_0193809
874 Ga0496123_0000117
875 Ga0496123_0032350
876 Ga0496123_0110848
877 Ga0496123_0207319
878 Ga0496123_0266256
879 Ga0496124_0081463
880 Ga0496124_0134490
881 Ga0496124_0149861
882 Ga0496125_0037932
883 Ga0495678_174114
884 Ga0501238_009950
885 Ga0501262_002177
886 nmdc:mga03683_1258_c1
887 nmdc:mga03683_33705_c1
888 nmdc:mga03683_48640_c1
889 nmdc:mga03683_82147_c1
890 nmdc:mga03n38_276698_c1
891 nmdc:mga00v17_137766_c1
892 nmdc:mga00v17_2256_c1
893 nmdc:mga0yw44_2645_c1
894 nmdc:mga0yw44_334616_c1
895 nmdc:mga0k408_159898_c1
896 nmdc:mga0k408_385427_c1
897 nmdc:mga0k408_396365_c1
898 nmdc:mga0k408_63391_c1
899 nmdc:mga0k408_64248_c1
900 nmdc:mga0k408_785_c1
901 nmdc:mga06z11_214658_c1
902 nmdc:mga06z11_348643_c1
903 nmdc:mga06z11_53589_c1
904 nmdc:mga07m45_109529_c1
905 nmdc:mga07m45_1301_c1
906 nmdc:mga07m45_16187_c1
907 nmdc:mga07m45_39113_c1
908 nmdc:mga07m45_90044_c1
909 nmdc:mga07m45_9092_c1
910 nmdc:mga0sz30_3421_c1
911 Ga0500610_0003655
912 Ga0500643_019448
913 Ga0500643_060439
914 Ga0500651_0003305
915 Ga0500569_011150
916 Ga0500571_000094
917 Ga0500572_059810
918 Ga0500592_006961
919 Ga0500593_000418
920 Ga0500594_0002466
921 Ga0500607_007240
922 Ga0500608_086187
923 Ga0500626_011614
924 Ga0500628_064217
925 Ga0500655_002551
926 Ga0500658_0000294
927 Ga0500658_0006263
928 Ga0500559_0019648
929 Ga0500559_0049493
930 Ga0500564_021741
931 Ga0500568_0000934
932 Ga0500616_0024757
933 Ga0500634_0005044
934 Ga0500634_0100346
935 Ga0500638_025511
936 Ga0500636_0100672
937 Ga0500625_113578
938 2599620793
939 2599674092
940 2599678591
941 2599690304
942 2643844575
943 2644161405
944 2644400685
945 2644465927
946 2738720643
947 2738886266
948 2739249510
949 2739279842
950 2819601326
951 2831269747
952 2838055235
953 2842682354
954 2842734069
955 2842749655
956 2885196767
957 2885201678
958 2885215611
959 2899927325
960 2904450963
961 2904459534
962 2904549224
963 2919465493
964 2928042761
965 2928048812
966 2928055144
967 2928068570
968 2928073521
969 2928089776
970 2928117182
971 2929161400
972 2929521648
973 2945914139
974 2945949715
975 2945973740
976 2945990480
977 2954770671
978 8056178407

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02308

MgtC

MgtC family

33

159

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
8byi-assembly1.cif.gz_A alvinella pompejana nicotinic acetylcholine receptor alpo4 in complex with chaps(alpo4_chaps) 0.4522 55 160
1yo7-assembly2.cif.gz_B re-engineering topology of the homodimeric rop protein into a single-chain 4-helix bundle 0.4326 26 134
1yo7-assembly2.cif.gz_B re-engineering topology of the homodimeric rop protein into a single-chain 4-helix bundle 0.4072 26 134
6pls-assembly1.cif.gz_A cryoem structure of zebra fish alpha-1 glycine receptor bound with taurine in nanodisc, desensitized state 0.3864 57 162
4dbl-assembly2.cif.gz_F crystal structure of e159q mutant of btucdf 0.382 25 146
ID Description Score Start End Superfamily
af_I6YBN6_13_134_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.9239 32 154 1.10.10.1740
af_I6YBN6_13_134_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.8877 32 154 1.10.10.1740
af_P0AFV2_9_138_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.8848 32 155 1.10.10.1740
af_P0AFV2_9_138_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.8397 32 155 1.10.10.1740
af_Q9VYW6_178_371_1.20.1540.10 Mainly Alpha;Up-down Bundle;Rhomboid-like fold;Rhomboid-like 0.6049 29 130 1.20.1540.10
ID Description Score Start End GO Terms
AF-A0A1G7Z609-F1-model_v4 Protein MgtC 0.953 25 154 GO:0005886
AF-A0A1M4YUW1-F1-model_v4 Protein MgtC 0.9404 20 156 GO:0005886
AF-A0A4Q5PCM1-F1-model_v4 Protein MgtC 0.9392 5 163 GO:0005886
AF-A0A7T9FJY9-F1-model_v4 deleted 0.9378 20 159
AF-O51796-F1-model_v4 Protein MgtC 0.9364 32 153 GO:0005886

Map