F453779

General Info

Members Datasets Scaffolds Average Seq Length
489 187 978 275

Family's Representative Sequence

Representative Sequence 3300013100|Ga0157373_10192285|Ga0157373_101922852
Length 313
Sequence MSLRHCRETLMVDRKSTIPEQERRRSLRNGAKWGIAIMFACKRKIVPAVFAAVIAAGVGAPASAGVGDLLVAPTRIVLDGRRGTEIVLNNVGDEPATYRISVEFRRMTPEGDLVEETNPTPQEQAAADMIVYAPRRVTLAPHEPQSIRIAARPPQGLPDGEYRVHLLFRAVPTATPVVAAAATEPVKGLHLQLIPIYGVTIPVIVRLGNLQVAAGIANVQLERKDGKAEIALDLTRSGTRSTFGEVRVFKTGVKDPIAVQRAVAVYTDVGTRRVTIPVDDNYKGELAGPVTVQYVETYDDGNQKIAETQAVLR

Samples

Sample ID Description Type Environment
1 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
7 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
8 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
64 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
72 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
73 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
74 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
75 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
122 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
123 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
124 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
125 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
126 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
127 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
128 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
129 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
130 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
131 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
132 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
133 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
134 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
135 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
136 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
137 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
138 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
139 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
140 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
141 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
142 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
143 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
144 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
145 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
146 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
147 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
148 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
149 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
150 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
151 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
152 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
153 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
154 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
155 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
156 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
157 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
158 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
159 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
160 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
161 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
162 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
163 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
164 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
165 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
166 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
167 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
168 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
169 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
170 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
171 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
172 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
173 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
174 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
175 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
176 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
177 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
178 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
179 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
180 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
181 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
182 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
183 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
184 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
185 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
186 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
187 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.61
Nodule 0
Rhizoplane 4.29
Rhizosphere 94.07
Stem 0
Stem Tuber 0
Unclassified 11.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157373_10192285 3300013100 Bacteria 1438
2 JGI24741J21665_1000945 3300001915 Bacteria 8779
3 JGI24740J21852_10002505 3300001979 Bacteria 8297
4 JGI24739J22299_10005843 3300001989 Bacteria 4659
5 JGI24737J22298_10001044 3300001990 Bacteria 9778
6 JGI24737J22298_10001902 3300001990 Bacteria 7461
7 JGI24743J22301_10012411 3300001991 Bacteria 1549
8 JGI24735J21928_10001547 3300002067 Bacteria 8167
9 JGI24735J21928_10013203 3300002067 Unclassified 2600
10 JGI24738J21930_10001538 3300002075 Bacteria 6362
11 JGI24738J21930_10016354 3300002075 Bacteria 1568
12 rootH1_10181345 3300003323 Bacteria 2987
13 Ga0070658_10000177 3300005327 Bacteria 56043
14 Ga0070658_10006077 3300005327 Bacteria 9790
15 Ga0070658_10029744 3300005327 Bacteria 4389
16 Ga0070658_10044566 3300005327 Bacteria 3585
17 Ga0070658_10072461 3300005327 Bacteria 2823
18 Ga0070658_10106502 3300005327 Bacteria 2320
19 Ga0070658_10385840 3300005327 Bacteria 1202
20 Ga0070676_10016570 3300005328 Bacteria 4076
21 Ga0070676_10059625 3300005328 Bacteria 2264
22 Ga0070676_10179052 3300005328 Bacteria 1377
23 Ga0070683_100009270 3300005329 Bacteria 8409
24 Ga0070683_100025253 3300005329 Bacteria 5333
25 Ga0070683_100223635 3300005329 Bacteria 1789
26 Ga0070683_100776264 3300005329 Unclassified 918
27 Ga0070690_100003082 3300005330 Bacteria 9064
28 Ga0070690_100344128 3300005330 Bacteria 1080
29 Ga0070670_100019970 3300005331 Bacteria 5751
30 Ga0070670_100021121 3300005331 Bacteria 5600
31 Ga0070670_100227779 3300005331 Bacteria 1622
32 Ga0070670_100399185 3300005331 Bacteria 1214
33 Ga0070677_10056286 3300005333 Bacteria 1608
34 Ga0068869_100032086 3300005334 Bacteria 3699
35 Ga0070666_10002966 3300005335 Bacteria 10287
36 Ga0070666_10009029 3300005335 Bacteria 6209
37 Ga0070682_100004323 3300005337 Bacteria 7889
38 Ga0070682_100030038 3300005337 Bacteria 3277
39 Ga0068868_100002927 3300005338 Bacteria 11850
40 Ga0068868_100134180 3300005338 Bacteria 2028
41 Ga0068868_100632782 3300005338 Bacteria 951
42 Ga0070660_100000065 3300005339 Bacteria 61999
43 Ga0070660_100008636 3300005339 Bacteria 7134
44 Ga0070660_100020612 3300005339 Bacteria 4848
45 Ga0070660_100097168 3300005339 Bacteria 2330
46 Ga0070660_100153519 3300005339 Bacteria 1852
47 Ga0070660_100192842 3300005339 Bacteria 1651
48 Ga0070660_100212882 3300005339 Bacteria 1569
49 Ga0070660_100355952 3300005339 Bacteria 1206
50 Ga0070660_100470338 3300005339 Bacteria 1044
51 Ga0070687_100047630 3300005343 Bacteria 2200
52 Ga0070661_100000084 3300005344 Bacteria 74971
53 Ga0070661_100015350 3300005344 Bacteria 5406
54 Ga0070661_100020585 3300005344 Bacteria 4707
55 Ga0070661_100047940 3300005344 Bacteria 3127
56 Ga0070661_100125144 3300005344 Bacteria 1928
57 Ga0070661_100224026 3300005344 Unclassified 1443
58 Ga0070692_10002153 3300005345 Bacteria 7546
59 Ga0070668_100009829 3300005347 Bacteria 7087
60 Ga0070668_100028392 3300005347 Bacteria 4248
61 Ga0070669_100222914 3300005353 Bacteria 1491
62 Ga0070671_100002759 3300005355 Bacteria 13636
63 Ga0070671_100012827 3300005355 Bacteria 6758
64 Ga0070671_100014142 3300005355 Bacteria 6445
65 Ga0070671_100024948 3300005355 Bacteria 4899
66 Ga0070671_100029282 3300005355 Bacteria 4540
67 Ga0070674_100005949 3300005356 Bacteria 7090
68 Ga0070674_100019790 3300005356 Bacteria 4284
69 Ga0070673_100081978 3300005364 Bacteria 2617
70 Ga0070673_100114157 3300005364 Bacteria 2244
71 Ga0070673_100220743 3300005364 Bacteria 1640
72 Ga0070673_100462199 3300005364 Bacteria 1143
73 Ga0070659_100000067 3300005366 Bacteria 81723
74 Ga0070659_100014420 3300005366 Bacteria 5907
75 Ga0070659_100020005 3300005366 Bacteria 5081
76 Ga0070659_100036707 3300005366 Bacteria 3821
77 Ga0070659_100037802 3300005366 Bacteria 3763
78 Ga0070659_100041060 3300005366 Bacteria 3615
79 Ga0070667_100001373 3300005367 Bacteria 21792
80 Ga0070667_100003485 3300005367 Bacteria 13408
81 Ga0070667_100009685 3300005367 Bacteria 7986
82 Ga0070667_100020730 3300005367 Bacteria 5459
83 Ga0070667_100032533 3300005367 Bacteria 4350
84 Ga0070667_100082068 3300005367 Bacteria 2759
85 Ga0070663_100014600 3300005455 Bacteria 5046
86 Ga0070663_100075508 3300005455 Bacteria 2463
87 Ga0070663_100103566 3300005455 Bacteria 2127
88 Ga0070663_100405480 3300005455 Bacteria 1115
89 Ga0070678_100028211 3300005456 Bacteria 3825
90 Ga0070678_100199043 3300005456 Unclassified 1652
91 Ga0070662_100000017 3300005457 Bacteria 105478
92 Ga0070662_100020255 3300005457 Unclassified 4527
93 Ga0070662_100027186 3300005457 Bacteria 3969
94 Ga0070662_100087097 3300005457 Bacteria 2337
95 Ga0070662_100330034 3300005457 Bacteria 1246
96 Ga0070681_10045851 3300005458 Bacteria 4372
97 Ga0070681_10253897 3300005458 Bacteria 1670
98 Ga0068867_100002594 3300005459 Bacteria 12741
99 Ga0068867_100021831 3300005459 Bacteria 4570
100 Ga0068867_100391248 3300005459 Unclassified 1170
101 Ga0070679_100205251 3300005530 Bacteria 1935
102 Ga0070684_100031467 3300005535 Bacteria 4517
103 Ga0070684_100052695 3300005535 Unclassified 3539
104 Ga0068853_100000784 3300005539 Bacteria 22095
105 Ga0068853_100324830 3300005539 Bacteria 1427
106 Ga0068853_100414175 3300005539 Bacteria 1263
107 Ga0070672_100097389 3300005543 Bacteria 2381
108 Ga0070672_100245737 3300005543 Bacteria 1506
109 Ga0070693_100003637 3300005547 Bacteria 7205
110 Ga0070693_100005538 3300005547 Bacteria 6074
111 Ga0070693_100010535 3300005547 Bacteria 4636
112 Ga0070665_100009769 3300005548 Bacteria 9704
113 Ga0070665_100052139 3300005548 Bacteria 4105
114 Ga0070665_100662707 3300005548 Bacteria 1057
115 Ga0070665_100735067 3300005548 Bacteria 1000
116 Ga0068855_100000194 3300005563 Bacteria 78505
117 Ga0068855_100021299 3300005563 Bacteria 7773
118 Ga0068855_100032275 3300005563 Bacteria 6253
119 Ga0068855_100147826 3300005563 Bacteria 2674
120 Ga0070664_100000098 3300005564 Bacteria 55907
121 Ga0070664_100026020 3300005564 Bacteria 4851
122 Ga0070664_100028290 3300005564 Plasmid 4662
123 Ga0070664_100039683 3300005564 Bacteria 3968
124 Ga0070664_100151387 3300005564 Bacteria 2048
125 Ga0068857_100005314 3300005577 Bacteria 10969
126 Ga0068857_100013488 3300005577 Bacteria 7118
127 Ga0068857_100063448 3300005577 Unclassified 3284
128 Ga0068857_100105855 3300005577 Bacteria 2526
129 Ga0068857_100106082 3300005577 Bacteria 2523
130 Ga0068854_100005842 3300005578 Bacteria 7791
131 Ga0068854_100017701 3300005578 Bacteria 4772
132 Ga0068854_100111319 3300005578 Bacteria 2065
133 Ga0068856_100000098 3300005614 Bacteria 83221
134 Ga0068856_100006038 3300005614 Bacteria 11910
135 Ga0068856_100044407 3300005614 Unclassified 4374
136 Ga0068856_100174396 3300005614 Unclassified 2163
137 Ga0068852_100000440 3300005616 Bacteria 27519
138 Ga0068852_100015063 3300005616 Bacteria 5981
139 Ga0068852_100040536 3300005616 Unclassified 3930
140 Ga0068852_100043567 3300005616 Bacteria 3807
141 Ga0068852_100105944 3300005616 Bacteria 2548
142 Ga0068852_100132466 3300005616 Bacteria 2297
143 Ga0068852_100167747 3300005616 Bacteria 2055
144 Ga0068852_100269287 3300005616 Bacteria 1638
145 Ga0068859_100014688 3300005617 Bacteria 7870
146 Ga0068859_100231626 3300005617 Bacteria 1935
147 Ga0068864_100007289 3300005618 Bacteria 9095
148 Ga0068864_100039601 3300005618 Bacteria 4028
149 Ga0068861_100003591 3300005719 Bacteria 10329
150 Ga0068851_10005321 3300005834 Bacteria 5843
151 Ga0068851_10007903 3300005834 Bacteria 4900
152 Ga0068851_10009250 3300005834 Plasmid 4575
153 Ga0068851_10013018 3300005834 Bacteria 3933
154 Ga0068863_100028209 3300005841 Bacteria 5359
155 Ga0068863_100028966 3300005841 Bacteria 5289
156 Ga0068863_100126892 3300005841 Bacteria 2434
157 Ga0068858_100002697 3300005842 Bacteria 17886
158 Ga0068858_100061526 3300005842 Bacteria 3471
159 Ga0068858_100080233 3300005842 Unclassified 3032
160 Ga0068858_100264931 3300005842 Bacteria 1634
161 Ga0068860_100033259 3300005843 Bacteria 4948
162 Ga0068860_100045866 3300005843 Bacteria 4168
163 Ga0068860_100168378 3300005843 Bacteria 2116
164 Ga0068860_100320739 3300005843 Bacteria 1521
165 Ga0068862_100005832 3300005844 Bacteria 10265
166 Ga0068862_100106891 3300005844 Bacteria 2453
167 Ga0068862_100239606 3300005844 Bacteria 1649
168 Ga0097620_100014689 3300006931 Bacteria 7870
169 Ga0097620_100231633 3300006931 Bacteria 1935
170 Ga0105250_10048451 3300009092 Bacteria 1704
171 Ga0105243_10010329 3300009148 Bacteria 7091
172 Ga0105243_10077822 3300009148 Bacteria 2699
173 Ga0105241_10086449 3300009174 Unclassified 2466
174 Ga0105241_10367918 3300009174 Unclassified 1253
175 Ga0105248_10000390 3300009177 Bacteria 50573
176 Ga0105248_10000444 3300009177 Bacteria 47003
177 Ga0105248_10065574 3300009177 Bacteria 4077
178 Ga0105248_10075590 3300009177 Bacteria 3785
179 Ga0105248_10105096 3300009177 Bacteria 3184
180 Ga0105248_10108678 3300009177 Bacteria 3127
181 Ga0105248_10138328 3300009177 Unclassified 2747
182 Ga0105238_10091387 3300009551 Bacteria 3031
183 Ga0105249_10357220 3300009553 Bacteria 1482
184 Ga0105249_10398710 3300009553 Unclassified 1406
185 Ga0157373_10007422 3300013100 Bacteria 8155
186 Ga0157373_10008483 3300013100 Bacteria 7633
187 Ga0157373_10010065 3300013100 Bacteria 6968
188 Ga0157373_10015842 3300013100 Bacteria 5504
189 Ga0157373_10023873 3300013100 Bacteria 4431
190 Ga0157373_10029599 3300013100 Bacteria 3944
191 Ga0157373_10097829 3300013100 Bacteria 2066
192 Ga0157373_10181548 3300013100 Bacteria 1482
193 Ga0157371_10007622 3300013102 Bacteria 8732
194 Ga0157371_10008828 3300013102 Bacteria 7983
195 Ga0157371_10012219 3300013102 Bacteria 6574
196 Ga0157371_10285441 3300013102 Bacteria 1193
197 Ga0157370_10250386 3300013104 Bacteria 1639
198 Ga0157369_10087737 3300013105 Bacteria 3322
199 Ga0157369_10125921 3300013105 Bacteria 2716
200 Ga0157378_10007549 3300013297 Bacteria 9494
201 Ga0163162_10017775 3300013306 Bacteria 6957
202 Ga0157372_10008404 3300013307 Bacteria 10966
203 Ga0157372_11017847 3300013307 Unclassified 959
204 Ga0157375_10049675 3300013308 Bacteria 4111
205 Ga0157375_10833246 3300013308 Bacteria 1070
206 Ga0163163_10000169 3300014325 Bacteria 68481
207 Ga0157380_10104835 3300014326 Bacteria 2363
208 Ga0182008_10010000 3300014497 Bacteria 5094
209 Ga0157379_10002940 3300014968 Bacteria 14373
210 Ga0157379_10364202 3300014968 Unclassified 1325
211 Ga0213875_10012836 3300021388 Bacteria 4127
212 Ga0207697_10119428 3300025315 Bacteria 1133
213 Ga0207688_10017162 3300025901 Bacteria 3934
214 Ga0207688_10041065 3300025901 Bacteria 2572
215 Ga0207680_10000773 3300025903 Bacteria 15110
216 Ga0207680_10004846 3300025903 Bacteria 6401
217 Ga0207647_10002702 3300025904 Bacteria 13390
218 Ga0207647_10003119 3300025904 Bacteria 12451
219 Ga0207647_10039243 3300025904 Bacteria 2989
220 Ga0207645_10033399 3300025907 Bacteria 3307
221 Ga0207645_10055672 3300025907 Bacteria 2525
222 Ga0207645_10074852 3300025907 Bacteria 2168
223 Ga0207705_10000137 3300025909 Bacteria 79174
224 Ga0207705_10002175 3300025909 Bacteria 15159
225 Ga0207705_10002960 3300025909 Bacteria 12984
226 Ga0207705_10007990 3300025909 Bacteria 7762
227 Ga0207705_10062200 3300025909 Bacteria 2696
228 Ga0207705_10075559 3300025909 Unclassified 2447
229 Ga0207705_10084069 3300025909 Bacteria 2323
230 Ga0207705_10194700 3300025909 Bacteria 1534
231 Ga0207705_10197923 3300025909 Bacteria 1522
232 Ga0207705_10473474 3300025909 Bacteria 972
233 Ga0207654_10162115 3300025911 Unclassified 1445
234 Ga0207707_10002628 3300025912 Bacteria 16085
235 Ga0207707_10131997 3300025912 Bacteria 2184
236 Ga0207660_10021258 3300025917 Unclassified 4363
237 Ga0207662_10047425 3300025918 Unclassified 2544
238 Ga0207657_10000508 3300025919 Bacteria 41139
239 Ga0207657_10010583 3300025919 Bacteria 9197
240 Ga0207657_10016406 3300025919 Bacteria 7145
241 Ga0207657_10024685 3300025919 Bacteria 5559
242 Ga0207657_10028662 3300025919 Bacteria 5074
243 Ga0207657_10028863 3300025919 Bacteria 5055
244 Ga0207657_10075745 3300025919 Bacteria 2839
245 Ga0207657_10094004 3300025919 Bacteria 2497
246 Ga0207657_10287964 3300025919 Bacteria 1303
247 Ga0207649_10000965 3300025920 Bacteria 17825
248 Ga0207649_10007538 3300025920 Bacteria 5915
249 Ga0207649_10012667 3300025920 Bacteria 4686
250 Ga0207649_10022690 3300025920 Bacteria 3627
251 Ga0207649_10026364 3300025920 Bacteria 3400
252 Ga0207652_10014489 3300025921 Bacteria 6387
253 Ga0207681_10029579 3300025923 Bacteria 3561
254 Ga0207681_10080833 3300025923 Bacteria 2293
255 Ga0207650_10023741 3300025925 Bacteria 4354
256 Ga0207659_10181635 3300025926 Unclassified 1667
257 Ga0207664_10209949 3300025929 Bacteria 1684
258 Ga0207644_10006575 3300025931 Bacteria 7572
259 Ga0207644_10011981 3300025931 Bacteria 5750
260 Ga0207644_10014817 3300025931 Bacteria 5226
261 Ga0207644_10022281 3300025931 Bacteria 4326
262 Ga0207690_10000108 3300025932 Bacteria 67599
263 Ga0207690_10001369 3300025932 Bacteria 15299
264 Ga0207690_10002887 3300025932 Bacteria 10351
265 Ga0207690_10027648 3300025932 Bacteria 3586
266 Ga0207690_10038137 3300025932 Bacteria 3125
267 Ga0207690_10230480 3300025932 Bacteria 1421
268 Ga0207706_10000514 3300025933 Bacteria 41167
269 Ga0207706_10007849 3300025933 Bacteria 9849
270 Ga0207706_10021750 3300025933 Bacteria 5756
271 Ga0207706_10025281 3300025933 Bacteria 5322
272 Ga0207706_10034311 3300025933 Bacteria 4514
273 Ga0207706_10071864 3300025933 Bacteria 3044
274 Ga0207706_10461052 3300025933 Bacteria 1099
275 Ga0207709_10007101 3300025935 Bacteria 6256
276 Ga0207669_10005721 3300025937 Bacteria 5608
277 Ga0207669_10075925 3300025937 Bacteria 2131
278 Ga0207711_10000190 3300025941 Bacteria 65723
279 Ga0207711_10000413 3300025941 Bacteria 45274
280 Ga0207711_10001099 3300025941 Bacteria 25801
281 Ga0207711_10025123 3300025941 Unclassified 4998
282 Ga0207711_10031119 3300025941 Bacteria 4503
283 Ga0207711_10054017 3300025941 Bacteria 3446
284 Ga0207661_10225817 3300025944 Bacteria 1656
285 Ga0207679_10000114 3300025945 Bacteria 64628
286 Ga0207679_10022016 3300025945 Unclassified 4333
287 Ga0207679_10039075 3300025945 Bacteria 3386
288 Ga0207679_10097455 3300025945 Bacteria 2291
289 Ga0207679_10177256 3300025945 Bacteria 1760
290 Ga0207679_10289856 3300025945 Unclassified 1407
291 Ga0207679_10467519 3300025945 Bacteria 1121
292 Ga0207667_10014335 3300025949 Bacteria 9041
293 Ga0207667_10042792 3300025949 Bacteria 4812
294 Ga0207667_10073646 3300025949 Unclassified 3548
295 Ga0207651_10024664 3300025960 Bacteria 3725
296 Ga0207651_10081330 3300025960 Unclassified 2335
297 Ga0207651_10081994 3300025960 Bacteria 2327
298 Ga0207651_10273798 3300025960 Bacteria 1392
299 Ga0207668_10000086 3300025972 Bacteria 69871
300 Ga0207668_10032150 3300025972 Bacteria 3464
301 Ga0207640_10004054 3300025981 Bacteria 7914
302 Ga0207640_10008352 3300025981 Bacteria 5752
303 Ga0207640_10331806 3300025981 Bacteria 1215
304 Ga0207658_10005858 3300025986 Bacteria 8405
305 Ga0207658_10006732 3300025986 Bacteria 7821
306 Ga0207658_10012825 3300025986 Bacteria 5723
307 Ga0207658_10020555 3300025986 Bacteria 4571
308 Ga0207658_10048727 3300025986 Unclassified 3108
309 Ga0207677_10002223 3300026023 Bacteria 10195
310 Ga0207703_10000461 3300026035 Bacteria 42797
311 Ga0207703_10044430 3300026035 Bacteria 3570
312 Ga0207703_10173526 3300026035 Unclassified 1898
313 Ga0207639_10000139 3300026041 Bacteria 54240
314 Ga0207639_10039738 3300026041 Bacteria 3507
315 Ga0207639_10072062 3300026041 Bacteria 2704
316 Ga0207639_10417510 3300026041 Unclassified 1212
317 Ga0207678_10008649 3300026067 Bacteria 8972
318 Ga0207678_10025133 3300026067 Bacteria 5200
319 Ga0207702_10001266 3300026078 Bacteria 25382
320 Ga0207702_10005925 3300026078 Bacteria 10618
321 Ga0207702_10007538 3300026078 Bacteria 9279
322 Ga0207702_10247457 3300026078 Bacteria 1673
323 Ga0207641_10139892 3300026088 Bacteria 2183
324 Ga0207648_10003003 3300026089 Bacteria 17824
325 Ga0207648_10004996 3300026089 Bacteria 13475
326 Ga0207648_10067277 3300026089 Bacteria 3124
327 Ga0207676_10067846 3300026095 Unclassified 2850
328 Ga0207674_10010728 3300026116 Bacteria 10342
329 Ga0207674_10013085 3300026116 Bacteria 9236
330 Ga0207674_10027107 3300026116 Bacteria 6069
331 Ga0207674_10053689 3300026116 Bacteria 4106
332 Ga0207675_100011776 3300026118 Bacteria 8175
333 Ga0207683_10176036 3300026121 Bacteria 1939
334 Ga0207698_10000598 3300026142 Bacteria 21116
335 Ga0207698_10038653 3300026142 Plasmid 3528
336 Ga0207698_10049514 3300026142 Bacteria 3199
337 Ga0207698_10051720 3300026142 Bacteria 3142
338 Ga0207698_10053593 3300026142 Bacteria 3097
339 Ga0207698_10105455 3300026142 Bacteria 2349
340 Ga0207698_10305156 3300026142 Bacteria 1484
341 Ga0209974_10008635 3300027876 Bacteria 3474
342 Ga0268266_10014776 3300028379 Bacteria 6706
343 Ga0268266_10024438 3300028379 Bacteria 5139
344 Ga0268266_10198223 3300028379 Bacteria 1836
345 Ga0268265_10016499 3300028380 Bacteria 5075
346 Ga0268264_10051419 3300028381 Bacteria 3433
347 Ga0268264_10076116 3300028381 Bacteria 2855
348 Ga0268264_10241452 3300028381 Bacteria 1673
349 Ga0268264_10287991 3300028381 Bacteria 1541
350 Ga0307513_10171944 3300031456 Bacteria 2043
351 Ga0307408_100019659 3300031548 Unclassified 4549
352 Ga0307408_100120253 3300031548 Bacteria 2033
353 Ga0307405_10190904 3300031731 Unclassified 1479
354 Ga0307405_10237767 3300031731 Unclassified 1347
355 Ga0307413_10089579 3300031824 Bacteria 1999
356 Ga0307413_10459694 3300031824 Unclassified 1012
357 Ga0307410_10001800 3300031852 Bacteria 9936
358 Ga0307410_10051161 3300031852 Unclassified 2782
359 Ga0307406_10083565 3300031901 Unclassified 2129
360 Ga0307406_10190897 3300031901 Bacteria 1499
361 Ga0307406_10263421 3300031901 Bacteria 1305
362 Ga0307406_10304579 3300031901 Bacteria 1226
363 Ga0307406_10395747 3300031901 Bacteria 1093
364 Ga0307407_10024094 3300031903 Unclassified 3185
365 Ga0307407_10301344 3300031903 Bacteria 1117
366 Ga0307412_10020482 3300031911 Bacteria 4026
367 Ga0307412_10023518 3300031911 Unclassified 3792
368 Ga0307412_10082398 3300031911 Bacteria 2227
369 Ga0307409_100017614 3300031995 Bacteria 4769
370 Ga0307409_100118445 3300031995 Unclassified 2236
371 Ga0307409_100262608 3300031995 Bacteria 1585
372 Ga0307409_100320452 3300031995 Unclassified 1450
373 Ga0307409_100633356 3300031995 Unclassified 1061
374 Ga0307409_100686674 3300031995 Bacteria 1022
375 Ga0307416_100047348 3300032002 Unclassified 3402
376 Ga0307416_100150823 3300032002 Bacteria 2131
377 Ga0307416_100222232 3300032002 Bacteria 1812
378 Ga0307416_100732479 3300032002 Bacteria 1080
379 Ga0307414_10108459 3300032004 Unclassified 2106
380 Ga0307414_10188473 3300032004 Bacteria 1666
381 Ga0307414_10577834 3300032004 Bacteria 1005
382 Ga0307414_10602155 3300032004 Unclassified 985
383 Ga0307411_10001772 3300032005 Bacteria 9116
384 Ga0307411_10080449 3300032005 Bacteria 2240
385 Ga0307411_10145328 3300032005 Unclassified 1754
386 Ga0307411_10168953 3300032005 Bacteria 1647
387 Ga0307411_10427026 3300032005 Unclassified 1102
388 Ga0307411_10456368 3300032005 Bacteria 1070
389 Ga0307415_100072381 3300032126 Unclassified 2427
390 Ga0307415_100101538 3300032126 Bacteria 2111
391 Ga0307415_100514348 3300032126 Bacteria 1049
392 Ga0373943_0003958 3300035170 Bacteria 6742
393 Ga0373931_0130656 3300035691 Unclassified 1445
394 Ga0373927_0055278 3300035695 Bacteria 2567
395 Ga0373925_0010278 3300037068 Bacteria 6789
396 Ga0395899_0024479 3300037312 Bacteria 4564
397 Ga0395899_0033596 3300037312 Bacteria 3851
398 Ga0395899_0040138 3300037312 Bacteria 3500
399 Ga0395899_0121720 3300037312 Bacteria 1868
400 Ga0395899_0238813 3300037312 Bacteria 1251
401 Ga0395900_0048144 3300037418 Bacteria 4391
402 Ga0395900_0053442 3300037418 Bacteria 4157
403 Ga0395900_0058032 3300037418 Bacteria 3984
404 Ga0395900_0160705 3300037418 Bacteria 2291
405 Ga0395900_0169068 3300037418 Bacteria 2226
406 Ga0395900_0329373 3300037418 Bacteria 1505
407 Ga0395898_0052517 3300037466 Bacteria 3982
408 Ga0395898_0110274 3300037466 Bacteria 2638
409 Ga0395905_0032859 3300037471 Bacteria 4878
410 Ga0395905_0045910 3300037471 Bacteria 4097
411 Ga0395905_0067564 3300037471 Bacteria 3348
412 Ga0395905_0068529 3300037471 Bacteria 3323
413 Ga0395905_0087639 3300037471 Bacteria 2918
414 Ga0395905_0184324 3300037471 Bacteria 1959
415 Ga0395905_0202334 3300037471 Bacteria 1861
416 Ga0395905_0203437 3300037471 Bacteria 1856
417 Ga0395905_0229038 3300037471 Bacteria 1738
418 Ga0395905_0684149 3300037471 Bacteria 928
419 Ga0436364_0186105 3300037853 Bacteria 15140
420 Ga0395901_0044251 3300038443 Bacteria 4617
421 Ga0395901_0077619 3300038443 Bacteria 3466
422 Ga0395901_0101093 3300038443 Bacteria 3025
423 Ga0395901_0137721 3300038443 Bacteria 2565
424 Ga0395901_0170256 3300038443 Bacteria 2285
425 Ga0395901_0255495 3300038443 Bacteria 1825
426 Ga0436365_0976737 3300039437 Bacteria 1340
427 Ga0439449_0045755 3300042007 Bacteria 1622
428 Ga0439462_0075641 3300042015 Unclassified 917
429 Ga0450898_006110 3300042134 Bacteria 1842
430 Ga0466966_0009614 3300044684 Bacteria 6399
431 Ga0466966_0012270 3300044684 Bacteria 5677
432 Ga0466963_0129164 3300044694 Bacteria 1744
433 Ga0466963_0224778 3300044694 Bacteria 1315
434 Ga0466971_0075967 3300044719 Bacteria 1528
435 Ga0466957_0012087 3300044842 Bacteria 4992
436 Ga0466957_0072353 3300044842 Bacteria 2134
437 Ga0466957_0113635 3300044842 Bacteria 1720
438 Ga0466957_0132941 3300044842 Bacteria 1596
439 Ga0466957_0216259 3300044842 Bacteria 1264
440 Ga0466959_0085646 3300045049 Bacteria 2267
441 Ga0466958_0008055 3300045836 Bacteria 5828
442 Ga0466967_0010950 3300045976 Bacteria 6836
443 Ga0466967_0013019 3300045976 Bacteria 6401
444 Ga0466967_0047100 3300045976 Bacteria 3757
445 Ga0495583_0105179 3300046506 Bacteria 1201
446 Ga0495620_0040588 3300046515 Bacteria 2047
447 Ga0495665_0167650 3300046531 Bacteria 1144
448 Ga0495598_0000424 3300046537 Bacteria 7631
449 Ga0495621_0000027 3300046539 Bacteria 28040
450 Ga0495633_0082532 3300046558 Bacteria 1496
451 Ga0495669_0002250 3300046684 Bacteria 7915
452 Ga0495669_0007144 3300046684 Bacteria 4678
453 Ga0495669_0042561 3300046684 Bacteria 2019
454 Ga0495669_0054870 3300046684 Unclassified 1794
455 Ga0495670_0000843 3300046691 Bacteria 14816
456 Ga0496100_0124007 3300048903 Bacteria 1811
457 Ga0496102_0044397 3300048905 Unclassified 4033
458 Ga0496104_0098386 3300048907 Unclassified 2800
459 Ga0496106_0358351 3300048909 Unclassified 1172
460 Ga0496107_0045471 3300048910 Bacteria 3158
461 Ga0496107_0101060 3300048910 Bacteria 2114
462 Ga0496107_0117478 3300048910 Bacteria 1958
463 Ga0496108_0023342 3300048911 Bacteria 5088
464 Ga0496109_0034230 3300048912 Unclassified 4573
465 Ga0496110_0035521 3300048913 Bacteria 4324
466 Ga0496111_0010163 3300048914 Bacteria 6302
467 Ga0496111_0129799 3300048914 Unclassified 1864
468 Ga0496111_0322581 3300048914 Bacteria 1144
469 Ga0496112_0007902 3300048915 Bacteria 9476
470 Ga0496112_0008333 3300048915 Bacteria 9279
471 Ga0496112_0017585 3300048915 Bacteria 6721
472 Ga0496112_0113281 3300048915 Bacteria 2683
473 Ga0496113_0005401 3300048916 Bacteria 7964
474 Ga0496113_0034889 3300048916 Bacteria 3674
475 Ga0496114_0083863 3300048917 Bacteria 2697
476 Ga0496115_0004461 3300048918 Bacteria 10144
477 Ga0501068_0076413 3300049584 Bacteria 2050
478 Ga0501069_0196809 3300049585 Bacteria 1167
479 Ga0501201_001970 3300049651 Bacteria 1894
480 Ga0501224_010682 3300049664 Bacteria 1346
481 Ga0501227_005579 3300049665 Bacteria 2694
482 Ga0501235_025292 3300049669 Bacteria 1328
483 Ga0501247_000439 3300049677 Unclassified 3255
484 Ga0501273_021067 3300049770 Bacteria 883
485 nmdc:mga03683_34140_c1 3300050489 Bacteria 2057
486 nmdc:mga00v17_62608_c1 3300050491 Bacteria 2289
487 Ga0500658_0000032 3300053134 Bacteria 90863
488 Ga0466962_0041553 3300061719 Bacteria 2200
489 Ga0466962_0131460 3300061719 Bacteria 1210
490 Ga0157373_10192285
491 JGI24741J21665_1000945
492 JGI24740J21852_10002505
493 JGI24739J22299_10005843
494 JGI24737J22298_10001044
495 JGI24737J22298_10001902
496 JGI24743J22301_10012411
497 JGI24735J21928_10001547
498 JGI24735J21928_10013203
499 JGI24738J21930_10001538
500 JGI24738J21930_10016354
501 rootH1_10181345
502 Ga0070658_10000177
503 Ga0070658_10006077
504 Ga0070658_10029744
505 Ga0070658_10044566
506 Ga0070658_10072461
507 Ga0070658_10106502
508 Ga0070658_10385840
509 Ga0070676_10016570
510 Ga0070676_10059625
511 Ga0070676_10179052
512 Ga0070683_100009270
513 Ga0070683_100025253
514 Ga0070683_100223635
515 Ga0070683_100776264
516 Ga0070690_100003082
517 Ga0070690_100344128
518 Ga0070670_100019970
519 Ga0070670_100021121
520 Ga0070670_100227779
521 Ga0070670_100399185
522 Ga0070677_10056286
523 Ga0068869_100032086
524 Ga0070666_10002966
525 Ga0070666_10009029
526 Ga0070682_100004323
527 Ga0070682_100030038
528 Ga0068868_100002927
529 Ga0068868_100134180
530 Ga0068868_100632782
531 Ga0070660_100000065
532 Ga0070660_100008636
533 Ga0070660_100020612
534 Ga0070660_100097168
535 Ga0070660_100153519
536 Ga0070660_100192842
537 Ga0070660_100212882
538 Ga0070660_100355952
539 Ga0070660_100470338
540 Ga0070687_100047630
541 Ga0070661_100000084
542 Ga0070661_100015350
543 Ga0070661_100020585
544 Ga0070661_100047940
545 Ga0070661_100125144
546 Ga0070661_100224026
547 Ga0070692_10002153
548 Ga0070668_100009829
549 Ga0070668_100028392
550 Ga0070669_100222914
551 Ga0070671_100002759
552 Ga0070671_100012827
553 Ga0070671_100014142
554 Ga0070671_100024948
555 Ga0070671_100029282
556 Ga0070674_100005949
557 Ga0070674_100019790
558 Ga0070673_100081978
559 Ga0070673_100114157
560 Ga0070673_100220743
561 Ga0070673_100462199
562 Ga0070659_100000067
563 Ga0070659_100014420
564 Ga0070659_100020005
565 Ga0070659_100036707
566 Ga0070659_100037802
567 Ga0070659_100041060
568 Ga0070667_100001373
569 Ga0070667_100003485
570 Ga0070667_100009685
571 Ga0070667_100020730
572 Ga0070667_100032533
573 Ga0070667_100082068
574 Ga0070663_100014600
575 Ga0070663_100075508
576 Ga0070663_100103566
577 Ga0070663_100405480
578 Ga0070678_100028211
579 Ga0070678_100199043
580 Ga0070662_100000017
581 Ga0070662_100020255
582 Ga0070662_100027186
583 Ga0070662_100087097
584 Ga0070662_100330034
585 Ga0070681_10045851
586 Ga0070681_10253897
587 Ga0068867_100002594
588 Ga0068867_100021831
589 Ga0068867_100391248
590 Ga0070679_100205251
591 Ga0070684_100031467
592 Ga0070684_100052695
593 Ga0068853_100000784
594 Ga0068853_100324830
595 Ga0068853_100414175
596 Ga0070672_100097389
597 Ga0070672_100245737
598 Ga0070693_100003637
599 Ga0070693_100005538
600 Ga0070693_100010535
601 Ga0070665_100009769
602 Ga0070665_100052139
603 Ga0070665_100662707
604 Ga0070665_100735067
605 Ga0068855_100000194
606 Ga0068855_100021299
607 Ga0068855_100032275
608 Ga0068855_100147826
609 Ga0070664_100000098
610 Ga0070664_100026020
611 Ga0070664_100028290
612 Ga0070664_100039683
613 Ga0070664_100151387
614 Ga0068857_100005314
615 Ga0068857_100013488
616 Ga0068857_100063448
617 Ga0068857_100105855
618 Ga0068857_100106082
619 Ga0068854_100005842
620 Ga0068854_100017701
621 Ga0068854_100111319
622 Ga0068856_100000098
623 Ga0068856_100006038
624 Ga0068856_100044407
625 Ga0068856_100174396
626 Ga0068852_100000440
627 Ga0068852_100015063
628 Ga0068852_100040536
629 Ga0068852_100043567
630 Ga0068852_100105944
631 Ga0068852_100132466
632 Ga0068852_100167747
633 Ga0068852_100269287
634 Ga0068859_100014688
635 Ga0068859_100231626
636 Ga0068864_100007289
637 Ga0068864_100039601
638 Ga0068861_100003591
639 Ga0068851_10005321
640 Ga0068851_10007903
641 Ga0068851_10009250
642 Ga0068851_10013018
643 Ga0068863_100028209
644 Ga0068863_100028966
645 Ga0068863_100126892
646 Ga0068858_100002697
647 Ga0068858_100061526
648 Ga0068858_100080233
649 Ga0068858_100264931
650 Ga0068860_100033259
651 Ga0068860_100045866
652 Ga0068860_100168378
653 Ga0068860_100320739
654 Ga0068862_100005832
655 Ga0068862_100106891
656 Ga0068862_100239606
657 Ga0097620_100014689
658 Ga0097620_100231633
659 Ga0105250_10048451
660 Ga0105243_10010329
661 Ga0105243_10077822
662 Ga0105241_10086449
663 Ga0105241_10367918
664 Ga0105248_10000390
665 Ga0105248_10000444
666 Ga0105248_10065574
667 Ga0105248_10075590
668 Ga0105248_10105096
669 Ga0105248_10108678
670 Ga0105248_10138328
671 Ga0105238_10091387
672 Ga0105249_10357220
673 Ga0105249_10398710
674 Ga0157373_10007422
675 Ga0157373_10008483
676 Ga0157373_10010065
677 Ga0157373_10015842
678 Ga0157373_10023873
679 Ga0157373_10029599
680 Ga0157373_10097829
681 Ga0157373_10181548
682 Ga0157371_10007622
683 Ga0157371_10008828
684 Ga0157371_10012219
685 Ga0157371_10285441
686 Ga0157370_10250386
687 Ga0157369_10087737
688 Ga0157369_10125921
689 Ga0157378_10007549
690 Ga0163162_10017775
691 Ga0157372_10008404
692 Ga0157372_11017847
693 Ga0157375_10049675
694 Ga0157375_10833246
695 Ga0163163_10000169
696 Ga0157380_10104835
697 Ga0182008_10010000
698 Ga0157379_10002940
699 Ga0157379_10364202
700 Ga0213875_10012836
701 Ga0207697_10119428
702 Ga0207688_10017162
703 Ga0207688_10041065
704 Ga0207680_10000773
705 Ga0207680_10004846
706 Ga0207647_10002702
707 Ga0207647_10003119
708 Ga0207647_10039243
709 Ga0207645_10033399
710 Ga0207645_10055672
711 Ga0207645_10074852
712 Ga0207705_10000137
713 Ga0207705_10002175
714 Ga0207705_10002960
715 Ga0207705_10007990
716 Ga0207705_10062200
717 Ga0207705_10075559
718 Ga0207705_10084069
719 Ga0207705_10194700
720 Ga0207705_10197923
721 Ga0207705_10473474
722 Ga0207654_10162115
723 Ga0207707_10002628
724 Ga0207707_10131997
725 Ga0207660_10021258
726 Ga0207662_10047425
727 Ga0207657_10000508
728 Ga0207657_10010583
729 Ga0207657_10016406
730 Ga0207657_10024685
731 Ga0207657_10028662
732 Ga0207657_10028863
733 Ga0207657_10075745
734 Ga0207657_10094004
735 Ga0207657_10287964
736 Ga0207649_10000965
737 Ga0207649_10007538
738 Ga0207649_10012667
739 Ga0207649_10022690
740 Ga0207649_10026364
741 Ga0207652_10014489
742 Ga0207681_10029579
743 Ga0207681_10080833
744 Ga0207650_10023741
745 Ga0207659_10181635
746 Ga0207664_10209949
747 Ga0207644_10006575
748 Ga0207644_10011981
749 Ga0207644_10014817
750 Ga0207644_10022281
751 Ga0207690_10000108
752 Ga0207690_10001369
753 Ga0207690_10002887
754 Ga0207690_10027648
755 Ga0207690_10038137
756 Ga0207690_10230480
757 Ga0207706_10000514
758 Ga0207706_10007849
759 Ga0207706_10021750
760 Ga0207706_10025281
761 Ga0207706_10034311
762 Ga0207706_10071864
763 Ga0207706_10461052
764 Ga0207709_10007101
765 Ga0207669_10005721
766 Ga0207669_10075925
767 Ga0207711_10000190
768 Ga0207711_10000413
769 Ga0207711_10001099
770 Ga0207711_10025123
771 Ga0207711_10031119
772 Ga0207711_10054017
773 Ga0207661_10225817
774 Ga0207679_10000114
775 Ga0207679_10022016
776 Ga0207679_10039075
777 Ga0207679_10097455
778 Ga0207679_10177256
779 Ga0207679_10289856
780 Ga0207679_10467519
781 Ga0207667_10014335
782 Ga0207667_10042792
783 Ga0207667_10073646
784 Ga0207651_10024664
785 Ga0207651_10081330
786 Ga0207651_10081994
787 Ga0207651_10273798
788 Ga0207668_10000086
789 Ga0207668_10032150
790 Ga0207640_10004054
791 Ga0207640_10008352
792 Ga0207640_10331806
793 Ga0207658_10005858
794 Ga0207658_10006732
795 Ga0207658_10012825
796 Ga0207658_10020555
797 Ga0207658_10048727
798 Ga0207677_10002223
799 Ga0207703_10000461
800 Ga0207703_10044430
801 Ga0207703_10173526
802 Ga0207639_10000139
803 Ga0207639_10039738
804 Ga0207639_10072062
805 Ga0207639_10417510
806 Ga0207678_10008649
807 Ga0207678_10025133
808 Ga0207702_10001266
809 Ga0207702_10005925
810 Ga0207702_10007538
811 Ga0207702_10247457
812 Ga0207641_10139892
813 Ga0207648_10003003
814 Ga0207648_10004996
815 Ga0207648_10067277
816 Ga0207676_10067846
817 Ga0207674_10010728
818 Ga0207674_10013085
819 Ga0207674_10027107
820 Ga0207674_10053689
821 Ga0207675_100011776
822 Ga0207683_10176036
823 Ga0207698_10000598
824 Ga0207698_10038653
825 Ga0207698_10049514
826 Ga0207698_10051720
827 Ga0207698_10053593
828 Ga0207698_10105455
829 Ga0207698_10305156
830 Ga0209974_10008635
831 Ga0268266_10014776
832 Ga0268266_10024438
833 Ga0268266_10198223
834 Ga0268265_10016499
835 Ga0268264_10051419
836 Ga0268264_10076116
837 Ga0268264_10241452
838 Ga0268264_10287991
839 Ga0307513_10171944
840 Ga0307408_100019659
841 Ga0307408_100120253
842 Ga0307405_10190904
843 Ga0307405_10237767
844 Ga0307413_10089579
845 Ga0307413_10459694
846 Ga0307410_10001800
847 Ga0307410_10051161
848 Ga0307406_10083565
849 Ga0307406_10190897
850 Ga0307406_10263421
851 Ga0307406_10304579
852 Ga0307406_10395747
853 Ga0307407_10024094
854 Ga0307407_10301344
855 Ga0307412_10020482
856 Ga0307412_10023518
857 Ga0307412_10082398
858 Ga0307409_100017614
859 Ga0307409_100118445
860 Ga0307409_100262608
861 Ga0307409_100320452
862 Ga0307409_100633356
863 Ga0307409_100686674
864 Ga0307416_100047348
865 Ga0307416_100150823
866 Ga0307416_100222232
867 Ga0307416_100732479
868 Ga0307414_10108459
869 Ga0307414_10188473
870 Ga0307414_10577834
871 Ga0307414_10602155
872 Ga0307411_10001772
873 Ga0307411_10080449
874 Ga0307411_10145328
875 Ga0307411_10168953
876 Ga0307411_10427026
877 Ga0307411_10456368
878 Ga0307415_100072381
879 Ga0307415_100101538
880 Ga0307415_100514348
881 Ga0373943_0003958
882 Ga0373931_0130656
883 Ga0373927_0055278
884 Ga0373925_0010278
885 Ga0395899_0024479
886 Ga0395899_0033596
887 Ga0395899_0040138
888 Ga0395899_0121720
889 Ga0395899_0238813
890 Ga0395900_0048144
891 Ga0395900_0053442
892 Ga0395900_0058032
893 Ga0395900_0160705
894 Ga0395900_0169068
895 Ga0395900_0329373
896 Ga0395898_0052517
897 Ga0395898_0110274
898 Ga0395905_0032859
899 Ga0395905_0045910
900 Ga0395905_0067564
901 Ga0395905_0068529
902 Ga0395905_0087639
903 Ga0395905_0184324
904 Ga0395905_0202334
905 Ga0395905_0203437
906 Ga0395905_0229038
907 Ga0395905_0684149
908 Ga0436364_0186105
909 Ga0395901_0044251
910 Ga0395901_0077619
911 Ga0395901_0101093
912 Ga0395901_0137721
913 Ga0395901_0170256
914 Ga0395901_0255495
915 Ga0436365_0976737
916 Ga0439449_0045755
917 Ga0439462_0075641
918 Ga0450898_006110
919 Ga0466966_0009614
920 Ga0466966_0012270
921 Ga0466963_0129164
922 Ga0466963_0224778
923 Ga0466971_0075967
924 Ga0466957_0012087
925 Ga0466957_0072353
926 Ga0466957_0113635
927 Ga0466957_0132941
928 Ga0466957_0216259
929 Ga0466959_0085646
930 Ga0466958_0008055
931 Ga0466967_0010950
932 Ga0466967_0013019
933 Ga0466967_0047100
934 Ga0495583_0105179
935 Ga0495620_0040588
936 Ga0495665_0167650
937 Ga0495598_0000424
938 Ga0495621_0000027
939 Ga0495633_0082532
940 Ga0495669_0002250
941 Ga0495669_0007144
942 Ga0495669_0042561
943 Ga0495669_0054870
944 Ga0495670_0000843
945 Ga0496100_0124007
946 Ga0496102_0044397
947 Ga0496104_0098386
948 Ga0496106_0358351
949 Ga0496107_0045471
950 Ga0496107_0101060
951 Ga0496107_0117478
952 Ga0496108_0023342
953 Ga0496109_0034230
954 Ga0496110_0035521
955 Ga0496111_0010163
956 Ga0496111_0129799
957 Ga0496111_0322581
958 Ga0496112_0007902
959 Ga0496112_0008333
960 Ga0496112_0017585
961 Ga0496112_0113281
962 Ga0496113_0005401
963 Ga0496113_0034889
964 Ga0496114_0083863
965 Ga0496115_0004461
966 Ga0501068_0076413
967 Ga0501069_0196809
968 Ga0501201_001970
969 Ga0501224_010682
970 Ga0501227_005579
971 Ga0501235_025292
972 Ga0501247_000439
973 Ga0501273_021067
974 nmdc:mga03683_34140_c1
975 nmdc:mga00v17_62608_c1
976 Ga0500658_0000032
977 Ga0466962_0041553
978 Ga0466962_0131460

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
3fjy-assembly1.cif.gz_A crystal structure of a probable mutt1 protein from bifidobacterium adolescentis 0.753 244 266
7v08-assembly1.cif.gz_D nucleoplasmic pre-60s intermediate of the nog2 containing pre-rotation state from a spb1 d52a suppressor 3 strain 0.6649 239 264
8fk7-assembly1.cif.gz_A structure of the pyrobaculum calidifontis flagellar-like archaeal type iv pilus 0.6537 166 266
7qqb-assembly1.cif.gz_B crystal structure of the envelope glycoprotein complex of puumala virus in complex with the scfv fragment of the broadly neutralizing human antibody adi-42898 0.6325 165 249
6xu6-assembly1.cif.gz_CD drosophila melanogaster testis 80s ribosome 0.6087 243 264
ID Description Score Start End Superfamily
af_P11465_244_325_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.6917 39 164 2.60.40.10
2erjF01 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.6747 172 265 2.60.40.10
af_A8MVW5_252_335_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.66 38 160 2.60.40.10
af_P11465_244_325_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.6424 39 164 2.60.40.10
af_Q559R5_221_326_2.60.40.1230 Mainly Beta;Sandwich;Immunoglobulin-like;Gamma-adaptin ear (GAE) domain 0.6423 162 265 2.60.40.1230
ID Description Score Start End GO Terms
AF-A0A7H0GB39-F1-model_v4 deleted 0.8625 154 268
AF-A0A7H0GB39-F1-model_v4 deleted 0.8552 154 268
AF-A0A848SHF1-F1-model_v4 Molecular chaperone 0.8174 35 268
AF-A0A844YHP6-F1-model_v4 Molecular chaperone 0.8146 35 268
AF-A0A2Z6UDQ2-F1-model_v4 Pili assembly chaperone N-terminal domain-containing protein 0.8088 38 267

Map