F453775

General Info

Members Datasets Scaffolds Average Seq Length
489 380 978 242

Family's Representative Sequence

Representative Sequence 3300010375|Ga0105239_10261128|Ga0105239_102611282
Length 268
Sequence MPRVLKTARICNGLSQGTACVYLDPFVMASDQLRREHVLVVDDDPRIRQMLTRYFEGEGYAVTAASGGAEMRARLRQENFDIILLDLVLPGGEDGLDLAREIRTQSDIPIMMLTGRDDVVDRIVGIEVGADDYIAKPFHLREVHARLKAILRRRQPITKGPDNSLGEIIRFEGWQLNIGKRQLLTADGDEIELTTGEFDMLVVFVRHAGRVLGRELLMDLTRGRNLEAFDRTIDAQIARLRKKIETDPRRPQLIKSIRGVGYVFTGKV

Samples

Sample ID Description Type Environment
1 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
4 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
5 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
6 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
7 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
8 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
9 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
10 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
11 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
12 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
13 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
14 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
15 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
16 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
17 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
18 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
19 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
20 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
21 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
22 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
23 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
24 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
25 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
26 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
27 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
35 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
36 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
37 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
38 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
39 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
40 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
41 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
42 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
43 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
44 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
45 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
46 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
47 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
48 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
49 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
51 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
52 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
53 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
54 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
55 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
56 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
57 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
58 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
59 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
60 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
61 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
62 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
63 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
64 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
65 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
66 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
67 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
68 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
69 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
70 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
72 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
73 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
74 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
75 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
76 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
78 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
79 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
80 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
82 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
83 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
96 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
97 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
98 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
100 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
101 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
102 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
103 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
104 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
105 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
106 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
107 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
108 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
109 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
110 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
111 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
112 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
113 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
114 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
115 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
116 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
117 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
118 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
119 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
120 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
121 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
122 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
123 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
124 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
125 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
126 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
127 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
128 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
129 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
130 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
131 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
132 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
133 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
134 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
135 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
136 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
137 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
138 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
139 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
140 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
141 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
142 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
143 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
144 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
145 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
146 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
147 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
148 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
149 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
150 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
151 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
152 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
153 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
154 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
155 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
156 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
157 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
158 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
159 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
160 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
161 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
162 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
163 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
164 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
165 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
166 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
167 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
168 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
169 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
170 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
171 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
172 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
173 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
174 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
175 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
176 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
177 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
178 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
179 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
180 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
181 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
182 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
183 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
184 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
185 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
186 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
187 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
188 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
189 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
190 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
191 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
192 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
193 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
194 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
195 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
204 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
205 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
206 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
207 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
208 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
209 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
210 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
211 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
212 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
213 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
214 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
215 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
216 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
217 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
218 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
219 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
220 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
221 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
222 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
223 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
224 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
225 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
226 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
227 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
228 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
229 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
230 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
231 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
232 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
233 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
234 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
235 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
236 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
237 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
238 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
239 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
240 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
241 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
242 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
243 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
244 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
245 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
246 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
247 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
248 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
249 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
250 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
251 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
252 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
253 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
254 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
255 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
256 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
257 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
258 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
259 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
260 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
261 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
262 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
263 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
264 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
265 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
266 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
267 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
268 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
269 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
270 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
271 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
272 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
273 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
274 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
275 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
276 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
277 2643221607 Rhizobium sp. Root73 Isolate Unclassified
278 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
279 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
280 2643221733 Bosea sp. Root381 Isolate Unclassified
281 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
282 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
283 2718217882 Rhizobium sp. N741 Isolate Nodule
284 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
285 2718218009 Rhizobium sp. N561 Isolate Nodule
286 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
287 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
288 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
289 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
290 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
291 2718218363 Rhizobium sp. N113 Isolate Nodule
292 2718218365 Rhizobium sp. N731 Isolate Nodule
293 2718218366 Rhizobium sp. N621 Isolate Nodule
294 2721755514 Rhizobium sp. N6212 Isolate Nodule
295 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
296 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
297 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
298 2721755810 Rhizobium sp. N871 Isolate Nodule
299 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
300 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
301 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
302 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
303 2728369365 Rhizobium sp. N1341 Isolate Nodule
304 2728369397 Rhizobium sp. N1314 Isolate Nodule
305 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
306 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
307 2791355256 Rhizobium sp. M10 Isolate Nodule
308 2791355260 Rhizobium sp. L9 Isolate Nodule
309 2791355261 Rhizobium sp. J15 Isolate Nodule
310 2791355263 Rhizobium chutanense C5 Isolate Nodule
311 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
312 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
313 2802429633 Rhizobium anhuiense J3 Isolate Nodule
314 2802429634 Rhizobium anhuiense S10 Isolate Nodule
315 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
316 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
317 2802429637 Rhizobium anhuiense C15 Isolate Nodule
318 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
319 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
320 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
321 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
322 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
323 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
324 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
325 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
326 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
327 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
328 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
329 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
330 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
331 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
332 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
333 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
334 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
335 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
336 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
337 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
338 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
339 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
340 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
341 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
342 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
343 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
344 2936381700 Rhizobium chutanense C16 Isolate Unclassified
345 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
346 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
347 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
348 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
349 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
350 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
351 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
352 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
353 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
354 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
355 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
356 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
357 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
358 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
359 2996893221 Rhizobium sp. R635 Isolate Nodule
360 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
361 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
362 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
363 8005258706 Rhizobium sp. R693 Isolate Nodule
364 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
365 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
366 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
367 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
368 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
369 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
370 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
371 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
372 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
373 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
374 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
375 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
376 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
377 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
378 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
379 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
380 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 71.98
Metatranscriptomes 0
Isolates 28.02

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 24.34
Nodule 20.25
Rhizoplane 1.23
Rhizosphere 36.2
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105239_10261128 3300010375 Bacteria 1946
2 JGI24740J21852_10000059 3300001979 Bacteria 35309
3 JGI25155J39150_1000026 3300002704 Bacteria 127779
4 JGI25156J39149_1000028 3300002705 Bacteria 127325
5 JGI25162J39368_1000238 3300002737 Bacteria 54861
6 JGI25162J39368_1000452 3300002737 Bacteria 32183
7 JGI25154J39366_1000046 3300002738 Bacteria 127252
8 JGI25157J39369_1000358 3300002741 Bacteria 31869
9 JGI25159J45721_1000056 3300002987 Bacteria 54880
10 JGI25151J46595_10001124 3300003187 Bacteria 19519
11 JGI25165J46597_1000116 3300003214 Bacteria 137942
12 JGI25165J46597_1000722 3300003214 Bacteria 25879
13 JGI25165J46597_1004082 3300003214 Bacteria 3278
14 JGI25153J46596_10004984 3300003215 Bacteria 7048
15 JGI25153J46596_10050541 3300003215 Bacteria 1197
16 rootH2_10105471 3300003320 Bacteria 2617
17 rootL2_10008082 3300003322 Bacteria 60006
18 rootL2_10185335 3300003322 Bacteria 2442
19 rootH1_10269008 3300003323 Bacteria 4338
20 JGI25160J50197_1000026 3300003354 Bacteria 184693
21 JGI25160J50197_1002772 3300003354 Bacteria 8027
22 JGI25161J50226_1000014 3300003374 Bacteria 191109
23 JGI25161J50226_1001565 3300003374 Bacteria 6702
24 Ga0055526_1000795 3300003771 Bacteria 23489
25 Ga0055526_1002999 3300003771 Bacteria 11031
26 Ga0055524_1001465 3300003775 Bacteria 13480
27 Ga0055536_1006281 3300003781 Bacteria 5593
28 Ga0055528_1000746 3300003790 Bacteria 22697
29 Ga0055528_1001731 3300003790 Bacteria 12619
30 Ga0055540_1002077 3300003792 Bacteria 11021
31 Ga0055540_1006183 3300003792 Bacteria 4815
32 Ga0055531_10004284 3300003794 Bacteria 8760
33 Ga0055543_1000052 3300004625 Bacteria 104887
34 Ga0055543_1000765 3300004625 Bacteria 16071
35 Ga0065165_1000073 3300005262 Bacteria 164910
36 Ga0065165_1013874 3300005262 Bacteria 3167
37 Ga0070658_10189682 3300005327 Bacteria 1732
38 Ga0070660_100009283 3300005339 Bacteria 6913
39 Ga0070692_10003220 3300005345 Bacteria 6569
40 Ga0070659_100003145 3300005366 Bacteria 11757
41 Ga0070659_100209157 3300005366 Bacteria 1608
42 Ga0070663_100016761 3300005455 Bacteria 4768
43 Ga0070679_100118919 3300005530 Bacteria 2627
44 Ga0068855_100036701 3300005563 Bacteria 5831
45 Ga0068855_100040565 3300005563 Bacteria 5525
46 Ga0068856_100020042 3300005614 Bacteria 6493
47 Ga0068852_100196129 3300005616 Bacteria 1908
48 Ga0075365_10002649 3300006038 Bacteria 8884
49 Ga0075365_10003501 3300006038 Bacteria 8111
50 Ga0075365_10010935 3300006038 Bacteria 5315
51 Ga0075368_10009381 3300006042 Bacteria 3520
52 Ga0075368_10098617 3300006042 Bacteria 1198
53 Ga0075363_100003241 3300006048 Bacteria 6883
54 Ga0075364_10004374 3300006051 Bacteria 8115
55 Ga0075362_10001375 3300006177 Bacteria 7716
56 Ga0075362_10109782 3300006177 Bacteria 1297
57 Ga0075367_10012924 3300006178 Bacteria 4473
58 Ga0075369_10002720 3300006186 Bacteria 6341
59 Ga0075366_10002825 3300006195 Bacteria 8991
60 Ga0075370_10001260 3300006353 Bacteria 10787
61 Ga0075370_10002787 3300006353 Bacteria 8192
62 Ga0075370_10014054 3300006353 Bacteria 4263
63 Ga0075433_10029023 3300006852 Bacteria 4709
64 Ga0075434_100692137 3300006871 Bacteria 1037
65 Ga0079104_1000101 3300006946 Bacteria 125456
66 Ga0079104_1025918 3300006946 Bacteria 1522
67 Ga0099826_10010074 3300006948 Bacteria 7073
68 Ga0105244_10102329 3300009036 Bacteria 1400
69 Ga0105240_10002575 3300009093 Bacteria 29071
70 Ga0105240_10062827 3300009093 Bacteria 4622
71 Ga0111539_10484160 3300009094 Bacteria 1441
72 Ga0105247_10127032 3300009101 Bacteria 1658
73 Ga0105243_10051220 3300009148 Bacteria 3265
74 Ga0105248_10309236 3300009177 Bacteria 1780
75 Ga0105237_10021145 3300009545 Bacteria 6693
76 Ga0105238_10144842 3300009551 Bacteria 2352
77 Ga0105239_10735007 3300010375 Bacteria 1129
78 Ga0157370_10001604 3300013104 Bacteria 27946
79 Ga0157369_10478901 3300013105 Bacteria 1288
80 Ga0157369_10588614 3300013105 Bacteria 1149
81 Ga0163162_10878417 3300013306 Bacteria 1011
82 Ga0182007_10017063 3300015262 Bacteria 2662
83 Ga0182005_1004457 3300015265 Bacteria 4527
84 Ga0163161_10083450 3300017792 Bacteria 2355
85 Ga0163161_10298984 3300017792 Bacteria 1267
86 Ga0213872_10007397 3300021361 Bacteria 5408
87 Ga0213872_10016359 3300021361 Bacteria 3442
88 Ga0213872_10029293 3300021361 Bacteria 2524
89 Ga0213872_10063797 3300021361 Bacteria 1664
90 Ga0228711_1010171 3300022739 Bacteria 12473
91 Ga0228710_1004457 3300022740 Bacteria 22108
92 Ga0228598_1014371 3300024227 Bacteria 1566
93 Ga0209435_100017 3300025206 Bacteria 303699
94 Ga0209437_100128 3300025233 Bacteria 190300
95 Ga0209437_100283 3300025233 Bacteria 74859
96 Ga0207425_1002847 3300025245 Bacteria 5817
97 Ga0209646_1000048 3300025246 Bacteria 303808
98 Ga0209646_1004088 3300025246 Bacteria 2718
99 Ga0209026_1000035 3300025250 Bacteria 303808
100 Ga0209677_101249 3300025253 Bacteria 11475
101 Ga0209759_1000027 3300025256 Bacteria 303808
102 Ga0209129_1000272 3300025258 Bacteria 50370
103 Ga0209233_1000072 3300025261 Bacteria 363074
104 Ga0209233_1000268 3300025261 Bacteria 74859
105 Ga0209233_1000727 3300025261 Bacteria 15234
106 Ga0209673_1000255 3300025273 Bacteria 100723
107 Ga0209673_1000733 3300025273 Bacteria 45496
108 Ga0209673_1001353 3300025273 Bacteria 24419
109 Ga0209130_1000121 3300025284 Bacteria 127462
110 Ga0209130_1014322 3300025284 Bacteria 1995
111 Ga0209676_1004782 3300025292 Bacteria 7374
112 Ga0209025_1000735 3300025294 Bacteria 55469
113 Ga0209025_1005649 3300025294 Bacteria 10078
114 Ga0209564_1000215 3300025295 Bacteria 132838
115 Ga0209564_1000695 3300025295 Bacteria 49249
116 Ga0209758_1000291 3300025297 Bacteria 98850
117 Ga0209758_1000687 3300025297 Bacteria 50244
118 Ga0209758_1019111 3300025297 Bacteria 3324
119 Ga0209758_1021839 3300025297 Bacteria 2964
120 Ga0209050_1008090 3300025298 Bacteria 5708
121 Ga0209256_1000155 3300025299 Bacteria 144379
122 Ga0209256_1003723 3300025299 Bacteria 10326
123 Ga0209256_1005635 3300025299 Bacteria 7069
124 Ga0207426_1000075 3300025302 Bacteria 321337
125 Ga0207426_1000569 3300025302 Bacteria 49930
126 Ga0209051_1000708 3300025303 Bacteria 36541
127 Ga0209051_1000958 3300025303 Bacteria 28336
128 Ga0209257_1002285 3300025304 Bacteria 19498
129 Ga0207705_10009721 3300025909 Bacteria 6995
130 Ga0207695_10002230 3300025913 Bacteria 29083
131 Ga0207695_10002873 3300025913 Bacteria 24991
132 Ga0207671_10000448 3300025914 Bacteria 56985
133 Ga0207657_10000691 3300025919 Bacteria 35886
134 Ga0207690_10003380 3300025932 Bacteria 9536
135 Ga0207711_10231084 3300025941 Bacteria 1694
136 Ga0207667_10028261 3300025949 Bacteria 6093
137 Ga0207667_10043415 3300025949 Bacteria 4771
138 Ga0207667_10049566 3300025949 Bacteria 4434
139 Ga0207678_10059952 3300026067 Bacteria 3274
140 Ga0207702_10063758 3300026078 Bacteria 3152
141 Ga0207698_10335788 3300026142 Bacteria 1421
142 Ga0209281_1000028 3300027111 Bacteria 440027
143 Ga0209282_1000075 3300027666 Bacteria 77825
144 Ga0209813_10061622 3300027866 Bacteria 1198
145 Ga0268266_10117337 3300028379 Bacteria 2365
146 Ga0307515_10237761 3300028794 Bacteria 1599
147 Ga0307513_10139434 3300031456 Bacteria 2354
148 Ga0315914_1001307 3300031967 Bacteria 36717
149 Ga0307414_10099079 3300032004 Bacteria 2189
150 Ga0307510_10004106 3300033180 Bacteria 17088
151 Ga0307510_10120258 3300033180 Bacteria 2334
152 Ga0315913_1001596 3300033430 Bacteria 25272
153 Ga0315915_1000042 3300033464 Bacteria 80209
154 Ga0395905_0013599 3300037471 Bacteria 7796
155 Ga0436364_0590203 3300037853 Bacteria 7927
156 Ga0395901_0203317 3300038443 Bacteria 2076
157 Ga0436361_0216394 3300039447 Bacteria 2230
158 Ga0436361_0279546 3300039447 Bacteria 2068
159 Ga0436361_0318174 3300039447 Bacteria 3023
160 Ga0436361_0445149 3300039447 Bacteria 876
161 Ga0436361_0466496 3300039447 Bacteria 6023
162 Ga0436361_0716635 3300039447 Bacteria 4150
163 Ga0436363_1620207 3300039450 Bacteria 2844
164 Ga0439436_0006571 3300041404 Bacteria 3571
165 Ga0439438_033762 3300041405 Bacteria 1350
166 Ga0439465_0050962 3300041413 Bacteria 1355
167 Ga0451787_505587 3300041441 Bacteria 1487
168 Ga0451798_0984989 3300041458 Bacteria 1919
169 Ga0451833_0769068 3300041491 Bacteria 4251
170 Ga0451835_0082151 3300041492 Bacteria 2020
171 Ga0451837_0219012 3300041494 Bacteria 9993
172 Ga0451839_0746754 3300041496 Bacteria 9248
173 Ga0451841_0129660 3300041498 Bacteria 3887
174 Ga0451845_0290259 3300041501 Bacteria 4148
175 Ga0451847_0654864 3300041503 Bacteria 3129
176 Ga0451849_0244831 3300041505 Bacteria 2197
177 Ga0451851_0235632 3300041507 Bacteria 3126
178 Ga0451843_0574778 3300041509 Bacteria 2404
179 Ga0451855_1284999 3300041511 Bacteria 9762
180 Ga0451853_2617308 3300041512 Bacteria 3421
181 Ga0439449_0078124 3300042007 Bacteria 1220
182 Ga0439462_0014504 3300042015 Bacteria 2026
183 Ga0450922_005721 3300042124 Bacteria 1153
184 Ga0450918_005058 3300042531 Bacteria 2375
185 Ga0466958_0054347 3300045836 Bacteria 2428
186 Ga0495617_002663 3300046452 Bacteria 6950
187 Ga0495638_0001006 3300046460 Bacteria 28233
188 Ga0495664_0087353 3300046477 Bacteria 1873
189 Ga0495585_0005189 3300046492 Bacteria 8259
190 Ga0495607_0028936 3300046501 Bacteria 3413
191 Ga0495607_0050585 3300046501 Bacteria 2418
192 Ga0495583_0002616 3300046506 Bacteria 15049
193 Ga0495583_0012475 3300046506 Bacteria 4804
194 Ga0495583_0013197 3300046506 Bacteria 4623
195 Ga0495583_0150713 3300046506 Bacteria 964
196 Ga0495608_0200930 3300046511 Bacteria 1256
197 Ga0495610_0004908 3300046512 Bacteria 9717
198 Ga0495610_0005552 3300046512 Bacteria 8927
199 Ga0495618_0038112 3300046514 Bacteria 3020
200 Ga0495620_0000299 3300046515 Bacteria 35229
201 Ga0495620_0001326 3300046515 Bacteria 15020
202 Ga0495628_0182755 3300046516 Bacteria 1585
203 Ga0495631_0204825 3300046518 Bacteria 843
204 Ga0495632_0115850 3300046519 Bacteria 1255
205 Ga0495632_0233968 3300046519 Bacteria 828
206 Ga0495637_0119166 3300046520 Bacteria 1017
207 Ga0495643_0002758 3300046522 Bacteria 13457
208 Ga0495643_0003892 3300046522 Bacteria 10714
209 Ga0495643_0014793 3300046522 Bacteria 4633
210 Ga0495648_0001065 3300046524 Bacteria 27857
211 Ga0495648_0001954 3300046524 Bacteria 19631
212 Ga0495663_0000101 3300046525 Bacteria 35106
213 Ga0495652_0107296 3300046529 Bacteria 2253
214 Ga0495654_0000296 3300046530 Bacteria 44716
215 Ga0495640_0153396 3300046533 Bacteria 1479
216 Ga0495609_0148829 3300046538 Bacteria 996
217 Ga0495597_0205656 3300046542 Bacteria 787
218 Ga0495622_0002093 3300046557 Bacteria 9761
219 Ga0495633_0011839 3300046558 Bacteria 4676
220 Ga0495656_0217044 3300046615 Bacteria 955
221 Ga0495634_0071400 3300046642 Bacteria 2286
222 Ga0495611_0000583 3300046648 Bacteria 21088
223 Ga0495625_0001051 3300046660 Bacteria 36220
224 Ga0495625_0018483 3300046660 Bacteria 5441
225 Ga0495625_0080325 3300046660 Bacteria 2271
226 Ga0495635_0176989 3300046663 Bacteria 1450
227 Ga0495661_0003002 3300046665 Bacteria 12722
228 Ga0495588_0001206 3300046674 Bacteria 11139
229 Ga0495646_0105199 3300046680 Bacteria 1613
230 Ga0495658_0010586 3300046683 Bacteria 4615
231 Ga0495613_0000402 3300046689 Bacteria 37114
232 Ga0495624_0135518 3300046690 Bacteria 1509
233 Ga0495670_0000129 3300046691 Bacteria 32692
234 Ga0495670_0027911 3300046691 Bacteria 2798
235 Ga0495671_0000401 3300046692 Bacteria 35219
236 Ga0495649_0000882 3300046694 Bacteria 24041
237 Ga0495660_0002916 3300046810 Bacteria 10706
238 Ga0495660_0233251 3300046810 Bacteria 861
239 Ga0495674_0216522 3300047319 Bacteria 1584
240 Ga0495672_0103932 3300047320 Bacteria 1536
241 Ga0495676_0154689 3300047321 Bacteria 1628
242 Ga0495683_0100498 3300047323 Bacteria 1391
243 Ga0495687_000478 3300047443 Bacteria 48491
244 Ga0495687_000998 3300047443 Bacteria 28327
245 Ga0495687_002738 3300047443 Bacteria 13666
246 Ga0495681_0000869 3300047470 Bacteria 23274
247 Ga0495681_0014299 3300047470 Bacteria 4556
248 Ga0495686_0001164 3300047472 Bacteria 30807
249 Ga0495593_0146689 3300047673 Bacteria 1194
250 Ga0495602_0112693 3300048088 Bacteria 2207
251 Ga0496100_0088828 3300048903 Bacteria 2104
252 Ga0496111_0001362 3300048914 Bacteria 13839
253 Ga0496116_0082781 3300048919 Bacteria 1983
254 Ga0496117_0006474 3300048920 Bacteria 11830
255 Ga0496119_0003374 3300048922 Bacteria 16617
256 Ga0496119_0008838 3300048922 Bacteria 8761
257 Ga0496119_0019451 3300048922 Bacteria 5001
258 Ga0496119_0175494 3300048922 Bacteria 1128
259 Ga0496120_0003022 3300048923 Bacteria 15931
260 Ga0496120_0038163 3300048923 Bacteria 2844
261 Ga0496120_0150023 3300048923 Bacteria 1173
262 Ga0496121_0016319 3300048924 Bacteria 7675
263 Ga0496121_0016320 3300048924 Bacteria 7675
264 Ga0496121_0035625 3300048924 Bacteria 4455
265 Ga0496121_0234992 3300048924 Bacteria 1281
266 Ga0496122_0000960 3300048925 Bacteria 52000
267 Ga0496122_0003049 3300048925 Bacteria 22654
268 Ga0496122_0004420 3300048925 Bacteria 17492
269 Ga0496122_0103634 3300048925 Bacteria 1892
270 Ga0496122_0332071 3300048925 Bacteria 803
271 Ga0496123_0000764 3300048926 Bacteria 51994
272 Ga0496123_0002513 3300048926 Bacteria 22537
273 Ga0496123_0004959 3300048926 Bacteria 13640
274 Ga0496123_0037512 3300048926 Bacteria 3420
275 Ga0496124_0005589 3300048927 Bacteria 14070
276 Ga0496124_0008170 3300048927 Bacteria 10980
277 Ga0496124_0016905 3300048927 Bacteria 6913
278 Ga0496124_0060047 3300048927 Bacteria 3191
279 Ga0496125_0015172 3300048928 Bacteria 7464
280 Ga0496125_0044149 3300048928 Bacteria 3774
281 Ga0496126_0118709 3300048929 Bacteria 2296
282 Ga0496126_0122333 3300048929 Bacteria 2255
283 Ga0496126_0388971 3300048929 Bacteria 1133
284 Ga0495678_000635 3300049459 Bacteria 32497
285 Ga0495682_0000331 3300049460 Bacteria 35194
286 Ga0501036_0113588 3300049572 Bacteria 2289
287 Ga0501037_0199244 3300049573 Bacteria 1415
288 Ga0501038_0051247 3300049574 Bacteria 3564
289 Ga0501039_0361060 3300049575 Bacteria 1141
290 Ga0501040_0128698 3300049576 Bacteria 1779
291 Ga0501041_0236019 3300049577 Bacteria 1149
292 Ga0501042_0115267 3300049578 Bacteria 1935
293 Ga0501043_0232736 3300049579 Bacteria 1423
294 Ga0501072_0115407 3300049588 Bacteria 2138
295 Ga0501073_0055068 3300049589 Bacteria 2784
296 Ga0501074_0369988 3300049590 Bacteria 1017
297 Ga0501075_0026281 3300049591 Bacteria 4284
298 Ga0501238_009246 3300049671 Bacteria 1306
299 Ga0501080_0147935 3300049742 Bacteria 2172
300 Ga0501080_0487000 3300049742 Bacteria 1103
301 Ga0501081_0036975 3300049743 Bacteria 3331
302 nmdc:mga03683_16700_c1 3300050489 Bacteria 2763
303 nmdc:mga03683_38086_c1 3300050489 Bacteria 1962
304 nmdc:mga03n38_9657_c1 3300050490 Bacteria 3517
305 nmdc:mga00v17_2209_c1 3300050491 Bacteria 10006
306 nmdc:mga0yw44_555_c1 3300050492 Bacteria 13472
307 nmdc:mga0yw44_5930_c1 3300050492 Bacteria 5842
308 nmdc:mga0yw44_6532_c1 3300050492 Bacteria 5646
309 nmdc:mga0k408_4354_c1 3300050493 Bacteria 7515
310 nmdc:mga06z11_23792_c1 3300050494 Bacteria 2882
311 nmdc:mga06z11_6008_c1 3300050494 Bacteria 4908
312 nmdc:mga04h51_47931_c1 3300050495 Bacteria 1422
313 nmdc:mga04h51_73682_c1 3300050495 Bacteria 1198
314 nmdc:mga07m45_1121_c1 3300050496 Bacteria 12013
315 nmdc:mga07m45_15007_c1 3300050496 Bacteria 4136
316 nmdc:mga07m45_1743_c1 3300050496 Bacteria 10015
317 nmdc:mga08y16_356958_c1 3300050511 Bacteria 1501
318 nmdc:mga0sz30_31852_c1 3300050516 Bacteria 2184
319 Ga0495601_0172827 3300053077 Bacteria 1412
320 Ga0495655_0100339 3300053083 Bacteria 856
321 Ga0500578_0001023 3300053086 Bacteria 30718
322 Ga0500643_056314 3300053087 Bacteria 1112
323 Ga0500583_0000368 3300053092 Bacteria 14795
324 Ga0500566_0200019 3300053094 Bacteria 1010
325 Ga0500555_002310 3300053103 Bacteria 5550
326 Ga0500556_0000834 3300053104 Bacteria 17689
327 Ga0500572_049403 3300053111 Bacteria 1248
328 Ga0500572_064446 3300053111 Bacteria 1120
329 Ga0500597_011557 3300053120 Bacteria 3200
330 Ga0500608_000822 3300053122 Bacteria 11255
331 Ga0500618_000222 3300053125 Bacteria 44764
332 Ga0500618_000241 3300053125 Bacteria 43403
333 Ga0500618_000668 3300053125 Bacteria 20211
334 Ga0500618_001256 3300053125 Bacteria 11822
335 Ga0500658_0000110 3300053134 Bacteria 38421
336 Ga0500559_0005199 3300053136 Bacteria 6007
337 Ga0500559_0067786 3300053136 Bacteria 1602
338 Ga0500561_0014908 3300053137 Bacteria 1715
339 Ga0500564_000492 3300053138 Bacteria 11587
340 Ga0500574_000181 3300053141 Bacteria 7439
341 Ga0500590_000077 3300053148 Bacteria 24739
342 Ga0500616_0000232 3300053153 Bacteria 87382
343 Ga0500619_010627 3300053154 Bacteria 2336
344 Ga0500624_000211 3300053157 Bacteria 22021
345 Ga0500634_0107875 3300053161 Bacteria 1380
346 Ga0500638_000049 3300053162 Bacteria 27994
347 Ga0500636_0000596 3300053177 Bacteria 19728
348 Ga0500636_0019410 3300053177 Bacteria 4024
349 Ga0500636_0149118 3300053177 Bacteria 1286
350 Ga0500636_0169935 3300053177 Bacteria 1180
351 Ga0501084_0706013 3300054114 Bacteria 850
352 Ga0466962_0054180 3300061719 Bacteria 1917
353 2509445109 2509276033 Bacteria 7180565
354 2510897026 2510461076 Bacteria 8618824
355 2511175582 2510917026 Bacteria 7046020
356 2513600231 2513237088 Bacteria 6927906
357 2513712675 2513237103 Bacteria 7647401
358 2513996966 2513237159 Bacteria 6810126
359 2514023563 2513237162 Bacteria 7468464
360 2515644921 2515154114 Bacteria 7848616
361 2515659430 2515154116 Bacteria 7552979
362 2517042445 2516653077 Bacteria 7555578
363 2517566773 2517487022 Bacteria 7227575
364 2551715404 2551306089 Bacteria 7162724
365 2585204453 2582581294 Bacteria 6626667
366 2585228310 2582581299 Bacteria 6518058
367 2585231398 2582581299 Bacteria 6518058
368 2585275215 2582581307 Bacteria 6597605
369 2585283749 2582581308 Bacteria 7413247
370 2585329229 2582581315 Bacteria 7318924
371 2585336671 2582581316 Bacteria 7774528
372 2585537071 2585427527 Bacteria 7273426
373 2585542235 2585427528 Bacteria 6842387
374 2585556496 2585427530 Bacteria 7383882
375 2585561070 2585427531 Bacteria 6992870
376 2585840569 2585427593 Bacteria 7141551
377 2585900859 2585427608 Bacteria 6544331
378 2585908339 2585427609 Bacteria 6667127
379 2585998190 2585427633 Bacteria 6413184
380 2586002767 2585427634 Bacteria 6455027
381 2587983626 2585428125 Bacteria 6662905
382 2599720218 2599185236 Bacteria 6875203
383 2616310071 2615840626 Bacteria 7921970
384 2617384509 2617270742 Bacteria 6808054
385 2644049769 2643221607 Bacteria 6314006
386 2644202719 2643221636 Bacteria 6583769
387 2644482049 2643221686 Bacteria 6310811
388 2644731260 2643221733 Bacteria 5690728
389 2657685035 2657244999 Bacteria 5946535
390 2671116234 2667528174 Bacteria 6435400
391 2719184131 2718217882 Bacteria 6556348
392 2719669469 2718217997 Bacteria 6740740
393 2719729704 2718218009 Bacteria 6478651
394 2720494485 2718218199 Bacteria 6740745
395 2720610822 2718218232 Bacteria 6720332
396 2720616700 2718218233 Bacteria 6662049
397 2720628057 2718218235 Bacteria 6630699
398 2720771637 2718218269 Bacteria 6906114
399 2721143954 2718218363 Bacteria 6524337
400 2721156642 2718218365 Bacteria 6274507
401 2721161329 2718218366 Bacteria 6425255
402 2722837282 2721755514 Bacteria 6424414
403 2723030900 2721755556 Bacteria 6745503
404 2723563400 2721755684 Bacteria 6859907
405 2723571391 2721755685 Bacteria 6704835
406 2724040858 2721755810 Bacteria 6479005
407 2724087186 2721755819 Bacteria 6906405
408 2724100897 2721755822 Bacteria 6726041
409 2724108138 2721755823 Bacteria 6752556
410 2730105366 2728369352 Bacteria 6745171
411 2730162271 2728369365 Bacteria 6555560
412 2730295403 2728369397 Bacteria 6274511
413 2739037470 2738541333 Bacteria 7106503
414 2778178907 2775507266 Bacteria 7392367
415 2793295788 2791355256 Bacteria 6798008
416 2793321952 2791355260 Bacteria 6598818
417 2793329450 2791355261 Bacteria 6661293
418 2793340804 2791355263 Bacteria 6872478
419 2802723772 2802428859 Bacteria 6667919
420 2804754870 2802429268 Bacteria 6094027
421 2806047197 2802429633 Bacteria 7341974
422 2806054804 2802429634 Bacteria 7083200
423 2806061968 2802429635 Bacteria 7650140
424 2806069509 2802429636 Bacteria 7597525
425 2806076120 2802429637 Bacteria 7067217
426 2819642481 2818991453 Bacteria 7181617
427 2819682780 2818991461 Bacteria 7026071
428 2821128612 2821123053 Bacteria 7836056
429 2838047604 2838042994 Bacteria 6046894
430 2838072403 2838068647 Bacteria 6208656
431 2838741629 2838736955 Bacteria 5760694
432 2841845537 2841840854 Bacteria 5761912
433 2842145240 2842140634 Bacteria 5759631
434 2842223520 2842217011 Bacteria 7497767
435 2842361664 2842357229 Bacteria 6485165
436 2842396868 2842395702 Bacteria 6780583
437 2842426150 2842422224 Bacteria 6239196
438 2842452569 2842447887 Bacteria 6754142
439 2842487067 2842482326 Bacteria 7212537
440 2842513829 2842509118 Bacteria 6850950
441 2842522794 2842521101 Bacteria 6569494
442 2852395303 2852387548 Bacteria 8025568
443 2854902161 2854896431 Bacteria 5869725
444 2854917240 2854916844 Bacteria 5725939
445 2857534235 2857531043 Bacteria 6754041
446 2916001719 2916000859 Bacteria 6865702
447 2917700018 2917699015 Bacteria 7043791
448 2919172722 2919171160 Bacteria 6499771
449 2919413920 2919408235 Bacteria 6149349
450 2921255646 2921250672 Bacteria 6677771
451 2924180611 2924179722 Bacteria 6843264
452 2936382401 2936381700 Bacteria 7006523
453 2937080522 2937078374 Bacteria 6610289
454 2957419604 2957415311 Bacteria 6991633
455 2957442382 2957437181 Bacteria 6568994
456 2957444594 2957443900 Bacteria 6869977
457 2960591656 2960591022 Bacteria 6622873
458 2960618494 2960617483 Bacteria 6727748
459 2960661378 2960660292 Bacteria 7041660
460 2970029483 2970026789 Bacteria 6785236
461 2970096936 2970095765 Bacteria 6936963
462 2977528211 2977523885 Bacteria 6960446
463 2977533737 2977530762 Bacteria 6951399
464 2979095313 2979089926 Bacteria 5670289
465 2979097566 2979095461 Bacteria 5669583
466 2989776604 2989771324 Bacteria 5605128
467 2996894571 2996893221 Bacteria 5823108
468 3005419087 3005416602 Bacteria 7064308
469 3005455223 3005452660 Bacteria 5889319
470 639645577 639633055 Bacteria 7751309
471 8005258747 8005258706 Bacteria 6184835
472 8005287229 8005282627 Bacteria 6675747
473 8005292138 8005289223 Bacteria 6634003
474 8005307321 8005301065 Bacteria 6614431
475 8005435625 8005430974 Bacteria 6689030
476 8005503368 8005497431 Bacteria 6477605
477 8005570949 8005570704 Bacteria 6957481
478 8005631928 8005626139 Bacteria 6534237
479 8005645499 8005645114 Bacteria 6950293
480 8005675246 8005668836 Bacteria 6953162
481 8005688317 8005682033 Bacteria 6726518
482 8005688609 8005688590 Bacteria 6610080
483 8005701035 8005695170 Bacteria 6912330
484 8024491194 8024486573 Bacteria 6540512
485 8046774339 8046767195 Bacteria 7547379
486 8049297987 8049293176 Bacteria 6128433
487 8057576551 8057575449 Bacteria 7367519
488 8057878912 8057874678 Bacteria 7494653
489 8057880012 8057874678 Bacteria 7494653
490 Ga0105239_10261128
491 JGI24740J21852_10000059
492 JGI25155J39150_1000026
493 JGI25156J39149_1000028
494 JGI25162J39368_1000238
495 JGI25162J39368_1000452
496 JGI25154J39366_1000046
497 JGI25157J39369_1000358
498 JGI25159J45721_1000056
499 JGI25151J46595_10001124
500 JGI25165J46597_1000116
501 JGI25165J46597_1000722
502 JGI25165J46597_1004082
503 JGI25153J46596_10004984
504 JGI25153J46596_10050541
505 rootH2_10105471
506 rootL2_10008082
507 rootL2_10185335
508 rootH1_10269008
509 JGI25160J50197_1000026
510 JGI25160J50197_1002772
511 JGI25161J50226_1000014
512 JGI25161J50226_1001565
513 Ga0055526_1000795
514 Ga0055526_1002999
515 Ga0055524_1001465
516 Ga0055536_1006281
517 Ga0055528_1000746
518 Ga0055528_1001731
519 Ga0055540_1002077
520 Ga0055540_1006183
521 Ga0055531_10004284
522 Ga0055543_1000052
523 Ga0055543_1000765
524 Ga0065165_1000073
525 Ga0065165_1013874
526 Ga0070658_10189682
527 Ga0070660_100009283
528 Ga0070692_10003220
529 Ga0070659_100003145
530 Ga0070659_100209157
531 Ga0070663_100016761
532 Ga0070679_100118919
533 Ga0068855_100036701
534 Ga0068855_100040565
535 Ga0068856_100020042
536 Ga0068852_100196129
537 Ga0075365_10002649
538 Ga0075365_10003501
539 Ga0075365_10010935
540 Ga0075368_10009381
541 Ga0075368_10098617
542 Ga0075363_100003241
543 Ga0075364_10004374
544 Ga0075362_10001375
545 Ga0075362_10109782
546 Ga0075367_10012924
547 Ga0075369_10002720
548 Ga0075366_10002825
549 Ga0075370_10001260
550 Ga0075370_10002787
551 Ga0075370_10014054
552 Ga0075433_10029023
553 Ga0075434_100692137
554 Ga0079104_1000101
555 Ga0079104_1025918
556 Ga0099826_10010074
557 Ga0105244_10102329
558 Ga0105240_10002575
559 Ga0105240_10062827
560 Ga0111539_10484160
561 Ga0105247_10127032
562 Ga0105243_10051220
563 Ga0105248_10309236
564 Ga0105237_10021145
565 Ga0105238_10144842
566 Ga0105239_10735007
567 Ga0157370_10001604
568 Ga0157369_10478901
569 Ga0157369_10588614
570 Ga0163162_10878417
571 Ga0182007_10017063
572 Ga0182005_1004457
573 Ga0163161_10083450
574 Ga0163161_10298984
575 Ga0213872_10007397
576 Ga0213872_10016359
577 Ga0213872_10029293
578 Ga0213872_10063797
579 Ga0228711_1010171
580 Ga0228710_1004457
581 Ga0228598_1014371
582 Ga0209435_100017
583 Ga0209437_100128
584 Ga0209437_100283
585 Ga0207425_1002847
586 Ga0209646_1000048
587 Ga0209646_1004088
588 Ga0209026_1000035
589 Ga0209677_101249
590 Ga0209759_1000027
591 Ga0209129_1000272
592 Ga0209233_1000072
593 Ga0209233_1000268
594 Ga0209233_1000727
595 Ga0209673_1000255
596 Ga0209673_1000733
597 Ga0209673_1001353
598 Ga0209130_1000121
599 Ga0209130_1014322
600 Ga0209676_1004782
601 Ga0209025_1000735
602 Ga0209025_1005649
603 Ga0209564_1000215
604 Ga0209564_1000695
605 Ga0209758_1000291
606 Ga0209758_1000687
607 Ga0209758_1019111
608 Ga0209758_1021839
609 Ga0209050_1008090
610 Ga0209256_1000155
611 Ga0209256_1003723
612 Ga0209256_1005635
613 Ga0207426_1000075
614 Ga0207426_1000569
615 Ga0209051_1000708
616 Ga0209051_1000958
617 Ga0209257_1002285
618 Ga0207705_10009721
619 Ga0207695_10002230
620 Ga0207695_10002873
621 Ga0207671_10000448
622 Ga0207657_10000691
623 Ga0207690_10003380
624 Ga0207711_10231084
625 Ga0207667_10028261
626 Ga0207667_10043415
627 Ga0207667_10049566
628 Ga0207678_10059952
629 Ga0207702_10063758
630 Ga0207698_10335788
631 Ga0209281_1000028
632 Ga0209282_1000075
633 Ga0209813_10061622
634 Ga0268266_10117337
635 Ga0307515_10237761
636 Ga0307513_10139434
637 Ga0315914_1001307
638 Ga0307414_10099079
639 Ga0307510_10004106
640 Ga0307510_10120258
641 Ga0315913_1001596
642 Ga0315915_1000042
643 Ga0395905_0013599
644 Ga0436364_0590203
645 Ga0395901_0203317
646 Ga0436361_0216394
647 Ga0436361_0279546
648 Ga0436361_0318174
649 Ga0436361_0445149
650 Ga0436361_0466496
651 Ga0436361_0716635
652 Ga0436363_1620207
653 Ga0439436_0006571
654 Ga0439438_033762
655 Ga0439465_0050962
656 Ga0451787_505587
657 Ga0451798_0984989
658 Ga0451833_0769068
659 Ga0451835_0082151
660 Ga0451837_0219012
661 Ga0451839_0746754
662 Ga0451841_0129660
663 Ga0451845_0290259
664 Ga0451847_0654864
665 Ga0451849_0244831
666 Ga0451851_0235632
667 Ga0451843_0574778
668 Ga0451855_1284999
669 Ga0451853_2617308
670 Ga0439449_0078124
671 Ga0439462_0014504
672 Ga0450922_005721
673 Ga0450918_005058
674 Ga0466958_0054347
675 Ga0495617_002663
676 Ga0495638_0001006
677 Ga0495664_0087353
678 Ga0495585_0005189
679 Ga0495607_0028936
680 Ga0495607_0050585
681 Ga0495583_0002616
682 Ga0495583_0012475
683 Ga0495583_0013197
684 Ga0495583_0150713
685 Ga0495608_0200930
686 Ga0495610_0004908
687 Ga0495610_0005552
688 Ga0495618_0038112
689 Ga0495620_0000299
690 Ga0495620_0001326
691 Ga0495628_0182755
692 Ga0495631_0204825
693 Ga0495632_0115850
694 Ga0495632_0233968
695 Ga0495637_0119166
696 Ga0495643_0002758
697 Ga0495643_0003892
698 Ga0495643_0014793
699 Ga0495648_0001065
700 Ga0495648_0001954
701 Ga0495663_0000101
702 Ga0495652_0107296
703 Ga0495654_0000296
704 Ga0495640_0153396
705 Ga0495609_0148829
706 Ga0495597_0205656
707 Ga0495622_0002093
708 Ga0495633_0011839
709 Ga0495656_0217044
710 Ga0495634_0071400
711 Ga0495611_0000583
712 Ga0495625_0001051
713 Ga0495625_0018483
714 Ga0495625_0080325
715 Ga0495635_0176989
716 Ga0495661_0003002
717 Ga0495588_0001206
718 Ga0495646_0105199
719 Ga0495658_0010586
720 Ga0495613_0000402
721 Ga0495624_0135518
722 Ga0495670_0000129
723 Ga0495670_0027911
724 Ga0495671_0000401
725 Ga0495649_0000882
726 Ga0495660_0002916
727 Ga0495660_0233251
728 Ga0495674_0216522
729 Ga0495672_0103932
730 Ga0495676_0154689
731 Ga0495683_0100498
732 Ga0495687_000478
733 Ga0495687_000998
734 Ga0495687_002738
735 Ga0495681_0000869
736 Ga0495681_0014299
737 Ga0495686_0001164
738 Ga0495593_0146689
739 Ga0495602_0112693
740 Ga0496100_0088828
741 Ga0496111_0001362
742 Ga0496116_0082781
743 Ga0496117_0006474
744 Ga0496119_0003374
745 Ga0496119_0008838
746 Ga0496119_0019451
747 Ga0496119_0175494
748 Ga0496120_0003022
749 Ga0496120_0038163
750 Ga0496120_0150023
751 Ga0496121_0016319
752 Ga0496121_0016320
753 Ga0496121_0035625
754 Ga0496121_0234992
755 Ga0496122_0000960
756 Ga0496122_0003049
757 Ga0496122_0004420
758 Ga0496122_0103634
759 Ga0496122_0332071
760 Ga0496123_0000764
761 Ga0496123_0002513
762 Ga0496123_0004959
763 Ga0496123_0037512
764 Ga0496124_0005589
765 Ga0496124_0008170
766 Ga0496124_0016905
767 Ga0496124_0060047
768 Ga0496125_0015172
769 Ga0496125_0044149
770 Ga0496126_0118709
771 Ga0496126_0122333
772 Ga0496126_0388971
773 Ga0495678_000635
774 Ga0495682_0000331
775 Ga0501036_0113588
776 Ga0501037_0199244
777 Ga0501038_0051247
778 Ga0501039_0361060
779 Ga0501040_0128698
780 Ga0501041_0236019
781 Ga0501042_0115267
782 Ga0501043_0232736
783 Ga0501072_0115407
784 Ga0501073_0055068
785 Ga0501074_0369988
786 Ga0501075_0026281
787 Ga0501238_009246
788 Ga0501080_0147935
789 Ga0501080_0487000
790 Ga0501081_0036975
791 nmdc:mga03683_16700_c1
792 nmdc:mga03683_38086_c1
793 nmdc:mga03n38_9657_c1
794 nmdc:mga00v17_2209_c1
795 nmdc:mga0yw44_555_c1
796 nmdc:mga0yw44_5930_c1
797 nmdc:mga0yw44_6532_c1
798 nmdc:mga0k408_4354_c1
799 nmdc:mga06z11_23792_c1
800 nmdc:mga06z11_6008_c1
801 nmdc:mga04h51_47931_c1
802 nmdc:mga04h51_73682_c1
803 nmdc:mga07m45_1121_c1
804 nmdc:mga07m45_15007_c1
805 nmdc:mga07m45_1743_c1
806 nmdc:mga08y16_356958_c1
807 nmdc:mga0sz30_31852_c1
808 Ga0495601_0172827
809 Ga0495655_0100339
810 Ga0500578_0001023
811 Ga0500643_056314
812 Ga0500583_0000368
813 Ga0500566_0200019
814 Ga0500555_002310
815 Ga0500556_0000834
816 Ga0500572_049403
817 Ga0500572_064446
818 Ga0500597_011557
819 Ga0500608_000822
820 Ga0500618_000222
821 Ga0500618_000241
822 Ga0500618_000668
823 Ga0500618_001256
824 Ga0500658_0000110
825 Ga0500559_0005199
826 Ga0500559_0067786
827 Ga0500561_0014908
828 Ga0500564_000492
829 Ga0500574_000181
830 Ga0500590_000077
831 Ga0500616_0000232
832 Ga0500619_010627
833 Ga0500624_000211
834 Ga0500634_0107875
835 Ga0500638_000049
836 Ga0500636_0000596
837 Ga0500636_0019410
838 Ga0500636_0149118
839 Ga0500636_0169935
840 Ga0501084_0706013
841 Ga0466962_0054180
842 2509445109
843 2510897026
844 2511175582
845 2513600231
846 2513712675
847 2513996966
848 2514023563
849 2515644921
850 2515659430
851 2517042445
852 2517566773
853 2551715404
854 2585204453
855 2585228310
856 2585231398
857 2585275215
858 2585283749
859 2585329229
860 2585336671
861 2585537071
862 2585542235
863 2585556496
864 2585561070
865 2585840569
866 2585900859
867 2585908339
868 2585998190
869 2586002767
870 2587983626
871 2599720218
872 2616310071
873 2617384509
874 2644049769
875 2644202719
876 2644482049
877 2644731260
878 2657685035
879 2671116234
880 2719184131
881 2719669469
882 2719729704
883 2720494485
884 2720610822
885 2720616700
886 2720628057
887 2720771637
888 2721143954
889 2721156642
890 2721161329
891 2722837282
892 2723030900
893 2723563400
894 2723571391
895 2724040858
896 2724087186
897 2724100897
898 2724108138
899 2730105366
900 2730162271
901 2730295403
902 2739037470
903 2778178907
904 2793295788
905 2793321952
906 2793329450
907 2793340804
908 2802723772
909 2804754870
910 2806047197
911 2806054804
912 2806061968
913 2806069509
914 2806076120
915 2819642481
916 2819682780
917 2821128612
918 2838047604
919 2838072403
920 2838741629
921 2841845537
922 2842145240
923 2842223520
924 2842361664
925 2842396868
926 2842426150
927 2842452569
928 2842487067
929 2842513829
930 2842522794
931 2852395303
932 2854902161
933 2854917240
934 2857534235
935 2916001719
936 2917700018
937 2919172722
938 2919413920
939 2921255646
940 2924180611
941 2936382401
942 2937080522
943 2957419604
944 2957442382
945 2957444594
946 2960591656
947 2960618494
948 2960661378
949 2970029483
950 2970096936
951 2977528211
952 2977533737
953 2979095313
954 2979097566
955 2989776604
956 2996894571
957 3005419087
958 3005455223
959 639645577
960 8005258747
961 8005287229
962 8005292138
963 8005307321
964 8005435625
965 8005503368
966 8005570949
967 8005631928
968 8005645499
969 8005675246
970 8005688317
971 8005688609
972 8005701035
973 8024491194
974 8046774339
975 8049297987
976 8057576551
977 8057878912
978 8057880012

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

38

148

0.98

PF00486

Trans_reg_C

Transcriptional regulatory protein, C terminal

188

264

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1nxt-assembly1.cif.gz_A-2 micarec ph 4.0 0.9834 9 126
2a9r-assembly1.cif.gz_A-2 rr02-rec phosphate in the active site 0.9784 9 126
7m0s-assembly1.cif.gz_B n-terminal domain of pmra from acinetobacter baumannii 0.9782 9 126
1nxx-assembly1.cif.gz_A-2 micarec ph 5.5 0.976 9 126
8fk2-assembly1.cif.gz_B the n-terminal vicr from streptococcus mutans 0.9752 9 126
ID Description Score Start End Superfamily
af_P38684_4_86_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.976 10 91 3.40.50.2300
af_P0AA16_3_84_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9752 8 88 3.40.50.2300
af_P9WGN1_2_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9712 10 85 3.40.50.2300
af_P0A9Q1_5_87_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9701 10 91 3.40.50.2300
2qzjA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9666 8 126 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A523CLE6-F1-model_v4 deleted 0.973 9 122
AF-A0A4R3JG41-F1-model_v4 Response regulator receiver domain-containing protein 0.9721 8 126 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A559TKX8-F1-model_v4 Two-component system phosphate regulon response regulator OmpR 0.9715 9 240 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A0P6YAV3-F1-model_v4 Fis family transcriptional regulator 0.9707 8 125 GO:0000160
GO:0005524
GO:0006355
GO:0043565
AF-G2H3C4-F1-model_v4 deleted 0.9701 9 122

Map