F453773

General Info

Members Datasets Scaffolds Average Seq Length
489 307 978 132

Family's Representative Sequence

Representative Sequence 3300009177|Ga0105248_12027787|Ga0105248_120277871
Length 131
Sequence MTKHMDINLPDVLAEVTAAFERYETALVGNDVAVLDELFWDSPHTLRYGVTENLYGYEEIRSFRAGRSSLGLQRALLRRVITTYGRDFATANVEFQRTGNGKTGRQSQTWMRTPEGWRVVCAHVSLLSPPS

Samples

Sample ID Description Type Environment
1 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
2 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
3 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
42 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
43 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
44 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
45 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
48 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
51 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
52 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
53 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
54 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
55 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
59 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
60 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
66 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
67 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
68 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
74 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
75 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
76 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
77 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
78 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
79 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
80 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
82 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
84 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
128 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
129 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
130 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
134 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
135 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
136 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
137 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
138 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
139 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
140 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
141 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
142 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
143 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
144 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
145 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
146 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
147 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
148 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
149 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
150 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
151 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
152 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
153 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
154 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
155 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
156 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
157 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
158 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
159 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
160 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
161 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
162 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
163 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
164 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
165 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
166 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
167 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
168 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
169 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
170 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
171 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
172 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
173 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
174 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
175 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
176 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
177 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
178 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
179 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
180 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
181 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
182 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
183 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
184 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
185 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
186 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
187 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
188 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
189 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
190 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
191 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
192 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
193 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
194 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
195 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
196 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
197 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
198 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
199 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
200 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
201 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
202 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
203 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
204 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
205 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
206 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
207 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
208 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
209 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
210 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
211 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
212 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
213 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
214 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
215 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
216 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
217 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
218 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
219 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
220 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
221 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
222 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
223 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
224 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
225 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
226 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
227 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
228 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
229 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
230 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
231 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
232 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
233 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
234 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
235 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
236 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
237 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
238 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
239 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
240 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
241 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
242 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
243 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
244 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
245 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
246 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
247 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
248 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
249 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
250 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
251 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
252 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
253 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
254 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
255 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
256 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
257 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
258 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
259 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
260 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
261 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
262 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
263 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
264 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
265 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
266 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
267 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
268 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
269 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
270 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
271 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
272 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
273 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
274 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
275 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
276 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
277 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
278 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
279 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
280 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
281 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
282 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
283 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
284 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
285 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
286 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
287 2829745981 Methylorubrum rhodinum DSM 2163 Isolate Rhizosphere
288 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
289 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
290 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
291 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
292 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
293 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
294 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
295 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
296 2906610324
297 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
298 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
299 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
300 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
301 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
302 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
303 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
304 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
305 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
306 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
307 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 94.67
Metatranscriptomes 0.2
Isolates 5.12

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.93
Nodule 4.5
Rhizoplane 5.52
Rhizosphere 73.62
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105248_12027787 3300009177 Bacteria 654
2 JGI25165J46597_1009920 3300003214 Bacteria 1407
3 JGI25404J52841_10089598 3300003659 Bacteria 643
4 Ga0070658_10087090 3300005327 Bacteria 2570
5 Ga0070676_10273287 3300005328 Bacteria 1136
6 Ga0070683_100149322 3300005329 Bacteria 2215
7 Ga0068868_100152878 3300005338 Bacteria 1901
8 Ga0070660_100022483 3300005339 Bacteria 4663
9 Ga0070691_10268441 3300005341 Bacteria 921
10 Ga0070661_100015019 3300005344 Bacteria 5464
11 Ga0070668_100293092 3300005347 Bacteria 1362
12 Ga0070668_101486167 3300005347 Bacteria 619
13 Ga0070675_100148174 3300005354 Bacteria 2011
14 Ga0070675_101007065 3300005354 Bacteria 765
15 Ga0070671_100271995 3300005355 Bacteria 1440
16 Ga0070674_100044306 3300005356 Bacteria 3032
17 Ga0070673_100146004 3300005364 Bacteria 1999
18 Ga0070659_100151934 3300005366 Bacteria 1889
19 Ga0070659_100250270 3300005366 Bacteria 1468
20 Ga0070709_10001435 3300005434 Bacteria 12865
21 Ga0070709_10484042 3300005434 Bacteria 937
22 Ga0070709_10613433 3300005434 Bacteria 839
23 Ga0070709_11529817 3300005434 Bacteria 542
24 Ga0070714_100013189 3300005435 Bacteria 6615
25 Ga0070714_100448963 3300005435 Bacteria 1225
26 Ga0070714_100579648 3300005435 Bacteria 1076
27 Ga0070713_100051353 3300005436 Bacteria 3409
28 Ga0070713_100077791 3300005436 Bacteria 2822
29 Ga0070713_100139161 3300005436 Bacteria 2148
30 Ga0070713_100336514 3300005436 Bacteria 1397
31 Ga0070713_100516567 3300005436 Bacteria 1128
32 Ga0070710_10006535 3300005437 Bacteria 5605
33 Ga0070711_100066959 3300005439 Bacteria 2518
34 Ga0070711_100428904 3300005439 Bacteria 1079
35 Ga0070711_100845248 3300005439 Bacteria 778
36 Ga0070663_100283391 3300005455 Bacteria 1321
37 Ga0070678_101216926 3300005456 Bacteria 699
38 Ga0070662_100116279 3300005457 Bacteria 2044
39 Ga0070662_100679215 3300005457 Bacteria 870
40 Ga0070662_101441063 3300005457 Bacteria 594
41 Ga0070706_100620069 3300005467 Bacteria 1005
42 Ga0070706_101194286 3300005467 Bacteria 699
43 Ga0070707_100947043 3300005468 Bacteria 826
44 Ga0070698_100164481 3300005471 Bacteria 2162
45 Ga0070698_100599600 3300005471 Bacteria 1042
46 Ga0070698_101488127 3300005471 Bacteria 628
47 Ga0070698_101736984 3300005471 Bacteria 576
48 Ga0070679_100001939 3300005530 Bacteria 18580
49 Ga0070679_100563446 3300005530 Bacteria 1083
50 Ga0070697_100383817 3300005536 Bacteria 1217
51 Ga0070672_100434082 3300005543 Bacteria 1129
52 Ga0070665_100739454 3300005548 Bacteria 997
53 Ga0068855_100339210 3300005563 Bacteria 1657
54 Ga0068855_100455126 3300005563 Bacteria 1396
55 Ga0070664_100146157 3300005564 Bacteria 2085
56 Ga0070664_100153835 3300005564 Bacteria 2031
57 Ga0068854_100036816 3300005578 Bacteria 3431
58 Ga0068856_100672415 3300005614 Bacteria 1056
59 Ga0068856_100978615 3300005614 Bacteria 864
60 Ga0068859_100934859 3300005617 Bacteria 951
61 Ga0068859_101442794 3300005617 Bacteria 759
62 Ga0068864_100065276 3300005618 Bacteria 3158
63 Ga0068864_100522175 3300005618 Bacteria 1145
64 Ga0068851_10363229 3300005834 Bacteria 845
65 Ga0068863_100234969 3300005841 Bacteria 1769
66 Ga0068858_100088528 3300005842 Bacteria 2880
67 Ga0068858_100330389 3300005842 Bacteria 1458
68 Ga0081540_1143933 3300005983 Bacteria 952
69 Ga0081540_1319332 3300005983 Bacteria 533
70 Ga0070717_10019819 3300006028 Bacteria 5280
71 Ga0070717_10042539 3300006028 Bacteria 3705
72 Ga0070717_10077195 3300006028 Bacteria 2788
73 Ga0070717_10660880 3300006028 Bacteria 949
74 Ga0070715_10015520 3300006163 Bacteria 2843
75 Ga0070716_100001410 3300006173 Bacteria 10662
76 Ga0070716_100030779 3300006173 Bacteria 2916
77 Ga0070716_100294608 3300006173 Bacteria 1126
78 Ga0070712_100007612 3300006175 Bacteria 6771
79 Ga0070712_100095004 3300006175 Bacteria 2192
80 Ga0070712_100790051 3300006175 Bacteria 814
81 Ga0097621_100797694 3300006237 Bacteria 875
82 Ga0097621_101734645 3300006237 Bacteria 595
83 Ga0075370_10738059 3300006353 Bacteria 599
84 Ga0068865_100762005 3300006881 Bacteria 832
85 Ga0097620_100556928 3300006931 Bacteria 1241
86 Ga0097620_100934993 3300006931 Bacteria 951
87 Ga0097620_101442599 3300006931 Bacteria 759
88 Ga0099825_1026268 3300006941 Bacteria 3123
89 Ga0099824_1046661 3300006942 Bacteria 885
90 Ga0099823_1022824 3300006944 Bacteria 5771
91 Ga0099794_10008383 3300007265 Bacteria 4291
92 Ga0099794_10065841 3300007265 Bacteria 1767
93 Ga0099795_10088823 3300007788 Bacteria 1195
94 Ga0099795_10121080 3300007788 Bacteria 1046
95 Ga0099795_10220298 3300007788 Bacteria 807
96 Ga0105251_10193015 3300009011 Bacteria 917
97 Ga0105240_10003161 3300009093 Bacteria 25902
98 Ga0105240_10413686 3300009093 Bacteria 1516
99 Ga0105245_10724081 3300009098 Bacteria 1029
100 Ga0105247_10180626 3300009101 Bacteria 1408
101 Ga0105241_10035840 3300009174 Bacteria 3732
102 Ga0105241_10428326 3300009174 Bacteria 1166
103 Ga0105237_10051619 3300009545 Bacteria 4130
104 Ga0105237_10211826 3300009545 Bacteria 1938
105 Ga0105237_10644010 3300009545 Bacteria 1067
106 Ga0105238_10032301 3300009551 Bacteria 5326
107 Ga0105238_10078151 3300009551 Bacteria 3300
108 Ga0105238_11127497 3300009551 Bacteria 808
109 Ga0105238_11915690 3300009551 Bacteria 626
110 Ga0105249_10436621 3300009553 Bacteria 1346
111 Ga0105249_13056331 3300009553 Bacteria 537
112 Ga0099796_10211298 3300010159 Bacteria 791
113 Ga0105239_10068017 3300010375 Bacteria 3914
114 Ga0105239_10514686 3300010375 Bacteria 1361
115 Ga0105239_10700060 3300010375 Bacteria 1158
116 Ga0105246_10317827 3300011119 Bacteria 1264
117 Ga0105246_10686278 3300011119 Bacteria 896
118 Ga0157373_11304146 3300013100 Bacteria 550
119 Ga0157374_10301431 3300013296 Bacteria 1585
120 Ga0157378_10022522 3300013297 Bacteria 5543
121 Ga0157378_10157175 3300013297 Bacteria 2123
122 Ga0163162_10145423 3300013306 Bacteria 2486
123 Ga0157372_10043623 3300013307 Bacteria 4966
124 Ga0157375_10342951 3300013308 Bacteria 1659
125 Ga0163163_10609836 3300014325 Bacteria 1155
126 Ga0163163_11463826 3300014325 Bacteria 744
127 Ga0157379_10401809 3300014968 Bacteria 1260
128 Ga0157379_12004793 3300014968 Bacteria 572
129 Ga0157376_10144611 3300014969 Bacteria 2137
130 Ga0157376_11627529 3300014969 Bacteria 680
131 Ga0182007_10028829 3300015262 Bacteria 1904
132 Ga0213872_10044103 3300021361 Bacteria 2031
133 Ga0213874_10136980 3300021377 Bacteria 845
134 Ga0213875_10393813 3300021388 Bacteria 660
135 Ga0213871_10003226 3300021441 Bacteria 3117
136 Ga0209677_100635 3300025253 Bacteria 18690
137 Ga0209233_1004670 3300025261 Bacteria 4625
138 Ga0209455_1005444 3300025272 Bacteria 3931
139 Ga0209758_1066033 3300025297 Bacteria 1164
140 Ga0207692_10011486 3300025898 Bacteria 3771
141 Ga0207692_10024941 3300025898 Bacteria 2787
142 Ga0207710_10066547 3300025900 Bacteria 1644
143 Ga0207685_10008958 3300025905 Bacteria 2884
144 Ga0207699_10000386 3300025906 Bacteria 23177
145 Ga0207699_10001899 3300025906 Bacteria 9840
146 Ga0207699_10304898 3300025906 Bacteria 1113
147 Ga0207699_11381919 3300025906 Bacteria 521
148 Ga0207645_10138457 3300025907 Bacteria 1586
149 Ga0207705_10111086 3300025909 Bacteria 2025
150 Ga0207705_10174806 3300025909 Bacteria 1618
151 Ga0207684_10379701 3300025910 Bacteria 1215
152 Ga0207684_10831996 3300025910 Bacteria 779
153 Ga0207654_10250753 3300025911 Bacteria 1186
154 Ga0207695_10587729 3300025913 Bacteria 995
155 Ga0207693_10000774 3300025915 Bacteria 28742
156 Ga0207693_10003263 3300025915 Bacteria 13891
157 Ga0207663_10001349 3300025916 Bacteria 11352
158 Ga0207663_10217847 3300025916 Bacteria 1387
159 Ga0207663_10801125 3300025916 Bacteria 750
160 Ga0207663_10872262 3300025916 Bacteria 719
161 Ga0207657_10005108 3300025919 Bacteria 13749
162 Ga0207657_10022273 3300025919 Bacteria 5935
163 Ga0207657_10226695 3300025919 Bacteria 1495
164 Ga0207649_10447387 3300025920 Bacteria 974
165 Ga0207659_10063733 3300025926 Bacteria 2666
166 Ga0207687_10373739 3300025927 Bacteria 1166
167 Ga0207700_10066276 3300025928 Bacteria 2759
168 Ga0207700_10951131 3300025928 Bacteria 769
169 Ga0207664_10121406 3300025929 Bacteria 2187
170 Ga0207664_10307164 3300025929 Bacteria 1397
171 Ga0207664_10726701 3300025929 Bacteria 893
172 Ga0207690_10134236 3300025932 Bacteria 1815
173 Ga0207706_10133411 3300025933 Bacteria 2184
174 Ga0207706_10225644 3300025933 Bacteria 1640
175 Ga0207709_10461466 3300025935 Bacteria 984
176 Ga0207670_10348902 3300025936 Bacteria 1171
177 Ga0207669_10074348 3300025937 Bacteria 2148
178 Ga0207704_10435006 3300025938 Bacteria 1043
179 Ga0207665_10000289 3300025939 Bacteria 34924
180 Ga0207665_10063183 3300025939 Bacteria 2514
181 Ga0207665_10195827 3300025939 Bacteria 1470
182 Ga0207691_10436405 3300025940 Bacteria 1115
183 Ga0207689_10176506 3300025942 Bacteria 1762
184 Ga0207689_11339243 3300025942 Bacteria 601
185 Ga0207679_10103141 3300025945 Bacteria 2235
186 Ga0207667_10118322 3300025949 Bacteria 2730
187 Ga0207651_10156546 3300025960 Bacteria 1781
188 Ga0207712_10307091 3300025961 Bacteria 1304
189 Ga0207668_10186171 3300025972 Bacteria 1642
190 Ga0207668_10435636 3300025972 Bacteria 1115
191 Ga0207658_11287758 3300025986 Bacteria 668
192 Ga0207677_10213122 3300026023 Bacteria 1544
193 Ga0207703_10731366 3300026035 Bacteria 942
194 Ga0207703_10816858 3300026035 Bacteria 891
195 Ga0207639_10954981 3300026041 Bacteria 802
196 Ga0207678_10110892 3300026067 Bacteria 2340
197 Ga0207678_10221367 3300026067 Bacteria 1620
198 Ga0207702_10823262 3300026078 Bacteria 918
199 Ga0207702_10943763 3300026078 Bacteria 855
200 Ga0207641_10117702 3300026088 Bacteria 2366
201 Ga0207641_11737513 3300026088 Bacteria 626
202 Ga0207648_10024638 3300026089 Bacteria 5367
203 Ga0207676_10690289 3300026095 Bacteria 988
204 Ga0207674_10122563 3300026116 Bacteria 2566
205 Ga0207675_100030164 3300026118 Bacteria 5050
206 Ga0207683_10239173 3300026121 Bacteria 1656
207 Ga0209389_1000076 3300027296 Bacteria 92447
208 Ga0209489_100416 3300027361 Bacteria 77981
209 Ga0209700_100014 3300027363 Bacteria 299349
210 Ga0209179_1006830 3300027512 Bacteria 1859
211 Ga0209179_1089541 3300027512 Bacteria 682
212 Ga0209588_1009765 3300027671 Bacteria 2873
213 Ga0209588_1083793 3300027671 Bacteria 1029
214 Ga0209588_1165815 3300027671 Bacteria 696
215 Ga0268264_10000049 3300028381 Bacteria 329992
216 Ga0268264_10207345 3300028381 Bacteria 1797
217 Ga0268264_10813352 3300028381 Bacteria 934
218 Ga0265328_10145913 3300031239 Bacteria 889
219 Ga0265340_10004397 3300031247 Bacteria 7886
220 Ga0265331_10014568 3300031250 Bacteria 4180
221 Ga0265331_10493393 3300031250 Bacteria 551
222 Ga0307509_10029257 3300031507 Bacteria 6116
223 Ga0307509_10255985 3300031507 Bacteria 1530
224 Ga0307508_10000046 3300031616 Bacteria 139709
225 Ga0307508_10083047 3300031616 Bacteria 2786
226 Ga0265314_10182387 3300031711 Bacteria 1257
227 Ga0265342_10184256 3300031712 Bacteria 1142
228 Ga0307516_10015246 3300031730 Bacteria 8096
229 Ga0307412_10134886 3300031911 Bacteria 1799
230 Ga0307411_10503750 3300032005 Bacteria 1024
231 Ga0373926_0203695 3300035083 Bacteria 762
232 Ga0373934_0028282 3300035086 Bacteria 2183
233 Ga0373923_0000022 3300035111 Bacteria 23262
234 Ga0373923_0103321 3300035111 Bacteria 1259
235 Ga0373936_0012468 3300035113 Bacteria 3234
236 Ga0373945_0001640 3300035116 Bacteria 6865
237 Ga0373953_0001610 3300035117 Bacteria 6605
238 Ga0373953_0015235 3300035117 Bacteria 2781
239 Ga0373954_0000519 3300035118 Bacteria 14460
240 Ga0373954_0020336 3300035118 Bacteria 3002
241 Ga0373954_0060634 3300035118 Bacteria 1785
242 Ga0373956_0006376 3300035119 Bacteria 4725
243 Ga0373956_0021603 3300035119 Bacteria 2746
244 Ga0373956_0635286 3300035119 Bacteria 510
245 Ga0373957_0002302 3300035120 Bacteria 5424
246 Ga0373957_0008463 3300035120 Bacteria 3333
247 Ga0373957_0111248 3300035120 Bacteria 1103
248 Ga0373943_0001832 3300035170 Bacteria 9614
249 Ga0373943_0276971 3300035170 Bacteria 948
250 Ga0373946_0021484 3300035171 Bacteria 2503
251 Ga0373955_0001695 3300035172 Bacteria 9427
252 Ga0373955_0774664 3300035172 Bacteria 589
253 Ga0373942_0104976 3300035207 Bacteria 867
254 Ga0373924_0021403 3300035410 Bacteria 2521
255 Ga0373924_0132398 3300035410 Bacteria 1085
256 Ga0373924_0166118 3300035410 Bacteria 969
257 Ga0373931_0091596 3300035691 Bacteria 1695
258 Ga0373935_0000244 3300035692 Bacteria 26819
259 Ga0373935_0035558 3300035692 Bacteria 3110
260 Ga0373935_0147966 3300035692 Bacteria 1592
261 Ga0373927_0003221 3300035695 Bacteria 11752
262 Ga0373927_0734038 3300035695 Bacteria 652
263 Ga0373933_0000374 3300035724 Bacteria 28691
264 Ga0373933_0005137 3300035724 Bacteria 7139
265 Ga0373933_0062505 3300035724 Bacteria 2249
266 Ga0373933_0105482 3300035724 Bacteria 1753
267 Ga0373933_0324832 3300035724 Bacteria 998
268 Ga0373947_0002144 3300035725 Bacteria 11991
269 Ga0373937_0003416 3300036401 Bacteria 13330
270 Ga0373937_0279161 3300036401 Bacteria 1577
271 Ga0373937_0334530 3300036401 Bacteria 1433
272 Ga0373937_0712868 3300036401 Bacteria 950
273 Ga0372808_022225 3300036459 Bacteria 912
274 Ga0373925_0001674 3300037068 Bacteria 18651
275 Ga0373925_0088015 3300037068 Bacteria 2371
276 Ga0436364_0257607 3300037853 Bacteria 563
277 Ga0436364_0416901 3300037853 Bacteria 1311
278 Ga0436365_0424272 3300039437 Bacteria 771
279 Ga0436365_1309919 3300039437 Bacteria 1824
280 Ga0436360_0176008 3300039438 Bacteria 706
281 Ga0436361_0446256 3300039447 Bacteria 902
282 Ga0436363_1084120 3300039450 Bacteria 1286
283 Ga0436362_0816704 3300039453 Bacteria 2104
284 Ga0451795_1351160 3300041456 Bacteria 549
285 Ga0451839_1001464 3300041496 Bacteria 525
286 Ga0451853_0393728 3300041512 Bacteria 1524
287 Ga0439437_011475 3300042000 Bacteria 1015
288 Ga0466966_0172968 3300044684 Bacteria 1312
289 Ga0466968_0014741 3300044735 Bacteria 3093
290 Ga0466968_0311473 3300044735 Bacteria 759
291 Ga0466970_0067268 3300044765 Bacteria 1924
292 Ga0466957_0055530 3300044842 Bacteria 2421
293 Ga0466959_0198864 3300045049 Bacteria 1396
294 Ga0466967_0937023 3300045976 Bacteria 862
295 Ga0495592_0006994 3300046454 Bacteria 8432
296 Ga0495592_0025947 3300046454 Bacteria 4445
297 Ga0495592_0684661 3300046454 Bacteria 618
298 Ga0495603_0000370 3300046455 Bacteria 24383
299 Ga0495629_0000081 3300046459 Bacteria 85305
300 Ga0495629_0000380 3300046459 Bacteria 37205
301 Ga0495629_0659327 3300046459 Bacteria 697
302 Ga0495641_0015940 3300046461 Bacteria 3981
303 Ga0495651_0009321 3300046462 Bacteria 7534
304 Ga0495651_0477385 3300046462 Bacteria 801
305 Ga0495651_0517028 3300046462 Bacteria 762
306 Ga0495653_0030013 3300046463 Bacteria 4334
307 Ga0495580_0000435 3300046472 Bacteria 34468
308 Ga0495582_0000051 3300046473 Bacteria 59010
309 Ga0495639_0000010 3300046475 Bacteria 93685
310 Ga0495662_0015859 3300046476 Bacteria 3656
311 Ga0495664_0006633 3300046477 Bacteria 6400
312 Ga0495594_0001553 3300046499 Bacteria 11928
313 Ga0495608_0006818 3300046511 Bacteria 8098
314 Ga0495618_0009515 3300046514 Bacteria 5870
315 Ga0495618_0219009 3300046514 Bacteria 1201
316 Ga0495628_0032259 3300046516 Bacteria 4230
317 Ga0495628_0073171 3300046516 Bacteria 2670
318 Ga0495628_0794794 3300046516 Bacteria 662
319 Ga0495630_0395834 3300046517 Bacteria 1058
320 Ga0495652_0007397 3300046529 Bacteria 10125
321 Ga0495652_0136421 3300046529 Bacteria 1935
322 Ga0495654_0000834 3300046530 Bacteria 23400
323 Ga0495665_0000005 3300046531 Bacteria 86491
324 Ga0495640_0000301 3300046533 Bacteria 33996
325 Ga0495640_0009451 3300046533 Bacteria 7596
326 Ga0495640_0238689 3300046533 Bacteria 1141
327 Ga0495586_0168185 3300046535 Bacteria 1238
328 Ga0495587_0002764 3300046536 Bacteria 11712
329 Ga0495587_0707749 3300046536 Bacteria 552
330 Ga0495645_0366751 3300046543 Bacteria 924
331 Ga0495622_0003164 3300046557 Bacteria 7794
332 Ga0495667_0017080 3300046559 Bacteria 4900
333 Ga0495667_0030543 3300046559 Bacteria 3620
334 Ga0495634_0000764 3300046642 Bacteria 31101
335 Ga0495634_0008147 3300046642 Bacteria 7807
336 Ga0495634_0508306 3300046642 Bacteria 706
337 Ga0495635_0000213 3300046663 Bacteria 36809
338 Ga0495635_0000259 3300046663 Bacteria 33960
339 Ga0495588_0006723 3300046674 Bacteria 5196
340 Ga0495657_0016391 3300046675 Bacteria 5399
341 Ga0495657_0110770 3300046675 Bacteria 1739
342 Ga0495599_0001319 3300046678 Bacteria 14145
343 Ga0495599_0032677 3300046678 Bacteria 3267
344 Ga0495599_0448933 3300046678 Bacteria 764
345 Ga0495623_0005373 3300046679 Bacteria 8381
346 Ga0495623_0014745 3300046679 Bacteria 5052
347 Ga0495623_0519860 3300046679 Bacteria 626
348 Ga0495646_0017294 3300046680 Bacteria 4574
349 Ga0495646_0044122 3300046680 Bacteria 2727
350 Ga0495647_0000671 3300046681 Bacteria 10182
351 Ga0495613_0001985 3300046689 Bacteria 15542
352 Ga0495613_0420384 3300046689 Bacteria 909
353 Ga0495613_0583525 3300046689 Bacteria 745
354 Ga0495624_0000094 3300046690 Bacteria 59911
355 Ga0495624_0706541 3300046690 Bacteria 598
356 Ga0495600_0016256 3300046809 Bacteria 4719
357 Ga0495581_0000810 3300047315 Bacteria 16618
358 Ga0495581_0229523 3300047315 Bacteria 1086
359 Ga0495604_0057292 3300047317 Bacteria 2996
360 Ga0495604_0357298 3300047317 Bacteria 969
361 Ga0495674_0000955 3300047319 Bacteria 27621
362 Ga0495674_0574073 3300047319 Bacteria 896
363 Ga0495672_0035185 3300047320 Bacteria 3086
364 Ga0495676_0022280 3300047321 Bacteria 5514
365 Ga0495680_0002637 3300047322 Bacteria 18206
366 Ga0495675_0000756 3300047444 Bacteria 20233
367 Ga0495675_0051427 3300047444 Bacteria 2616
368 Ga0495684_0000052 3300047471 Bacteria 85125
369 Ga0495684_0156945 3300047471 Bacteria 1699
370 Ga0495686_0101291 3300047472 Bacteria 1737
371 Ga0495593_0000084 3300047673 Bacteria 41155
372 Ga0495593_0000126 3300047673 Bacteria 37465
373 Ga0495602_0121217 3300048088 Bacteria 2103
374 Ga0495602_0351131 3300048088 Bacteria 1064
375 Ga0495614_0569323 3300048089 Bacteria 543
376 Ga0496101_0522752 3300048904 Bacteria 938
377 Ga0496101_0678218 3300048904 Bacteria 814
378 Ga0496102_0700807 3300048905 Bacteria 936
379 Ga0496104_0020882 3300048907 Bacteria 6006
380 Ga0496104_1432833 3300048907 Bacteria 594
381 Ga0496105_0073921 3300048908 Bacteria 2816
382 Ga0496106_0001452 3300048909 Bacteria 17800
383 Ga0496106_0021757 3300048909 Bacteria 4762
384 Ga0496106_0186980 3300048909 Bacteria 1646
385 Ga0496106_0447266 3300048909 Bacteria 1038
386 Ga0496106_0841982 3300048909 Bacteria 726
387 Ga0496107_0534307 3300048910 Bacteria 869
388 Ga0496107_0550074 3300048910 Bacteria 855
389 Ga0496108_0438976 3300048911 Bacteria 1140
390 Ga0496109_0944130 3300048912 Bacteria 800
391 Ga0496110_0003476 3300048913 Bacteria 12083
392 Ga0496111_0056182 3300048914 Bacteria 2848
393 Ga0496112_0007159 3300048915 Bacteria 9877
394 Ga0496112_0027946 3300048915 Bacteria 5442
395 Ga0496113_0321840 3300048916 Bacteria 1239
396 Ga0496114_0309249 3300048917 Bacteria 1396
397 Ga0496115_0090264 3300048918 Bacteria 2503
398 Ga0496115_0114564 3300048918 Bacteria 2216
399 Ga0496115_0190951 3300048918 Bacteria 1692
400 Ga0496115_0749472 3300048918 Bacteria 764
401 Ga0496116_0071988 3300048919 Bacteria 2187
402 Ga0496117_0037758 3300048920 Bacteria 3593
403 Ga0496117_0210834 3300048920 Bacteria 1089
404 Ga0496118_0008852 3300048921 Bacteria 10300
405 Ga0496118_0052109 3300048921 Bacteria 3125
406 Ga0496118_0168090 3300048921 Bacteria 1344
407 Ga0496119_0081904 3300048922 Bacteria 1857
408 Ga0496119_0412093 3300048922 Bacteria 643
409 Ga0496120_0168673 3300048923 Bacteria 1085
410 Ga0496120_0297047 3300048923 Bacteria 741
411 Ga0496121_0000261 3300048924 Bacteria 110085
412 Ga0496121_0002340 3300048924 Bacteria 29257
413 Ga0496121_0031129 3300048924 Bacteria 4883
414 Ga0496121_0232809 3300048924 Bacteria 1289
415 Ga0496121_0286149 3300048924 Bacteria 1125
416 Ga0496122_0090838 3300048925 Bacteria 2082
417 Ga0496123_0146942 3300048926 Bacteria 1278
418 Ga0496124_0002998 3300048927 Bacteria 21122
419 Ga0496124_0390677 3300048927 Bacteria 969
420 Ga0496125_0048665 3300048928 Bacteria 3533
421 Ga0496125_0056711 3300048928 Bacteria 3179
422 Ga0496126_0001531 3300048929 Bacteria 35598
423 Ga0496126_0011299 3300048929 Bacteria 9262
424 Ga0496126_0035854 3300048929 Bacteria 4643
425 Ga0496126_0086520 3300048929 Bacteria 2762
426 Ga0496126_0242448 3300048929 Bacteria 1505
427 Ga0496126_0249763 3300048929 Bacteria 1479
428 Ga0496126_0308712 3300048929 Bacteria 1303
429 Ga0501080_0398760 3300049742 Bacteria 1238
430 nmdc:mga0n895_15401_c1 3300050512 Bacteria 6970
431 nmdc:mga08x19_888902_c1 3300050514 Bacteria 633
432 Ga0495601_0027411 3300053077 Bacteria 3522
433 Ga0495601_0211548 3300053077 Bacteria 1267
434 Ga0495601_0215342 3300053077 Bacteria 1254
435 Ga0495612_0086227 3300053078 Bacteria 1324
436 Ga0500610_0110922 3300053079 Bacteria 1411
437 Ga0495595_0022161 3300053084 Bacteria 2785
438 Ga0495619_0000913 3300053085 Bacteria 19380
439 Ga0495619_0117915 3300053085 Bacteria 1818
440 Ga0495619_0347854 3300053085 Bacteria 1025
441 Ga0495619_0530219 3300053085 Bacteria 809
442 Ga0500569_000723 3300053109 Bacteria 5739
443 Ga0500572_045565 3300053111 Bacteria 1289
444 Ga0500595_001771 3300053119 Bacteria 11236
445 Ga0500607_026105 3300053121 Bacteria 3249
446 Ga0500614_048047 3300053123 Bacteria 1110
447 Ga0500559_0320315 3300053136 Bacteria 727
448 Ga0500564_183906 3300053138 Bacteria 869
449 Ga0500568_0009134 3300053139 Bacteria 4727
450 Ga0500590_157413 3300053148 Bacteria 1016
451 Ga0500616_0073564 3300053153 Bacteria 1734
452 Ga0500616_0326507 3300053153 Bacteria 630
453 Ga0500619_031425 3300053154 Bacteria 1620
454 Ga0500620_029748 3300053155 Bacteria 1718
455 Ga0500624_006249 3300053157 Bacteria 1607
456 Ga0500638_212038 3300053162 Bacteria 810
457 Ga0500639_293781 3300053163 Bacteria 616
458 Ga0500636_0000291 3300053177 Bacteria 27724
459 Ga0500636_0334339 3300053177 Bacteria 730
460 Ga0500625_167909 3300053729 Bacteria 793
461 Ga0500645_159033 3300053730 Bacteria 620
462 Ga0500609_001936 3300053731 Bacteria 2988
463 Ga0500596_004648 3300053735 Bacteria 2499
464 2513694887 2513237101 Bacteria 7952346
465 2513890435 2513237141 Bacteria 8496279
466 2524466485 2524023210 Bacteria 9029266
467 2671121237 2667528175 Bacteria 7532676
468 2793073660 2791355197 Bacteria 8420563
469 2829746942 2829745981 Bacteria 5406054
470 2847931500 2847930680 Bacteria 9342022
471 2874624390 2874620515 Bacteria 8290088
472 2879087462 2879083081 Bacteria 8587928
473 2885385383 2885383462 Bacteria 9473874
474 2903755868 2903748898 Bacteria 9972761
475 2903772289 2903768456 Bacteria 9749579
476 2904672271 2904666416 Bacteria 8226587
477 2904692124 2904690495 Bacteria 9412302
478 2906613044
479 2908757406 2908756301 Bacteria 8864324
480 2935635056 2935630451 Bacteria 8169952
481 2935964176 2935959822 Bacteria 7869783
482 2941511665 2941507105 Bacteria 8166816
483 2941519352 2941515067 Bacteria 8166720
484 2941527524 2941523033 Bacteria 8169134
485 3005483196 3005474847 Bacteria 9259049
486 8006935566 8006933436 Bacteria 10410654
487 8006975492 8006973647 Bacteria 10679141
488 8019563242 8019555841 Bacteria 9642137
489 8019573322 8019565922 Bacteria 9639779
490 Ga0105248_12027787
491 JGI25165J46597_1009920
492 JGI25404J52841_10089598
493 Ga0070658_10087090
494 Ga0070676_10273287
495 Ga0070683_100149322
496 Ga0068868_100152878
497 Ga0070660_100022483
498 Ga0070691_10268441
499 Ga0070661_100015019
500 Ga0070668_100293092
501 Ga0070668_101486167
502 Ga0070675_100148174
503 Ga0070675_101007065
504 Ga0070671_100271995
505 Ga0070674_100044306
506 Ga0070673_100146004
507 Ga0070659_100151934
508 Ga0070659_100250270
509 Ga0070709_10001435
510 Ga0070709_10484042
511 Ga0070709_10613433
512 Ga0070709_11529817
513 Ga0070714_100013189
514 Ga0070714_100448963
515 Ga0070714_100579648
516 Ga0070713_100051353
517 Ga0070713_100077791
518 Ga0070713_100139161
519 Ga0070713_100336514
520 Ga0070713_100516567
521 Ga0070710_10006535
522 Ga0070711_100066959
523 Ga0070711_100428904
524 Ga0070711_100845248
525 Ga0070663_100283391
526 Ga0070678_101216926
527 Ga0070662_100116279
528 Ga0070662_100679215
529 Ga0070662_101441063
530 Ga0070706_100620069
531 Ga0070706_101194286
532 Ga0070707_100947043
533 Ga0070698_100164481
534 Ga0070698_100599600
535 Ga0070698_101488127
536 Ga0070698_101736984
537 Ga0070679_100001939
538 Ga0070679_100563446
539 Ga0070697_100383817
540 Ga0070672_100434082
541 Ga0070665_100739454
542 Ga0068855_100339210
543 Ga0068855_100455126
544 Ga0070664_100146157
545 Ga0070664_100153835
546 Ga0068854_100036816
547 Ga0068856_100672415
548 Ga0068856_100978615
549 Ga0068859_100934859
550 Ga0068859_101442794
551 Ga0068864_100065276
552 Ga0068864_100522175
553 Ga0068851_10363229
554 Ga0068863_100234969
555 Ga0068858_100088528
556 Ga0068858_100330389
557 Ga0081540_1143933
558 Ga0081540_1319332
559 Ga0070717_10019819
560 Ga0070717_10042539
561 Ga0070717_10077195
562 Ga0070717_10660880
563 Ga0070715_10015520
564 Ga0070716_100001410
565 Ga0070716_100030779
566 Ga0070716_100294608
567 Ga0070712_100007612
568 Ga0070712_100095004
569 Ga0070712_100790051
570 Ga0097621_100797694
571 Ga0097621_101734645
572 Ga0075370_10738059
573 Ga0068865_100762005
574 Ga0097620_100556928
575 Ga0097620_100934993
576 Ga0097620_101442599
577 Ga0099825_1026268
578 Ga0099824_1046661
579 Ga0099823_1022824
580 Ga0099794_10008383
581 Ga0099794_10065841
582 Ga0099795_10088823
583 Ga0099795_10121080
584 Ga0099795_10220298
585 Ga0105251_10193015
586 Ga0105240_10003161
587 Ga0105240_10413686
588 Ga0105245_10724081
589 Ga0105247_10180626
590 Ga0105241_10035840
591 Ga0105241_10428326
592 Ga0105237_10051619
593 Ga0105237_10211826
594 Ga0105237_10644010
595 Ga0105238_10032301
596 Ga0105238_10078151
597 Ga0105238_11127497
598 Ga0105238_11915690
599 Ga0105249_10436621
600 Ga0105249_13056331
601 Ga0099796_10211298
602 Ga0105239_10068017
603 Ga0105239_10514686
604 Ga0105239_10700060
605 Ga0105246_10317827
606 Ga0105246_10686278
607 Ga0157373_11304146
608 Ga0157374_10301431
609 Ga0157378_10022522
610 Ga0157378_10157175
611 Ga0163162_10145423
612 Ga0157372_10043623
613 Ga0157375_10342951
614 Ga0163163_10609836
615 Ga0163163_11463826
616 Ga0157379_10401809
617 Ga0157379_12004793
618 Ga0157376_10144611
619 Ga0157376_11627529
620 Ga0182007_10028829
621 Ga0213872_10044103
622 Ga0213874_10136980
623 Ga0213875_10393813
624 Ga0213871_10003226
625 Ga0209677_100635
626 Ga0209233_1004670
627 Ga0209455_1005444
628 Ga0209758_1066033
629 Ga0207692_10011486
630 Ga0207692_10024941
631 Ga0207710_10066547
632 Ga0207685_10008958
633 Ga0207699_10000386
634 Ga0207699_10001899
635 Ga0207699_10304898
636 Ga0207699_11381919
637 Ga0207645_10138457
638 Ga0207705_10111086
639 Ga0207705_10174806
640 Ga0207684_10379701
641 Ga0207684_10831996
642 Ga0207654_10250753
643 Ga0207695_10587729
644 Ga0207693_10000774
645 Ga0207693_10003263
646 Ga0207663_10001349
647 Ga0207663_10217847
648 Ga0207663_10801125
649 Ga0207663_10872262
650 Ga0207657_10005108
651 Ga0207657_10022273
652 Ga0207657_10226695
653 Ga0207649_10447387
654 Ga0207659_10063733
655 Ga0207687_10373739
656 Ga0207700_10066276
657 Ga0207700_10951131
658 Ga0207664_10121406
659 Ga0207664_10307164
660 Ga0207664_10726701
661 Ga0207690_10134236
662 Ga0207706_10133411
663 Ga0207706_10225644
664 Ga0207709_10461466
665 Ga0207670_10348902
666 Ga0207669_10074348
667 Ga0207704_10435006
668 Ga0207665_10000289
669 Ga0207665_10063183
670 Ga0207665_10195827
671 Ga0207691_10436405
672 Ga0207689_10176506
673 Ga0207689_11339243
674 Ga0207679_10103141
675 Ga0207667_10118322
676 Ga0207651_10156546
677 Ga0207712_10307091
678 Ga0207668_10186171
679 Ga0207668_10435636
680 Ga0207658_11287758
681 Ga0207677_10213122
682 Ga0207703_10731366
683 Ga0207703_10816858
684 Ga0207639_10954981
685 Ga0207678_10110892
686 Ga0207678_10221367
687 Ga0207702_10823262
688 Ga0207702_10943763
689 Ga0207641_10117702
690 Ga0207641_11737513
691 Ga0207648_10024638
692 Ga0207676_10690289
693 Ga0207674_10122563
694 Ga0207675_100030164
695 Ga0207683_10239173
696 Ga0209389_1000076
697 Ga0209489_100416
698 Ga0209700_100014
699 Ga0209179_1006830
700 Ga0209179_1089541
701 Ga0209588_1009765
702 Ga0209588_1083793
703 Ga0209588_1165815
704 Ga0268264_10000049
705 Ga0268264_10207345
706 Ga0268264_10813352
707 Ga0265328_10145913
708 Ga0265340_10004397
709 Ga0265331_10014568
710 Ga0265331_10493393
711 Ga0307509_10029257
712 Ga0307509_10255985
713 Ga0307508_10000046
714 Ga0307508_10083047
715 Ga0265314_10182387
716 Ga0265342_10184256
717 Ga0307516_10015246
718 Ga0307412_10134886
719 Ga0307411_10503750
720 Ga0373926_0203695
721 Ga0373934_0028282
722 Ga0373923_0000022
723 Ga0373923_0103321
724 Ga0373936_0012468
725 Ga0373945_0001640
726 Ga0373953_0001610
727 Ga0373953_0015235
728 Ga0373954_0000519
729 Ga0373954_0020336
730 Ga0373954_0060634
731 Ga0373956_0006376
732 Ga0373956_0021603
733 Ga0373956_0635286
734 Ga0373957_0002302
735 Ga0373957_0008463
736 Ga0373957_0111248
737 Ga0373943_0001832
738 Ga0373943_0276971
739 Ga0373946_0021484
740 Ga0373955_0001695
741 Ga0373955_0774664
742 Ga0373942_0104976
743 Ga0373924_0021403
744 Ga0373924_0132398
745 Ga0373924_0166118
746 Ga0373931_0091596
747 Ga0373935_0000244
748 Ga0373935_0035558
749 Ga0373935_0147966
750 Ga0373927_0003221
751 Ga0373927_0734038
752 Ga0373933_0000374
753 Ga0373933_0005137
754 Ga0373933_0062505
755 Ga0373933_0105482
756 Ga0373933_0324832
757 Ga0373947_0002144
758 Ga0373937_0003416
759 Ga0373937_0279161
760 Ga0373937_0334530
761 Ga0373937_0712868
762 Ga0372808_022225
763 Ga0373925_0001674
764 Ga0373925_0088015
765 Ga0436364_0257607
766 Ga0436364_0416901
767 Ga0436365_0424272
768 Ga0436365_1309919
769 Ga0436360_0176008
770 Ga0436361_0446256
771 Ga0436363_1084120
772 Ga0436362_0816704
773 Ga0451795_1351160
774 Ga0451839_1001464
775 Ga0451853_0393728
776 Ga0439437_011475
777 Ga0466966_0172968
778 Ga0466968_0014741
779 Ga0466968_0311473
780 Ga0466970_0067268
781 Ga0466957_0055530
782 Ga0466959_0198864
783 Ga0466967_0937023
784 Ga0495592_0006994
785 Ga0495592_0025947
786 Ga0495592_0684661
787 Ga0495603_0000370
788 Ga0495629_0000081
789 Ga0495629_0000380
790 Ga0495629_0659327
791 Ga0495641_0015940
792 Ga0495651_0009321
793 Ga0495651_0477385
794 Ga0495651_0517028
795 Ga0495653_0030013
796 Ga0495580_0000435
797 Ga0495582_0000051
798 Ga0495639_0000010
799 Ga0495662_0015859
800 Ga0495664_0006633
801 Ga0495594_0001553
802 Ga0495608_0006818
803 Ga0495618_0009515
804 Ga0495618_0219009
805 Ga0495628_0032259
806 Ga0495628_0073171
807 Ga0495628_0794794
808 Ga0495630_0395834
809 Ga0495652_0007397
810 Ga0495652_0136421
811 Ga0495654_0000834
812 Ga0495665_0000005
813 Ga0495640_0000301
814 Ga0495640_0009451
815 Ga0495640_0238689
816 Ga0495586_0168185
817 Ga0495587_0002764
818 Ga0495587_0707749
819 Ga0495645_0366751
820 Ga0495622_0003164
821 Ga0495667_0017080
822 Ga0495667_0030543
823 Ga0495634_0000764
824 Ga0495634_0008147
825 Ga0495634_0508306
826 Ga0495635_0000213
827 Ga0495635_0000259
828 Ga0495588_0006723
829 Ga0495657_0016391
830 Ga0495657_0110770
831 Ga0495599_0001319
832 Ga0495599_0032677
833 Ga0495599_0448933
834 Ga0495623_0005373
835 Ga0495623_0014745
836 Ga0495623_0519860
837 Ga0495646_0017294
838 Ga0495646_0044122
839 Ga0495647_0000671
840 Ga0495613_0001985
841 Ga0495613_0420384
842 Ga0495613_0583525
843 Ga0495624_0000094
844 Ga0495624_0706541
845 Ga0495600_0016256
846 Ga0495581_0000810
847 Ga0495581_0229523
848 Ga0495604_0057292
849 Ga0495604_0357298
850 Ga0495674_0000955
851 Ga0495674_0574073
852 Ga0495672_0035185
853 Ga0495676_0022280
854 Ga0495680_0002637
855 Ga0495675_0000756
856 Ga0495675_0051427
857 Ga0495684_0000052
858 Ga0495684_0156945
859 Ga0495686_0101291
860 Ga0495593_0000084
861 Ga0495593_0000126
862 Ga0495602_0121217
863 Ga0495602_0351131
864 Ga0495614_0569323
865 Ga0496101_0522752
866 Ga0496101_0678218
867 Ga0496102_0700807
868 Ga0496104_0020882
869 Ga0496104_1432833
870 Ga0496105_0073921
871 Ga0496106_0001452
872 Ga0496106_0021757
873 Ga0496106_0186980
874 Ga0496106_0447266
875 Ga0496106_0841982
876 Ga0496107_0534307
877 Ga0496107_0550074
878 Ga0496108_0438976
879 Ga0496109_0944130
880 Ga0496110_0003476
881 Ga0496111_0056182
882 Ga0496112_0007159
883 Ga0496112_0027946
884 Ga0496113_0321840
885 Ga0496114_0309249
886 Ga0496115_0090264
887 Ga0496115_0114564
888 Ga0496115_0190951
889 Ga0496115_0749472
890 Ga0496116_0071988
891 Ga0496117_0037758
892 Ga0496117_0210834
893 Ga0496118_0008852
894 Ga0496118_0052109
895 Ga0496118_0168090
896 Ga0496119_0081904
897 Ga0496119_0412093
898 Ga0496120_0168673
899 Ga0496120_0297047
900 Ga0496121_0000261
901 Ga0496121_0002340
902 Ga0496121_0031129
903 Ga0496121_0232809
904 Ga0496121_0286149
905 Ga0496122_0090838
906 Ga0496123_0146942
907 Ga0496124_0002998
908 Ga0496124_0390677
909 Ga0496125_0048665
910 Ga0496125_0056711
911 Ga0496126_0001531
912 Ga0496126_0011299
913 Ga0496126_0035854
914 Ga0496126_0086520
915 Ga0496126_0242448
916 Ga0496126_0249763
917 Ga0496126_0308712
918 Ga0501080_0398760
919 nmdc:mga0n895_15401_c1
920 nmdc:mga08x19_888902_c1
921 Ga0495601_0027411
922 Ga0495601_0211548
923 Ga0495601_0215342
924 Ga0495612_0086227
925 Ga0500610_0110922
926 Ga0495595_0022161
927 Ga0495619_0000913
928 Ga0495619_0117915
929 Ga0495619_0347854
930 Ga0495619_0530219
931 Ga0500569_000723
932 Ga0500572_045565
933 Ga0500595_001771
934 Ga0500607_026105
935 Ga0500614_048047
936 Ga0500559_0320315
937 Ga0500564_183906
938 Ga0500568_0009134
939 Ga0500590_157413
940 Ga0500616_0073564
941 Ga0500616_0326507
942 Ga0500619_031425
943 Ga0500620_029748
944 Ga0500624_006249
945 Ga0500638_212038
946 Ga0500639_293781
947 Ga0500636_0000291
948 Ga0500636_0334339
949 Ga0500625_167909
950 Ga0500645_159033
951 Ga0500609_001936
952 Ga0500596_004648
953 2513694887
954 2513890435
955 2524466485
956 2671121237
957 2793073660
958 2829746942
959 2847931500
960 2874624390
961 2879087462
962 2885385383
963 2903755868
964 2903772289
965 2904672271
966 2904692124
967 2906613044
968 2908757406
969 2935635056
970 2935964176
971 2941511665
972 2941519352
973 2941527524
974 3005483196
975 8006935566
976 8006975492
977 8019563242
978 8019573322

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11533

AtzH-like

AtzH-like

5

130

0.98

PF13474

SnoaL_3

SnoaL-like domain

16

129

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
6bjt-assembly1.cif.gz_B the structure of atzh: a little known member of the atrazine breakdown pathway 0.9937 3 127
6bju-assembly1.cif.gz_B the structure of atzh: a little known member of the atrazine breakdown pathway 0.9932 3 124
6bju-assembly1.cif.gz_A the structure of atzh: a little known member of the atrazine breakdown pathway 0.9926 3 126
6bju-assembly2.cif.gz_D the structure of atzh: a little known member of the atrazine breakdown pathway 0.9923 3 126
6d63-assembly1.cif.gz_A the structure of atzh: a little known member of the atrazine breakdown pathway 0.9907 1 126
ID Description Score Start End Superfamily
6bjtB00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.9937 3 127 3.10.450.50
6d63G00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.972 1 126 3.10.450.50
6d63G00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.9638 1 126 3.10.450.50
2owpB00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.9488 1 126 3.10.450.50
2owpB00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.9414 1 126 3.10.450.50
ID Description Score Start End GO Terms
AF-A0A509EFP3-F1-model_v4 DUF4440 domain-containing protein 0.9977 1 127
AF-A0A0Q6K7F9-F1-model_v4 Oxalurate catabolism protein HpxZ 0.9974 1 126
AF-A0A2W5KBU4-F1-model_v4 Oxalurate catabolism protein HpxZ 0.9972 1 130
AF-A0A109CVZ3-F1-model_v4 deleted 0.9956 2 124
AF-A0A2C9D9G2-F1-model_v4 Allophanate hydrolase (EC 3.5.1.54) 0.9934 1 126 GO:0004039

Map