F453790
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 489 | 239 | 489 | 122 |
Family's Representative Sequence
| Representative Sequence | 3300025945|Ga0207679_11995811|Ga0207679_119958111 |
| Length | 143 |
| Sequence | MKTLTKAEEQVMQVIWKLKEGFIRDIMEATPLPKPHQNTVATILKILVEKEFVGVRVYGRQHQYYPLMSKDAYSKASMKSLVKSYFGGSFSDAVSFMVKENNISLEGGGVFSNREHSIAHFLIKEAEEAKAKLEEVGASVEVK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 2 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 3 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 6 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 12 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 16 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 36 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 41 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 46 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 48 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 49 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 50 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 51 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 52 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 53 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 54 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 55 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 56 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 57 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 58 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 59 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 60 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 61 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 63 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 64 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 65 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 66 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 67 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 147 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 148 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 149 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 150 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 151 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 152 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 153 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 154 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 155 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 156 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 157 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 158 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 159 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 160 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 161 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 162 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 163 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 164 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 165 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 166 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 167 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 168 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 169 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 170 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 176 | 3300049517 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control | Metagenome | Rhizosphere |
| 177 | 3300049520 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought | Metagenome | Rhizosphere |
| 178 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 179 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 180 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 181 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 182 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 183 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 184 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 185 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 186 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 187 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 188 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 189 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 190 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 191 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 192 | 3300049651 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought | Metagenome | Rhizosphere |
| 193 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 194 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 195 | 3300049657 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought | Metagenome | Rhizosphere |
| 196 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 197 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 198 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 199 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 200 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 201 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 202 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 203 | 3300049670 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought | Metagenome | Rhizosphere |
| 204 | 3300049672 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought | Metagenome | Rhizosphere |
| 205 | 3300049673 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought | Metagenome | Rhizosphere |
| 206 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 207 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 208 | 3300049676 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control | Metagenome | Rhizosphere |
| 209 | 3300049680 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought | Metagenome | Rhizosphere |
| 210 | 3300049681 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought | Metagenome | Rhizosphere |
| 211 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 212 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 213 | 3300049685 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control | Metagenome | Rhizosphere |
| 214 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 215 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 216 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 217 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 218 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 219 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 220 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 221 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 222 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 223 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 224 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 225 | 3300049757 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control | Metagenome | Rhizosphere |
| 226 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 227 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 228 | 3300049768 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought | Metagenome | Rhizosphere |
| 229 | 3300049772 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control | Metagenome | Rhizosphere |
| 230 | 3300049778 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control | Metagenome | Rhizosphere |
| 231 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 232 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 233 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 234 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 235 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 236 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 237 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 238 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 239 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.43 |
| Nodule | 0 |
| Rhizoplane | 0 |
| Rhizosphere | 97.96 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.61 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24751J29686_10001619 | 3300002459 | Unclassified | 4649 |
| 2 | rootH1_10322875 | 3300003323 | Bacteria | 1501 |
| 3 | Ga0065714_10083424 | 3300005288 | Bacteria | 2250 |
| 4 | Ga0065704_10849339 | 3300005289 | Bacteria | 509 |
| 5 | Ga0065712_10002727 | 3300005290 | Bacteria | 5996 |
| 6 | Ga0065712_10016709 | 3300005290 | Bacteria | 2290 |
| 7 | Ga0065712_10073585 | 3300005290 | Bacteria | 4332 |
| 8 | Ga0065715_10226491 | 3300005293 | Bacteria | 1250 |
| 9 | Ga0070658_11100291 | 3300005327 | Bacteria | 691 |
| 10 | Ga0070683_100036619 | 3300005329 | Bacteria | 4490 |
| 11 | Ga0070683_101065820 | 3300005329 | Bacteria | 776 |
| 12 | Ga0070690_100678802 | 3300005330 | Bacteria | 789 |
| 13 | Ga0070670_100038368 | 3300005331 | Bacteria | 4119 |
| 14 | Ga0070670_100100598 | 3300005331 | Bacteria | 2489 |
| 15 | Ga0070670_100228187 | 3300005331 | Bacteria | 1620 |
| 16 | Ga0070670_100556429 | 3300005331 | Unclassified | 1024 |
| 17 | Ga0070670_100588249 | 3300005331 | Unclassified | 995 |
| 18 | Ga0070670_100811831 | 3300005331 | Unclassified | 845 |
| 19 | Ga0068869_100050190 | 3300005334 | Bacteria | 3023 |
| 20 | Ga0068869_100365803 | 3300005334 | Bacteria | 1179 |
| 21 | Ga0068869_101680686 | 3300005334 | Bacteria | 566 |
| 22 | Ga0070666_10909623 | 3300005335 | Bacteria | 651 |
| 23 | Ga0070680_100036976 | 3300005336 | Bacteria | 3945 |
| 24 | Ga0070680_101055103 | 3300005336 | Bacteria | 702 |
| 25 | Ga0070682_100782073 | 3300005337 | Bacteria | 774 |
| 26 | Ga0068868_100671168 | 3300005338 | Bacteria | 925 |
| 27 | Ga0070660_100160370 | 3300005339 | Unclassified | 1812 |
| 28 | Ga0070660_100258811 | 3300005339 | Bacteria | 1421 |
| 29 | Ga0070660_100518906 | 3300005339 | Bacteria | 992 |
| 30 | Ga0070660_101863568 | 3300005339 | Bacteria | 512 |
| 31 | Ga0070689_100250090 | 3300005340 | Bacteria | 1462 |
| 32 | Ga0070689_100362806 | 3300005340 | Bacteria | 1217 |
| 33 | Ga0070687_100523505 | 3300005343 | Bacteria | 802 |
| 34 | Ga0070687_100534318 | 3300005343 | Bacteria | 795 |
| 35 | Ga0070661_100041139 | 3300005344 | Unclassified | 3372 |
| 36 | Ga0070661_100045609 | 3300005344 | Bacteria | 3205 |
| 37 | Ga0070661_100578076 | 3300005344 | Unclassified | 906 |
| 38 | Ga0070669_100290039 | 3300005353 | Bacteria | 1313 |
| 39 | Ga0070669_100431731 | 3300005353 | Bacteria | 1083 |
| 40 | Ga0070669_100467032 | 3300005353 | Bacteria | 1042 |
| 41 | Ga0070669_101883556 | 3300005353 | Unclassified | 522 |
| 42 | Ga0070669_101960788 | 3300005353 | Bacteria | 512 |
| 43 | Ga0070675_100058212 | 3300005354 | Bacteria | 3187 |
| 44 | Ga0070675_100626228 | 3300005354 | Bacteria | 977 |
| 45 | Ga0070671_100342650 | 3300005355 | Unclassified | 1275 |
| 46 | Ga0070674_100137704 | 3300005356 | Bacteria | 1828 |
| 47 | Ga0070673_100056657 | 3300005364 | Bacteria | 3093 |
| 48 | Ga0070688_100020367 | 3300005365 | Bacteria | 3856 |
| 49 | Ga0070688_100188729 | 3300005365 | Bacteria | 1434 |
| 50 | Ga0070688_101623808 | 3300005365 | Bacteria | 528 |
| 51 | Ga0070659_100014169 | 3300005366 | Bacteria | 5952 |
| 52 | Ga0070659_100016720 | 3300005366 | Bacteria | 5511 |
| 53 | Ga0070667_100035440 | 3300005367 | Bacteria | 4180 |
| 54 | Ga0070667_100329239 | 3300005367 | Bacteria | 1380 |
| 55 | Ga0070714_101962302 | 3300005435 | Bacteria | 571 |
| 56 | Ga0070701_10022901 | 3300005438 | Bacteria | 3001 |
| 57 | Ga0070705_101698994 | 3300005440 | Bacteria | 533 |
| 58 | Ga0070700_100103034 | 3300005441 | Bacteria | 1884 |
| 59 | Ga0070700_100497553 | 3300005441 | Bacteria | 937 |
| 60 | Ga0070694_101012650 | 3300005444 | Bacteria | 690 |
| 61 | Ga0070678_101763674 | 3300005456 | Unclassified | 583 |
| 62 | Ga0070681_10082740 | 3300005458 | Bacteria | 3164 |
| 63 | Ga0070681_10238608 | 3300005458 | Bacteria | 1732 |
| 64 | Ga0070681_10553907 | 3300005458 | Bacteria | 1064 |
| 65 | Ga0068867_100021335 | 3300005459 | Bacteria | 4621 |
| 66 | Ga0068867_100219973 | 3300005459 | Bacteria | 1530 |
| 67 | Ga0068867_100681548 | 3300005459 | Bacteria | 905 |
| 68 | Ga0070685_10003936 | 3300005466 | Bacteria | 7503 |
| 69 | Ga0070685_10103395 | 3300005466 | Bacteria | 1743 |
| 70 | Ga0070685_11152644 | 3300005466 | Unclassified | 587 |
| 71 | Ga0070698_100032750 | 3300005471 | Bacteria | 5382 |
| 72 | Ga0070679_100001371 | 3300005530 | Bacteria | 21479 |
| 73 | Ga0070679_100094725 | 3300005530 | Bacteria | 2973 |
| 74 | Ga0070679_100214555 | 3300005530 | Unclassified | 1887 |
| 75 | Ga0070679_100589924 | 3300005530 | Bacteria | 1055 |
| 76 | Ga0070679_101554355 | 3300005530 | Bacteria | 609 |
| 77 | Ga0070684_100008197 | 3300005535 | Bacteria | 8163 |
| 78 | Ga0070684_100973390 | 3300005535 | Bacteria | 796 |
| 79 | Ga0068853_100007200 | 3300005539 | Bacteria | 8907 |
| 80 | Ga0068853_100067705 | 3300005539 | Bacteria | 3103 |
| 81 | Ga0068853_100195406 | 3300005539 | Bacteria | 1840 |
| 82 | Ga0068853_100203552 | 3300005539 | Bacteria | 1802 |
| 83 | Ga0068853_100223470 | 3300005539 | Bacteria | 1721 |
| 84 | Ga0068853_100510311 | 3300005539 | Unclassified | 1136 |
| 85 | Ga0068853_101288362 | 3300005539 | Bacteria | 706 |
| 86 | Ga0070672_100374180 | 3300005543 | Bacteria | 1217 |
| 87 | Ga0070672_101159279 | 3300005543 | Bacteria | 688 |
| 88 | Ga0070686_100497594 | 3300005544 | Unclassified | 945 |
| 89 | Ga0070686_101275370 | 3300005544 | Unclassified | 613 |
| 90 | Ga0070665_100927238 | 3300005548 | Bacteria | 883 |
| 91 | Ga0070704_100778286 | 3300005549 | Bacteria | 854 |
| 92 | Ga0068855_100119666 | 3300005563 | Bacteria | 3015 |
| 93 | Ga0068855_100168961 | 3300005563 | Bacteria | 2477 |
| 94 | Ga0068855_101562404 | 3300005563 | Bacteria | 676 |
| 95 | Ga0070664_100002996 | 3300005564 | Bacteria | 13660 |
| 96 | Ga0068857_100167706 | 3300005577 | Bacteria | 1995 |
| 97 | Ga0068857_100345204 | 3300005577 | Bacteria | 1378 |
| 98 | Ga0068857_101282396 | 3300005577 | Bacteria | 711 |
| 99 | Ga0068854_100481228 | 3300005578 | Unclassified | 1042 |
| 100 | Ga0068854_101608575 | 3300005578 | Bacteria | 592 |
| 101 | Ga0068854_102231297 | 3300005578 | Unclassified | 507 |
| 102 | Ga0068856_100100554 | 3300005614 | Bacteria | 2884 |
| 103 | Ga0068852_100004095 | 3300005616 | Bacteria | 10264 |
| 104 | Ga0068852_100005706 | 3300005616 | Bacteria | 8928 |
| 105 | Ga0068852_100337204 | 3300005616 | Unclassified | 1468 |
| 106 | Ga0068852_100631915 | 3300005616 | Bacteria | 1077 |
| 107 | Ga0068859_100134619 | 3300005617 | Bacteria | 2543 |
| 108 | Ga0068859_100148289 | 3300005617 | Bacteria | 2421 |
| 109 | Ga0068859_100223816 | 3300005617 | Bacteria | 1969 |
| 110 | Ga0068859_100336147 | 3300005617 | Bacteria | 1605 |
| 111 | Ga0068859_100779408 | 3300005617 | Bacteria | 1044 |
| 112 | Ga0068859_100921373 | 3300005617 | Bacteria | 958 |
| 113 | Ga0068864_100063729 | 3300005618 | Bacteria | 3195 |
| 114 | Ga0068864_100068118 | 3300005618 | Bacteria | 3091 |
| 115 | Ga0068861_100140344 | 3300005719 | Bacteria | 1971 |
| 116 | Ga0068861_100446128 | 3300005719 | Unclassified | 1158 |
| 117 | Ga0068861_101163888 | 3300005719 | Unclassified | 744 |
| 118 | Ga0068861_101175228 | 3300005719 | Unclassified | 741 |
| 119 | Ga0068851_10050052 | 3300005834 | Unclassified | 2121 |
| 120 | Ga0068870_10138094 | 3300005840 | Bacteria | 1423 |
| 121 | Ga0068870_10284915 | 3300005840 | Unclassified | 1037 |
| 122 | Ga0068863_100038538 | 3300005841 | Bacteria | 4547 |
| 123 | Ga0068863_100191310 | 3300005841 | Bacteria | 1966 |
| 124 | Ga0068863_100582538 | 3300005841 | Bacteria | 1106 |
| 125 | Ga0068863_100893018 | 3300005841 | Bacteria | 889 |
| 126 | Ga0068858_100211806 | 3300005842 | Bacteria | 1834 |
| 127 | Ga0068860_100014531 | 3300005843 | Bacteria | 7703 |
| 128 | Ga0068860_100152717 | 3300005843 | Bacteria | 2224 |
| 129 | Ga0068860_100835875 | 3300005843 | Unclassified | 935 |
| 130 | Ga0068860_101841123 | 3300005843 | Unclassified | 627 |
| 131 | Ga0068860_101932935 | 3300005843 | Bacteria | 612 |
| 132 | Ga0068862_100583034 | 3300005844 | Bacteria | 1071 |
| 133 | Ga0075366_10045238 | 3300006195 | Bacteria | 2609 |
| 134 | Ga0075366_10091700 | 3300006195 | Bacteria | 1820 |
| 135 | Ga0075366_10228791 | 3300006195 | Bacteria | 1133 |
| 136 | Ga0097621_100010162 | 3300006237 | Bacteria | 6871 |
| 137 | Ga0097621_101072204 | 3300006237 | Bacteria | 755 |
| 138 | Ga0068871_100832504 | 3300006358 | Bacteria | 852 |
| 139 | Ga0068871_101990468 | 3300006358 | Bacteria | 553 |
| 140 | Ga0075428_100026453 | 3300006844 | Bacteria | 6422 |
| 141 | Ga0075430_100262442 | 3300006846 | Bacteria | 1430 |
| 142 | Ga0075431_100073802 | 3300006847 | Bacteria | 3520 |
| 143 | Ga0075429_100045901 | 3300006880 | Bacteria | 3801 |
| 144 | Ga0097620_100134629 | 3300006931 | Bacteria | 2543 |
| 145 | Ga0097620_100148296 | 3300006931 | Bacteria | 2421 |
| 146 | Ga0097620_100223813 | 3300006931 | Bacteria | 1969 |
| 147 | Ga0097620_100336133 | 3300006931 | Bacteria | 1605 |
| 148 | Ga0097620_100779399 | 3300006931 | Bacteria | 1044 |
| 149 | Ga0097620_100921262 | 3300006931 | Bacteria | 958 |
| 150 | Ga0105251_10412929 | 3300009011 | Bacteria | 622 |
| 151 | Ga0111539_10683122 | 3300009094 | Bacteria | 1195 |
| 152 | Ga0105247_10000640 | 3300009101 | Bacteria | 28018 |
| 153 | Ga0105243_11529585 | 3300009148 | Unclassified | 692 |
| 154 | Ga0105241_10053700 | 3300009174 | Bacteria | 3082 |
| 155 | Ga0105241_10293154 | 3300009174 | Bacteria | 1394 |
| 156 | Ga0105242_10034920 | 3300009176 | Bacteria | 4031 |
| 157 | Ga0105242_10166907 | 3300009176 | Bacteria | 1932 |
| 158 | Ga0105242_13013095 | 3300009176 | Bacteria | 521 |
| 159 | Ga0105237_10158080 | 3300009545 | Bacteria | 2264 |
| 160 | Ga0105249_10002821 | 3300009553 | Bacteria | 14998 |
| 161 | Ga0105249_10005620 | 3300009553 | Bacteria | 10847 |
| 162 | Ga0105249_10009722 | 3300009553 | Bacteria | 8428 |
| 163 | Ga0105249_10027485 | 3300009553 | Bacteria | 5133 |
| 164 | Ga0105249_10094029 | 3300009553 | Bacteria | 2809 |
| 165 | Ga0105249_10376527 | 3300009553 | Bacteria | 1445 |
| 166 | Ga0105249_11007097 | 3300009553 | Unclassified | 902 |
| 167 | Ga0105239_10010402 | 3300010375 | Bacteria | 10409 |
| 168 | Ga0105246_10883907 | 3300011119 | Bacteria | 800 |
| 169 | Ga0157373_10010357 | 3300013100 | Bacteria | 6864 |
| 170 | Ga0157373_10048108 | 3300013100 | Bacteria | 3041 |
| 171 | Ga0157371_10001525 | 3300013102 | Bacteria | 23896 |
| 172 | Ga0157371_10011091 | 3300013102 | Bacteria | 6978 |
| 173 | Ga0157371_10035442 | 3300013102 | Unclassified | 3575 |
| 174 | Ga0157371_10040227 | 3300013102 | Bacteria | 3340 |
| 175 | Ga0157371_10080418 | 3300013102 | Bacteria | 2308 |
| 176 | Ga0157371_10180449 | 3300013102 | Bacteria | 1510 |
| 177 | Ga0157371_10240209 | 3300013102 | Bacteria | 1303 |
| 178 | Ga0157371_10240471 | 3300013102 | Bacteria | 1302 |
| 179 | Ga0157371_10287936 | 3300013102 | Bacteria | 1187 |
| 180 | Ga0157371_10312967 | 3300013102 | Unclassified | 1138 |
| 181 | Ga0157371_10325460 | 3300013102 | Bacteria | 1116 |
| 182 | Ga0157371_10451987 | 3300013102 | Bacteria | 945 |
| 183 | Ga0157371_10462747 | 3300013102 | Bacteria | 933 |
| 184 | Ga0157371_10671711 | 3300013102 | Bacteria | 774 |
| 185 | Ga0157371_11095214 | 3300013102 | Bacteria | 611 |
| 186 | Ga0157371_11125522 | 3300013102 | Bacteria | 603 |
| 187 | Ga0157370_10000405 | 3300013104 | Bacteria | 54383 |
| 188 | Ga0157370_10056705 | 3300013104 | Bacteria | 3728 |
| 189 | Ga0157370_10173003 | 3300013104 | Bacteria | 2007 |
| 190 | Ga0157370_10408255 | 3300013104 | Bacteria | 1250 |
| 191 | Ga0157370_10884935 | 3300013104 | Unclassified | 811 |
| 192 | Ga0157370_10990339 | 3300013104 | Bacteria | 761 |
| 193 | Ga0157370_11019795 | 3300013104 | Bacteria | 749 |
| 194 | Ga0157369_10015578 | 3300013105 | Bacteria | 8567 |
| 195 | Ga0157369_10099420 | 3300013105 | Bacteria | 3101 |
| 196 | Ga0157369_10116752 | 3300013105 | Bacteria | 2833 |
| 197 | Ga0157369_10210068 | 3300013105 | Bacteria | 2040 |
| 198 | Ga0157374_10060543 | 3300013296 | Unclassified | 3543 |
| 199 | Ga0157374_10847877 | 3300013296 | Bacteria | 930 |
| 200 | Ga0157374_12038300 | 3300013296 | Unclassified | 600 |
| 201 | Ga0163162_10072994 | 3300013306 | Bacteria | 3487 |
| 202 | Ga0163162_10419275 | 3300013306 | Bacteria | 1471 |
| 203 | Ga0163162_10451852 | 3300013306 | Bacteria | 1417 |
| 204 | Ga0157372_10015792 | 3300013307 | Bacteria | 8099 |
| 205 | Ga0157372_10061447 | 3300013307 | Bacteria | 4207 |
| 206 | Ga0157372_10091821 | 3300013307 | Bacteria | 3453 |
| 207 | Ga0157372_10147832 | 3300013307 | Bacteria | 2710 |
| 208 | Ga0157372_10165541 | 3300013307 | Bacteria | 2557 |
| 209 | Ga0157372_10183084 | 3300013307 | Bacteria | 2425 |
| 210 | Ga0157372_10184092 | 3300013307 | Bacteria | 2419 |
| 211 | Ga0157372_10392177 | 3300013307 | Bacteria | 1618 |
| 212 | Ga0157372_10434674 | 3300013307 | Bacteria | 1530 |
| 213 | Ga0157372_10474666 | 3300013307 | Bacteria | 1458 |
| 214 | Ga0157372_10827790 | 3300013307 | Unclassified | 1075 |
| 215 | Ga0157372_10941356 | 3300013307 | Bacteria | 1001 |
| 216 | Ga0157372_11342863 | 3300013307 | Bacteria | 825 |
| 217 | Ga0157372_11668931 | 3300013307 | Bacteria | 733 |
| 218 | Ga0157372_12763264 | 3300013307 | Bacteria | 563 |
| 219 | Ga0157372_13059747 | 3300013307 | Bacteria | 534 |
| 220 | Ga0157375_10044031 | 3300013308 | Bacteria | 4332 |
| 221 | Ga0157375_10903592 | 3300013308 | Bacteria | 1027 |
| 222 | Ga0157375_11402660 | 3300013308 | Archaea | 823 |
| 223 | Ga0157375_12504408 | 3300013308 | Bacteria | 616 |
| 224 | Ga0157375_13098924 | 3300013308 | Bacteria | 555 |
| 225 | Ga0163163_10112836 | 3300014325 | Bacteria | 2748 |
| 226 | Ga0163163_10168049 | 3300014325 | Bacteria | 2240 |
| 227 | Ga0163163_10544902 | 3300014325 | Bacteria | 1223 |
| 228 | Ga0157380_10009854 | 3300014326 | Bacteria | 6859 |
| 229 | Ga0157377_10000850 | 3300014745 | Bacteria | 12689 |
| 230 | Ga0157377_10235339 | 3300014745 | Unclassified | 1180 |
| 231 | Ga0157377_10831640 | 3300014745 | Bacteria | 684 |
| 232 | Ga0157379_10860232 | 3300014968 | Bacteria | 858 |
| 233 | Ga0157376_10177830 | 3300014969 | Bacteria | 1942 |
| 234 | Ga0157376_10329528 | 3300014969 | Bacteria | 1454 |
| 235 | Ga0157376_11236227 | 3300014969 | Bacteria | 776 |
| 236 | Ga0157376_11279825 | 3300014969 | Bacteria | 763 |
| 237 | Ga0157376_11833067 | 3300014969 | Bacteria | 643 |
| 238 | Ga0163161_10040415 | 3300017792 | Bacteria | 3350 |
| 239 | Ga0163161_10153465 | 3300017792 | Bacteria | 1751 |
| 240 | Ga0163161_10316739 | 3300017792 | Bacteria | 1232 |
| 241 | Ga0163161_10734993 | 3300017792 | Bacteria | 824 |
| 242 | Ga0207697_10193836 | 3300025315 | Bacteria | 892 |
| 243 | Ga0207656_10043348 | 3300025321 | Bacteria | 1919 |
| 244 | Ga0207682_10375984 | 3300025893 | Bacteria | 671 |
| 245 | Ga0207682_10381313 | 3300025893 | Unclassified | 666 |
| 246 | Ga0207710_10230926 | 3300025900 | Bacteria | 921 |
| 247 | Ga0207680_10921194 | 3300025903 | Bacteria | 626 |
| 248 | Ga0207647_10000631 | 3300025904 | Bacteria | 27434 |
| 249 | Ga0207647_10333925 | 3300025904 | Bacteria | 860 |
| 250 | Ga0207699_11371624 | 3300025906 | Bacteria | 523 |
| 251 | Ga0207643_10042108 | 3300025908 | Bacteria | 2574 |
| 252 | Ga0207705_10124763 | 3300025909 | Bacteria | 1913 |
| 253 | Ga0207705_10134071 | 3300025909 | Bacteria | 1845 |
| 254 | Ga0207705_10198865 | 3300025909 | Bacteria | 1518 |
| 255 | Ga0207705_11174925 | 3300025909 | Bacteria | 589 |
| 256 | Ga0207654_10052355 | 3300025911 | Bacteria | 2352 |
| 257 | Ga0207707_10208744 | 3300025912 | Bacteria | 1702 |
| 258 | Ga0207707_10237157 | 3300025912 | Bacteria | 1586 |
| 259 | Ga0207707_10513706 | 3300025912 | Bacteria | 1021 |
| 260 | Ga0207695_10043451 | 3300025913 | Bacteria | 4789 |
| 261 | Ga0207671_10094034 | 3300025914 | Bacteria | 2262 |
| 262 | Ga0207660_10072536 | 3300025917 | Bacteria | 2508 |
| 263 | Ga0207660_10270871 | 3300025917 | Bacteria | 1345 |
| 264 | Ga0207662_10704543 | 3300025918 | Bacteria | 708 |
| 265 | Ga0207657_10337755 | 3300025919 | Bacteria | 1189 |
| 266 | Ga0207649_10030254 | 3300025920 | Bacteria | 3205 |
| 267 | Ga0207649_10115780 | 3300025920 | Bacteria | 1799 |
| 268 | Ga0207649_11310748 | 3300025920 | Bacteria | 573 |
| 269 | Ga0207652_10000011 | 3300025921 | Bacteria | 246742 |
| 270 | Ga0207652_10010507 | 3300025921 | Bacteria | 7452 |
| 271 | Ga0207652_10386729 | 3300025921 | Bacteria | 1262 |
| 272 | Ga0207681_10163199 | 3300025923 | Bacteria | 1682 |
| 273 | Ga0207650_10024753 | 3300025925 | Bacteria | 4272 |
| 274 | Ga0207650_10090506 | 3300025925 | Unclassified | 2337 |
| 275 | Ga0207650_10291363 | 3300025925 | Bacteria | 1331 |
| 276 | Ga0207650_10345411 | 3300025925 | Bacteria | 1223 |
| 277 | Ga0207650_11222498 | 3300025925 | Bacteria | 640 |
| 278 | Ga0207659_10058933 | 3300025926 | Bacteria | 2758 |
| 279 | Ga0207659_10357557 | 3300025926 | Bacteria | 1213 |
| 280 | Ga0207659_10522240 | 3300025926 | Bacteria | 1007 |
| 281 | Ga0207659_10546507 | 3300025926 | Unclassified | 984 |
| 282 | Ga0207664_11437300 | 3300025929 | Bacteria | 611 |
| 283 | Ga0207644_10573251 | 3300025931 | Bacteria | 936 |
| 284 | Ga0207644_10693599 | 3300025931 | Unclassified | 849 |
| 285 | Ga0207690_10077056 | 3300025932 | Archaea | 2317 |
| 286 | Ga0207690_10214244 | 3300025932 | Bacteria | 1470 |
| 287 | Ga0207686_10002295 | 3300025934 | Bacteria | 10475 |
| 288 | Ga0207670_10011943 | 3300025936 | Bacteria | 5059 |
| 289 | Ga0207670_10012135 | 3300025936 | Bacteria | 5028 |
| 290 | Ga0207669_10417077 | 3300025937 | Bacteria | 1056 |
| 291 | Ga0207704_10704473 | 3300025938 | Bacteria | 836 |
| 292 | Ga0207691_10011763 | 3300025940 | Bacteria | 8400 |
| 293 | Ga0207691_10280931 | 3300025940 | Unclassified | 1432 |
| 294 | Ga0207691_11426297 | 3300025940 | Bacteria | 568 |
| 295 | Ga0207689_10026995 | 3300025942 | Bacteria | 4807 |
| 296 | Ga0207689_10366816 | 3300025942 | Bacteria | 1198 |
| 297 | Ga0207661_10013907 | 3300025944 | Bacteria | 5883 |
| 298 | Ga0207661_10126985 | 3300025944 | Bacteria | 2179 |
| 299 | Ga0207679_10010234 | 3300025945 | Bacteria | 6033 |
| 300 | Ga0207679_11995811 | 3300025945 | Bacteria | 528 |
| 301 | Ga0207667_10047267 | 3300025949 | Bacteria | 4555 |
| 302 | Ga0207667_10382848 | 3300025949 | Bacteria | 1433 |
| 303 | Ga0207667_11401981 | 3300025949 | Bacteria | 672 |
| 304 | Ga0207651_10489515 | 3300025960 | Bacteria | 1061 |
| 305 | Ga0207712_10012625 | 3300025961 | Bacteria | 5398 |
| 306 | Ga0207712_10036938 | 3300025961 | Bacteria | 3330 |
| 307 | Ga0207712_10038726 | 3300025961 | Bacteria | 3261 |
| 308 | Ga0207712_10337853 | 3300025961 | Bacteria | 1248 |
| 309 | Ga0207712_10366597 | 3300025961 | Bacteria | 1202 |
| 310 | Ga0207712_10860227 | 3300025961 | Bacteria | 800 |
| 311 | Ga0207668_10065467 | 3300025972 | Bacteria | 2573 |
| 312 | Ga0207640_10340771 | 3300025981 | Unclassified | 1201 |
| 313 | Ga0207640_10505048 | 3300025981 | Unclassified | 1008 |
| 314 | Ga0207640_10535461 | 3300025981 | Unclassified | 981 |
| 315 | Ga0207640_12203939 | 3300025981 | Unclassified | 500 |
| 316 | Ga0207658_10075665 | 3300025986 | Bacteria | 2562 |
| 317 | Ga0207658_10332220 | 3300025986 | Bacteria | 1319 |
| 318 | Ga0207677_10171462 | 3300026023 | Bacteria | 1697 |
| 319 | Ga0207677_10176062 | 3300026023 | Unclassified | 1678 |
| 320 | Ga0207677_11659020 | 3300026023 | Bacteria | 592 |
| 321 | Ga0207639_10014093 | 3300026041 | Bacteria | 5613 |
| 322 | Ga0207639_10395255 | 3300026041 | Unclassified | 1244 |
| 323 | Ga0207639_10457222 | 3300026041 | Unclassified | 1160 |
| 324 | Ga0207639_11040349 | 3300026041 | Unclassified | 767 |
| 325 | Ga0207639_11184843 | 3300026041 | Bacteria | 717 |
| 326 | Ga0207678_10009847 | 3300026067 | Bacteria | 8398 |
| 327 | Ga0207708_10569129 | 3300026075 | Bacteria | 957 |
| 328 | Ga0207702_10729732 | 3300026078 | Bacteria | 977 |
| 329 | Ga0207641_10032262 | 3300026088 | Bacteria | 4348 |
| 330 | Ga0207641_10523637 | 3300026088 | Bacteria | 1153 |
| 331 | Ga0207641_11479572 | 3300026088 | Bacteria | 681 |
| 332 | Ga0207648_10002286 | 3300026089 | Bacteria | 20689 |
| 333 | Ga0207648_10187738 | 3300026089 | Bacteria | 1831 |
| 334 | Ga0207648_10839511 | 3300026089 | Bacteria | 856 |
| 335 | Ga0207648_10862815 | 3300026089 | Bacteria | 844 |
| 336 | Ga0207676_10058081 | 3300026095 | Bacteria | 3050 |
| 337 | Ga0207676_10187526 | 3300026095 | Bacteria | 1817 |
| 338 | Ga0207676_11010900 | 3300026095 | Bacteria | 820 |
| 339 | Ga0207676_11624698 | 3300026095 | Bacteria | 644 |
| 340 | Ga0207676_12580218 | 3300026095 | Bacteria | 504 |
| 341 | Ga0207674_10175238 | 3300026116 | Bacteria | 2097 |
| 342 | Ga0207674_10207901 | 3300026116 | Bacteria | 1906 |
| 343 | Ga0207674_10391447 | 3300026116 | Unclassified | 1343 |
| 344 | Ga0207674_10461249 | 3300026116 | Unclassified | 1228 |
| 345 | Ga0207674_10486236 | 3300026116 | Bacteria | 1193 |
| 346 | Ga0207674_10591515 | 3300026116 | Bacteria | 1072 |
| 347 | Ga0207674_10657407 | 3300026116 | Bacteria | 1012 |
| 348 | Ga0207675_100183166 | 3300026118 | Bacteria | 2006 |
| 349 | Ga0207675_100194739 | 3300026118 | Bacteria | 1945 |
| 350 | Ga0207675_100350934 | 3300026118 | Bacteria | 1446 |
| 351 | Ga0207683_10095532 | 3300026121 | Bacteria | 2650 |
| 352 | Ga0207698_10137739 | 3300026142 | Bacteria | 2097 |
| 353 | Ga0207698_10475378 | 3300026142 | Bacteria | 1211 |
| 354 | Ga0207698_10587356 | 3300026142 | Unclassified | 1096 |
| 355 | Ga0207698_10887484 | 3300026142 | Bacteria | 898 |
| 356 | Ga0207698_11066291 | 3300026142 | Bacteria | 820 |
| 357 | Ga0209969_1041694 | 3300027360 | Unclassified | 713 |
| 358 | Ga0268266_11332733 | 3300028379 | Bacteria | 693 |
| 359 | Ga0268265_10126162 | 3300028380 | Bacteria | 2118 |
| 360 | Ga0268265_10530885 | 3300028380 | Bacteria | 1114 |
| 361 | Ga0268265_10564875 | 3300028380 | Bacteria | 1082 |
| 362 | Ga0268265_10998824 | 3300028380 | Bacteria | 826 |
| 363 | Ga0268264_10125691 | 3300028381 | Bacteria | 2266 |
| 364 | Ga0268264_10142752 | 3300028381 | Bacteria | 2137 |
| 365 | Ga0268264_10520629 | 3300028381 | Bacteria | 1163 |
| 366 | Ga0268264_10909242 | 3300028381 | Bacteria | 884 |
| 367 | Ga0307410_10775276 | 3300031852 | Bacteria | 814 |
| 368 | Ga0307412_10892053 | 3300031911 | Unclassified | 779 |
| 369 | Ga0307414_10077584 | 3300032004 | Bacteria | 2419 |
| 370 | Ga0307414_10292078 | 3300032004 | Bacteria | 1375 |
| 371 | Ga0307415_100835047 | 3300032126 | Unclassified | 844 |
| 372 | Ga0395899_0015849 | 3300037312 | Bacteria | 5747 |
| 373 | Ga0395899_0079554 | 3300037312 | Bacteria | 2387 |
| 374 | Ga0395899_0200182 | 3300037312 | Bacteria | 1393 |
| 375 | Ga0395900_0103902 | 3300037418 | Bacteria | 2918 |
| 376 | Ga0395900_0348733 | 3300037418 | Bacteria | 1454 |
| 377 | Ga0395900_0602430 | 3300037418 | Bacteria | 1039 |
| 378 | Ga0395898_0015199 | 3300037466 | Bacteria | 7902 |
| 379 | Ga0395898_0137204 | 3300037466 | Bacteria | 2342 |
| 380 | Ga0395898_0262695 | 3300037466 | Bacteria | 1647 |
| 381 | Ga0395905_0008340 | 3300037471 | Bacteria | 10221 |
| 382 | Ga0395905_0061061 | 3300037471 | Bacteria | 3525 |
| 383 | Ga0395901_0034894 | 3300038443 | Bacteria | 5196 |
| 384 | Ga0395901_0166042 | 3300038443 | Bacteria | 2318 |
| 385 | Ga0436365_0701472 | 3300039437 | Bacteria | 614 |
| 386 | Ga0439461_0045037 | 3300041410 | Bacteria | 964 |
| 387 | Ga0439465_0231858 | 3300041413 | Bacteria | 679 |
| 388 | Ga0451835_0593670 | 3300041492 | Bacteria | 671 |
| 389 | Ga0439442_026709 | 3300042002 | Bacteria | 1202 |
| 390 | Ga0439445_0051755 | 3300042004 | Unclassified | 1110 |
| 391 | Ga0439449_0117790 | 3300042007 | Unclassified | 985 |
| 392 | Ga0439457_061210 | 3300042014 | Bacteria | 852 |
| 393 | Ga0439462_0014193 | 3300042015 | Bacteria | 2046 |
| 394 | Ga0450923_016511 | 3300042125 | Bacteria | 1392 |
| 395 | Ga0450923_026516 | 3300042125 | Bacteria | 1161 |
| 396 | Ga0450894_011316 | 3300042131 | Bacteria | 1162 |
| 397 | Ga0450898_000876 | 3300042134 | Bacteria | 3763 |
| 398 | Ga0450899_006909 | 3300042135 | Bacteria | 1232 |
| 399 | Ga0439434_0003068 | 3300042435 | Bacteria | 4901 |
| 400 | Ga0466966_0422811 | 3300044684 | Unclassified | 801 |
| 401 | Ga0495644_0117958 | 3300046523 | Bacteria | 1009 |
| 402 | Ga0495598_0046006 | 3300046537 | Bacteria | 1296 |
| 403 | Ga0495670_0555725 | 3300046691 | Bacteria | 625 |
| 404 | Ga0495672_0520976 | 3300047320 | Unclassified | 525 |
| 405 | Ga0495686_0018868 | 3300047472 | Bacteria | 4620 |
| 406 | Ga0501292_062512 | 3300049515 | Unclassified | 678 |
| 407 | Ga0501292_067179 | 3300049515 | Bacteria | 660 |
| 408 | Ga0501294_023354 | 3300049517 | Bacteria | 683 |
| 409 | Ga0501297_055750 | 3300049520 | Bacteria | 593 |
| 410 | Ga0501298_010434 | 3300049521 | Bacteria | 1599 |
| 411 | Ga0501032_0005429 | 3300049569 | Bacteria | 9471 |
| 412 | Ga0501034_0001294 | 3300049571 | Bacteria | 33843 |
| 413 | Ga0501036_0002885 | 3300049572 | Bacteria | 13631 |
| 414 | Ga0501037_0024522 | 3300049573 | Bacteria | 4461 |
| 415 | Ga0501038_0160650 | 3300049574 | Bacteria | 1826 |
| 416 | Ga0501039_0034378 | 3300049575 | Bacteria | 3912 |
| 417 | Ga0501043_0021899 | 3300049579 | Bacteria | 5012 |
| 418 | Ga0501046_0019988 | 3300049580 | Bacteria | 5544 |
| 419 | Ga0501047_0026380 | 3300049581 | Bacteria | 5590 |
| 420 | Ga0501068_0296254 | 3300049584 | Bacteria | 1035 |
| 421 | Ga0501070_0379301 | 3300049586 | Bacteria | 1145 |
| 422 | Ga0501073_0005146 | 3300049589 | Bacteria | 9815 |
| 423 | Ga0501074_0034770 | 3300049590 | Bacteria | 3652 |
| 424 | Ga0501201_000834 | 3300049651 | Bacteria | 2900 |
| 425 | Ga0501206_001011 | 3300049653 | Bacteria | 3508 |
| 426 | Ga0501206_003305 | 3300049653 | Bacteria | 2046 |
| 427 | Ga0501207_032581 | 3300049654 | Bacteria | 881 |
| 428 | Ga0501210_007348 | 3300049657 | Unclassified | 828 |
| 429 | Ga0501217_000389 | 3300049661 | Bacteria | 7073 |
| 430 | Ga0501217_022559 | 3300049661 | Bacteria | 1494 |
| 431 | Ga0501222_029785 | 3300049662 | Bacteria | 748 |
| 432 | Ga0501223_003310 | 3300049663 | Bacteria | 3523 |
| 433 | Ga0501224_011301 | 3300049664 | Bacteria | 1313 |
| 434 | Ga0501227_022377 | 3300049665 | Bacteria | 1462 |
| 435 | Ga0501233_020379 | 3300049668 | Bacteria | 1414 |
| 436 | Ga0501233_131455 | 3300049668 | Unclassified | 684 |
| 437 | Ga0501235_005238 | 3300049669 | Bacteria | 2820 |
| 438 | Ga0501235_095244 | 3300049669 | Bacteria | 722 |
| 439 | Ga0501236_023351 | 3300049670 | Unclassified | 931 |
| 440 | Ga0501236_060368 | 3300049670 | Bacteria | 671 |
| 441 | Ga0501239_045723 | 3300049672 | Bacteria | 619 |
| 442 | Ga0501240_063566 | 3300049673 | Bacteria | 656 |
| 443 | Ga0501240_090589 | 3300049673 | Unclassified | 577 |
| 444 | Ga0501242_003117 | 3300049674 | Bacteria | 1778 |
| 445 | Ga0501242_004568 | 3300049674 | Bacteria | 1538 |
| 446 | Ga0501242_011274 | 3300049674 | Bacteria | 1077 |
| 447 | Ga0501243_016237 | 3300049675 | Bacteria | 1200 |
| 448 | Ga0501243_030475 | 3300049675 | Bacteria | 919 |
| 449 | Ga0501246_044906 | 3300049676 | Bacteria | 538 |
| 450 | Ga0501250_013374 | 3300049680 | Unclassified | 983 |
| 451 | Ga0501251_013541 | 3300049681 | Bacteria | 1001 |
| 452 | Ga0501252_002982 | 3300049682 | Bacteria | 1716 |
| 453 | Ga0501253_007025 | 3300049683 | Bacteria | 1554 |
| 454 | Ga0501253_083904 | 3300049683 | Bacteria | 723 |
| 455 | Ga0501256_008231 | 3300049685 | Unclassified | 969 |
| 456 | Ga0501257_006054 | 3300049686 | Bacteria | 2680 |
| 457 | Ga0501257_054461 | 3300049686 | Bacteria | 1002 |
| 458 | Ga0501257_059892 | 3300049686 | Unclassified | 961 |
| 459 | Ga0501259_000140 | 3300049688 | Bacteria | 10848 |
| 460 | Ga0501259_008172 | 3300049688 | Bacteria | 1683 |
| 461 | Ga0501261_034894 | 3300049690 | Bacteria | 773 |
| 462 | Ga0501221_001556 | 3300049704 | Bacteria | 3804 |
| 463 | Ga0501225_0007459 | 3300049705 | Bacteria | 3167 |
| 464 | Ga0501225_0093190 | 3300049705 | Unclassified | 874 |
| 465 | Ga0501229_008822 | 3300049706 | Bacteria | 1263 |
| 466 | Ga0501234_002359 | 3300049707 | Bacteria | 2972 |
| 467 | Ga0501234_054510 | 3300049707 | Unclassified | 670 |
| 468 | Ga0501245_001734 | 3300049708 | Bacteria | 2856 |
| 469 | Ga0501245_003425 | 3300049708 | Bacteria | 2152 |
| 470 | Ga0501079_0106114 | 3300049741 | Bacteria | 2180 |
| 471 | Ga0501080_0082434 | 3300049742 | Bacteria | 2987 |
| 472 | Ga0501083_0045805 | 3300049744 | Bacteria | 2958 |
| 473 | Ga0501232_023963 | 3300049757 | Unclassified | 806 |
| 474 | Ga0501241_018069 | 3300049758 | Bacteria | 1291 |
| 475 | Ga0501268_059759 | 3300049765 | Unclassified | 753 |
| 476 | Ga0501271_061595 | 3300049768 | Bacteria | 527 |
| 477 | Ga0501275_086225 | 3300049772 | Bacteria | 516 |
| 478 | Ga0501282_007908 | 3300049778 | Bacteria | 1138 |
| 479 | Ga0501035_0008435 | 3300049822 | Bacteria | 9595 |
| 480 | Ga0501044_0103815 | 3300049823 | Bacteria | 2857 |
| 481 | Ga0501212_011247 | 3300049851 | Bacteria | 1287 |
| 482 | nmdc:mga0k408_153361_c1 | 3300050493 | Bacteria | 1372 |
| 483 | nmdc:mga0k408_180857_c1 | 3300050493 | Bacteria | 1258 |
| 484 | nmdc:mga0k408_491049_c1 | 3300050493 | Unclassified | 728 |
| 485 | nmdc:mga09592_62139_c1 | 3300050508 | Bacteria | 3160 |
| 486 | nmdc:mga0qj67_205728_c1 | 3300050509 | Bacteria | 1599 |
| 487 | nmdc:mga06r32_727338_c1 | 3300050510 | Bacteria | 957 |
| 488 | nmdc:mga08y16_944207_c1 | 3300050511 | Bacteria | 846 |
| 489 | Ga0500645_198032 | 3300053730 | Bacteria | 542 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005355 | Ga0070671_100342650 | Ga0070671_1003426501 | 118 |
| 2 | 3300005543 | Ga0070672_101159279 | Ga0070672_1011592791 | 118 |
| 3 | 3300005544 | Ga0070686_100497594 | Ga0070686_1004975942 | 118 |
| 4 | 3300005843 | Ga0068860_100152717 | Ga0068860_1001527172 | 118 |
| 5 | 3300013102 | Ga0157371_10001525 | Ga0157371_1000152513 | 118 |
| 6 | 3300013104 | Ga0157370_10056705 | Ga0157370_100567052 | 118 |
| 7 | 3300013306 | Ga0163162_10419275 | Ga0163162_104192752 | 118 |
| 8 | 3300013307 | Ga0157372_11342863 | Ga0157372_113428632 | 118 |
| 9 | 3300013308 | Ga0157375_11402660 | Ga0157375_114026602 | 118 |
| 10 | 3300013308 | Ga0157375_12504408 | Ga0157375_125044081 | 118 |
| 11 | 3300014969 | Ga0157376_10329528 | Ga0157376_103295282 | 118 |
| 12 | 3300017792 | Ga0163161_10153465 | Ga0163161_101534652 | 118 |
| 13 | 3300025926 | Ga0207659_10357557 | Ga0207659_103575572 | 118 |
| 14 | 3300025931 | Ga0207644_10693599 | Ga0207644_106935992 | 118 |
| 15 | 3300025940 | Ga0207691_11426297 | Ga0207691_114262971 | 118 |
| 16 | 3300026142 | Ga0207698_10475378 | Ga0207698_104753782 | 118 |
| 17 | 3300028381 | Ga0268264_10520629 | Ga0268264_105206292 | 118 |
| 18 | 3300005327 | Ga0070658_11100291 | Ga0070658_111002911 | 119 |
| 19 | 3300005329 | Ga0070683_101065820 | Ga0070683_1010658202 | 119 |
| 20 | 3300005336 | Ga0070680_100036976 | Ga0070680_1000369762 | 119 |
| 21 | 3300005336 | Ga0070680_101055103 | Ga0070680_1010551032 | 119 |
| 22 | 3300005339 | Ga0070660_100258811 | Ga0070660_1002588113 | 119 |
| 23 | 3300005339 | Ga0070660_100518906 | Ga0070660_1005189061 | 119 |
| 24 | 3300005339 | Ga0070660_101863568 | Ga0070660_1018635681 | 119 |
| 25 | 3300005353 | Ga0070669_100290039 | Ga0070669_1002900392 | 119 |
| 26 | 3300005366 | Ga0070659_100016720 | Ga0070659_1000167203 | 119 |
| 27 | 3300005367 | Ga0070667_100035440 | Ga0070667_1000354403 | 119 |
| 28 | 3300005435 | Ga0070714_101962302 | Ga0070714_1019623021 | 119 |
| 29 | 3300005458 | Ga0070681_10082740 | Ga0070681_100827403 | 119 |
| 30 | 3300005458 | Ga0070681_10238608 | Ga0070681_102386082 | 119 |
| 31 | 3300005458 | Ga0070681_10553907 | Ga0070681_105539072 | 119 |
| 32 | 3300005459 | Ga0068867_100219973 | Ga0068867_1002199732 | 119 |
| 33 | 3300005530 | Ga0070679_100001371 | Ga0070679_1000013717 | 119 |
| 34 | 3300005530 | Ga0070679_100094725 | Ga0070679_1000947253 | 119 |
| 35 | 3300005530 | Ga0070679_100214555 | Ga0070679_1002145552 | 119 |
| 36 | 3300005530 | Ga0070679_100589924 | Ga0070679_1005899241 | 119 |
| 37 | 3300005530 | Ga0070679_101554355 | Ga0070679_1015543551 | 119 |
| 38 | 3300005539 | Ga0068853_100067705 | Ga0068853_1000677052 | 119 |
| 39 | 3300005539 | Ga0068853_100203552 | Ga0068853_1002035522 | 119 |
| 40 | 3300005539 | Ga0068853_101288362 | Ga0068853_1012883621 | 119 |
| 41 | 3300005548 | Ga0070665_100927238 | Ga0070665_1009272381 | 119 |
| 42 | 3300005563 | Ga0068855_100119666 | Ga0068855_1001196664 | 119 |
| 43 | 3300005563 | Ga0068855_100168961 | Ga0068855_1001689612 | 119 |
| 44 | 3300005563 | Ga0068855_101562404 | Ga0068855_1015624041 | 119 |
| 45 | 3300005577 | Ga0068857_100167706 | Ga0068857_1001677062 | 119 |
| 46 | 3300005577 | Ga0068857_100345204 | Ga0068857_1003452041 | 119 |
| 47 | 3300005578 | Ga0068854_100481228 | Ga0068854_1004812281 | 119 |
| 48 | 3300005614 | Ga0068856_100100554 | Ga0068856_1001005542 | 119 |
| 49 | 3300005616 | Ga0068852_100004095 | Ga0068852_10000409510 | 119 |
| 50 | 3300005617 | Ga0068859_100336147 | Ga0068859_1003361472 | 119 |
| 51 | 3300005618 | Ga0068864_100068118 | Ga0068864_1000681183 | 119 |
| 52 | 3300005840 | Ga0068870_10284915 | Ga0068870_102849152 | 119 |
| 53 | 3300005841 | Ga0068863_100893018 | Ga0068863_1008930182 | 119 |
| 54 | 3300005843 | Ga0068860_100014531 | Ga0068860_1000145315 | 119 |
| 55 | 3300005843 | Ga0068860_100835875 | Ga0068860_1008358751 | 119 |
| 56 | 3300006358 | Ga0068871_100832504 | Ga0068871_1008325041 | 119 |
| 57 | 3300006931 | Ga0097620_100336133 | Ga0097620_1003361332 | 119 |
| 58 | 3300009011 | Ga0105251_10412929 | Ga0105251_104129291 | 119 |
| 59 | 3300009174 | Ga0105241_10053700 | Ga0105241_100537002 | 119 |
| 60 | 3300009174 | Ga0105241_10293154 | Ga0105241_102931541 | 119 |
| 61 | 3300009545 | Ga0105237_10158080 | Ga0105237_101580803 | 119 |
| 62 | 3300009553 | Ga0105249_10376527 | Ga0105249_103765272 | 119 |
| 63 | 3300010375 | Ga0105239_10010402 | Ga0105239_100104025 | 119 |
| 64 | 3300013100 | Ga0157373_10010357 | Ga0157373_100103573 | 119 |
| 65 | 3300013100 | Ga0157373_10048108 | Ga0157373_100481085 | 119 |
| 66 | 3300013102 | Ga0157371_10011091 | Ga0157371_100110916 | 119 |
| 67 | 3300013102 | Ga0157371_10035442 | Ga0157371_100354422 | 119 |
| 68 | 3300013102 | Ga0157371_10040227 | Ga0157371_100402272 | 119 |
| 69 | 3300013102 | Ga0157371_10080418 | Ga0157371_100804183 | 119 |
| 70 | 3300013102 | Ga0157371_10240209 | Ga0157371_102402092 | 119 |
| 71 | 3300013102 | Ga0157371_10240471 | Ga0157371_102404712 | 119 |
| 72 | 3300013102 | Ga0157371_10451987 | Ga0157371_104519871 | 119 |
| 73 | 3300013102 | Ga0157371_10462747 | Ga0157371_104627472 | 119 |
| 74 | 3300013102 | Ga0157371_11125522 | Ga0157371_111255221 | 119 |
| 75 | 3300013104 | Ga0157370_10173003 | Ga0157370_101730032 | 119 |
| 76 | 3300013104 | Ga0157370_10990339 | Ga0157370_109903391 | 119 |
| 77 | 3300013104 | Ga0157370_11019795 | Ga0157370_110197951 | 119 |
| 78 | 3300013105 | Ga0157369_10015578 | Ga0157369_1001557810 | 119 |
| 79 | 3300013105 | Ga0157369_10099420 | Ga0157369_100994202 | 119 |
| 80 | 3300013105 | Ga0157369_10116752 | Ga0157369_101167522 | 119 |
| 81 | 3300013296 | Ga0157374_10847877 | Ga0157374_108478772 | 119 |
| 82 | 3300013296 | Ga0157374_12038300 | Ga0157374_120383001 | 119 |
| 83 | 3300013307 | Ga0157372_10015792 | Ga0157372_100157922 | 119 |
| 84 | 3300013307 | Ga0157372_10061447 | Ga0157372_100614473 | 119 |
| 85 | 3300013307 | Ga0157372_10183084 | Ga0157372_101830842 | 119 |
| 86 | 3300013307 | Ga0157372_10392177 | Ga0157372_103921771 | 119 |
| 87 | 3300013307 | Ga0157372_10827790 | Ga0157372_108277901 | 119 |
| 88 | 3300014325 | Ga0163163_10168049 | Ga0163163_101680492 | 119 |
| 89 | 3300014325 | Ga0163163_10544902 | Ga0163163_105449022 | 119 |
| 90 | 3300025904 | Ga0207647_10333925 | Ga0207647_103339251 | 119 |
| 91 | 3300025909 | Ga0207705_10124763 | Ga0207705_101247632 | 119 |
| 92 | 3300025909 | Ga0207705_10134071 | Ga0207705_101340711 | 119 |
| 93 | 3300025909 | Ga0207705_10198865 | Ga0207705_101988652 | 119 |
| 94 | 3300025909 | Ga0207705_11174925 | Ga0207705_111749251 | 119 |
| 95 | 3300025911 | Ga0207654_10052355 | Ga0207654_100523552 | 119 |
| 96 | 3300025912 | Ga0207707_10208744 | Ga0207707_102087442 | 119 |
| 97 | 3300025912 | Ga0207707_10237157 | Ga0207707_102371572 | 119 |
| 98 | 3300025912 | Ga0207707_10513706 | Ga0207707_105137061 | 119 |
| 99 | 3300025913 | Ga0207695_10043451 | Ga0207695_100434514 | 119 |
| 100 | 3300025914 | Ga0207671_10094034 | Ga0207671_100940342 | 119 |
| 101 | 3300025917 | Ga0207660_10072536 | Ga0207660_100725362 | 119 |
| 102 | 3300025917 | Ga0207660_10270871 | Ga0207660_102708711 | 119 |
| 103 | 3300025919 | Ga0207657_10337755 | Ga0207657_103377551 | 119 |
| 104 | 3300025921 | Ga0207652_10000011 | Ga0207652_1000001115 | 119 |
| 105 | 3300025921 | Ga0207652_10010507 | Ga0207652_100105074 | 119 |
| 106 | 3300025921 | Ga0207652_10386729 | Ga0207652_103867292 | 119 |
| 107 | 3300025923 | Ga0207681_10163199 | Ga0207681_101631992 | 119 |
| 108 | 3300025929 | Ga0207664_11437300 | Ga0207664_114373001 | 119 |
| 109 | 3300025932 | Ga0207690_10214244 | Ga0207690_102142441 | 119 |
| 110 | 3300025944 | Ga0207661_10126985 | Ga0207661_101269852 | 119 |
| 111 | 3300025949 | Ga0207667_10047267 | Ga0207667_100472672 | 119 |
| 112 | 3300025949 | Ga0207667_10382848 | Ga0207667_103828482 | 119 |
| 113 | 3300025949 | Ga0207667_11401981 | Ga0207667_114019811 | 119 |
| 114 | 3300025961 | Ga0207712_10860227 | Ga0207712_108602271 | 119 |
| 115 | 3300025981 | Ga0207640_10505048 | Ga0207640_105050481 | 119 |
| 116 | 3300025981 | Ga0207640_10535461 | Ga0207640_105354612 | 119 |
| 117 | 3300025986 | Ga0207658_10332220 | Ga0207658_103322202 | 119 |
| 118 | 3300026023 | Ga0207677_11659020 | Ga0207677_116590201 | 119 |
| 119 | 3300026041 | Ga0207639_11040349 | Ga0207639_110403491 | 119 |
| 120 | 3300026041 | Ga0207639_11184843 | Ga0207639_111848432 | 119 |
| 121 | 3300026067 | Ga0207678_10009847 | Ga0207678_100098472 | 119 |
| 122 | 3300026078 | Ga0207702_10729732 | Ga0207702_107297321 | 119 |
| 123 | 3300026088 | Ga0207641_11479572 | Ga0207641_114795721 | 119 |
| 124 | 3300026089 | Ga0207648_10187738 | Ga0207648_101877382 | 119 |
| 125 | 3300026095 | Ga0207676_10187526 | Ga0207676_101875262 | 119 |
| 126 | 3300026116 | Ga0207674_10175238 | Ga0207674_101752382 | 119 |
| 127 | 3300026116 | Ga0207674_10207901 | Ga0207674_102079012 | 119 |
| 128 | 3300026116 | Ga0207674_10657407 | Ga0207674_106574071 | 119 |
| 129 | 3300026142 | Ga0207698_10887484 | Ga0207698_108874841 | 119 |
| 130 | 3300028379 | Ga0268266_11332733 | Ga0268266_113327331 | 119 |
| 131 | 3300028380 | Ga0268265_10998824 | Ga0268265_109988242 | 119 |
| 132 | 3300028381 | Ga0268264_10142752 | Ga0268264_101427522 | 119 |
| 133 | 3300037312 | Ga0395899_0015849 | Ga0395899_0015849_2319_2687 | 119 |
| 134 | 3300037312 | Ga0395899_0079554 | Ga0395899_0079554_1702_2070 | 119 |
| 135 | 3300037312 | Ga0395899_0200182 | Ga0395899_0200182_28_387 | 119 |
| 136 | 3300037418 | Ga0395900_0103902 | Ga0395900_0103902_2044_2412 | 119 |
| 137 | 3300037418 | Ga0395900_0602430 | Ga0395900_0602430_176_535 | 119 |
| 138 | 3300037466 | Ga0395898_0015199 | Ga0395898_0015199_5673_6041 | 119 |
| 139 | 3300037466 | Ga0395898_0137204 | Ga0395898_0137204_203_562 | 119 |
| 140 | 3300038443 | Ga0395901_0034894 | Ga0395901_0034894_617_985 | 119 |
| 141 | 3300038443 | Ga0395901_0166042 | Ga0395901_0166042_689_1048 | 119 |
| 142 | 3300005329 | Ga0070683_100036619 | Ga0070683_1000366194 | 120 |
| 143 | 3300005331 | Ga0070670_100038368 | Ga0070670_1000383683 | 120 |
| 144 | 3300005331 | Ga0070670_100811831 | Ga0070670_1008118312 | 120 |
| 145 | 3300005339 | Ga0070660_100160370 | Ga0070660_1001603701 | 120 |
| 146 | 3300005343 | Ga0070687_100523505 | Ga0070687_1005235051 | 120 |
| 147 | 3300005344 | Ga0070661_100041139 | Ga0070661_1000411392 | 120 |
| 148 | 3300005344 | Ga0070661_100045609 | Ga0070661_1000456093 | 120 |
| 149 | 3300005344 | Ga0070661_100578076 | Ga0070661_1005780761 | 120 |
| 150 | 3300005353 | Ga0070669_101883556 | Ga0070669_1018835561 | 120 |
| 151 | 3300005366 | Ga0070659_100014169 | Ga0070659_1000141694 | 120 |
| 152 | 3300005459 | Ga0068867_100681548 | Ga0068867_1006815482 | 120 |
| 153 | 3300005535 | Ga0070684_100008197 | Ga0070684_1000081976 | 120 |
| 154 | 3300005535 | Ga0070684_100973390 | Ga0070684_1009733902 | 120 |
| 155 | 3300005539 | Ga0068853_100195406 | Ga0068853_1001954063 | 120 |
| 156 | 3300005539 | Ga0068853_100510311 | Ga0068853_1005103112 | 120 |
| 157 | 3300005544 | Ga0070686_101275370 | Ga0070686_1012753701 | 120 |
| 158 | 3300005564 | Ga0070664_100002996 | Ga0070664_1000029962 | 120 |
| 159 | 3300005578 | Ga0068854_101608575 | Ga0068854_1016085752 | 120 |
| 160 | 3300005616 | Ga0068852_100005706 | Ga0068852_1000057063 | 120 |
| 161 | 3300005616 | Ga0068852_100337204 | Ga0068852_1003372042 | 120 |
| 162 | 3300005719 | Ga0068861_100446128 | Ga0068861_1004461281 | 120 |
| 163 | 3300005719 | Ga0068861_101163888 | Ga0068861_1011638881 | 120 |
| 164 | 3300005834 | Ga0068851_10050052 | Ga0068851_100500522 | 120 |
| 165 | 3300006358 | Ga0068871_101990468 | Ga0068871_1019904681 | 120 |
| 166 | 3300013102 | Ga0157371_10180449 | Ga0157371_101804492 | 120 |
| 167 | 3300013102 | Ga0157371_10287936 | Ga0157371_102879362 | 120 |
| 168 | 3300013102 | Ga0157371_10312967 | Ga0157371_103129672 | 120 |
| 169 | 3300013102 | Ga0157371_10325460 | Ga0157371_103254602 | 120 |
| 170 | 3300013102 | Ga0157371_10671711 | Ga0157371_106717111 | 120 |
| 171 | 3300013102 | Ga0157371_11095214 | Ga0157371_110952141 | 120 |
| 172 | 3300013104 | Ga0157370_10000405 | Ga0157370_100004056 | 120 |
| 173 | 3300013104 | Ga0157370_10408255 | Ga0157370_104082552 | 120 |
| 174 | 3300013104 | Ga0157370_10884935 | Ga0157370_108849351 | 120 |
| 175 | 3300013105 | Ga0157369_10210068 | Ga0157369_102100682 | 120 |
| 176 | 3300013296 | Ga0157374_10060543 | Ga0157374_100605432 | 120 |
| 177 | 3300013307 | Ga0157372_10091821 | Ga0157372_100918213 | 120 |
| 178 | 3300013307 | Ga0157372_10147832 | Ga0157372_101478323 | 120 |
| 179 | 3300013307 | Ga0157372_10165541 | Ga0157372_101655413 | 120 |
| 180 | 3300013307 | Ga0157372_10184092 | Ga0157372_101840924 | 120 |
| 181 | 3300013307 | Ga0157372_10434674 | Ga0157372_104346742 | 120 |
| 182 | 3300013307 | Ga0157372_10474666 | Ga0157372_104746663 | 120 |
| 183 | 3300013307 | Ga0157372_10941356 | Ga0157372_109413562 | 120 |
| 184 | 3300013307 | Ga0157372_11668931 | Ga0157372_116689311 | 120 |
| 185 | 3300013307 | Ga0157372_12763264 | Ga0157372_127632641 | 120 |
| 186 | 3300013307 | Ga0157372_13059747 | Ga0157372_130597471 | 120 |
| 187 | 3300013308 | Ga0157375_13098924 | Ga0157375_130989241 | 120 |
| 188 | 3300014745 | Ga0157377_10235339 | Ga0157377_102353391 | 120 |
| 189 | 3300025321 | Ga0207656_10043348 | Ga0207656_100433482 | 120 |
| 190 | 3300025893 | Ga0207682_10381313 | Ga0207682_103813131 | 120 |
| 191 | 3300025904 | Ga0207647_10000631 | Ga0207647_100006318 | 120 |
| 192 | 3300025906 | Ga0207699_11371624 | Ga0207699_113716241 | 120 |
| 193 | 3300025920 | Ga0207649_10030254 | Ga0207649_100302543 | 120 |
| 194 | 3300025920 | Ga0207649_10115780 | Ga0207649_101157802 | 120 |
| 195 | 3300025920 | Ga0207649_11310748 | Ga0207649_113107481 | 120 |
| 196 | 3300025925 | Ga0207650_11222498 | Ga0207650_112224981 | 120 |
| 197 | 3300025926 | Ga0207659_10546507 | Ga0207659_105465072 | 120 |
| 198 | 3300025932 | Ga0207690_10077056 | Ga0207690_100770562 | 120 |
| 199 | 3300025940 | Ga0207691_10280931 | Ga0207691_102809312 | 120 |
| 200 | 3300025944 | Ga0207661_10013907 | Ga0207661_100139076 | 120 |
| 201 | 3300025945 | Ga0207679_10010234 | Ga0207679_100102344 | 120 |
| 202 | 3300026023 | Ga0207677_10176062 | Ga0207677_101760622 | 120 |
| 203 | 3300026041 | Ga0207639_10014093 | Ga0207639_100140932 | 120 |
| 204 | 3300026041 | Ga0207639_10395255 | Ga0207639_103952552 | 120 |
| 205 | 3300026089 | Ga0207648_10839511 | Ga0207648_108395112 | 120 |
| 206 | 3300026095 | Ga0207676_11010900 | Ga0207676_110109002 | 120 |
| 207 | 3300026116 | Ga0207674_10461249 | Ga0207674_104612492 | 120 |
| 208 | 3300026116 | Ga0207674_10486236 | Ga0207674_104862362 | 120 |
| 209 | 3300026142 | Ga0207698_10137739 | Ga0207698_101377392 | 120 |
| 210 | 3300026142 | Ga0207698_10587356 | Ga0207698_105873562 | 120 |
| 211 | 3300027360 | Ga0209969_1041694 | Ga0209969_10416942 | 120 |
| 212 | 3300031852 | Ga0307410_10775276 | Ga0307410_107752761 | 120 |
| 213 | 3300031911 | Ga0307412_10892053 | Ga0307412_108920531 | 120 |
| 214 | 3300032004 | Ga0307414_10077584 | Ga0307414_100775842 | 120 |
| 215 | 3300032004 | Ga0307414_10292078 | Ga0307414_102920782 | 120 |
| 216 | 3300032126 | Ga0307415_100835047 | Ga0307415_1008350471 | 120 |
| 217 | 3300037418 | Ga0395900_0348733 | Ga0395900_0348733_303_665 | 120 |
| 218 | 3300037466 | Ga0395898_0262695 | Ga0395898_0262695_217_579 | 120 |
| 219 | 3300037471 | Ga0395905_0008340 | Ga0395905_0008340_2209_2571 | 120 |
| 220 | 3300037471 | Ga0395905_0061061 | Ga0395905_0061061_2024_2386 | 120 |
| 221 | 3300039437 | Ga0436365_0701472 | Ga0436365_0701472_224_586 | 120 |
| 222 | 3300044684 | Ga0466966_0422811 | Ga0466966_0422811_158_520 | 120 |
| 223 | 3300049515 | Ga0501292_062512 | Ga0501292_062512_177_539 | 120 |
| 224 | 3300049515 | Ga0501292_067179 | Ga0501292_067179_42_404 | 120 |
| 225 | 3300049517 | Ga0501294_023354 | Ga0501294_023354_176_538 | 120 |
| 226 | 3300049520 | Ga0501297_055750 | Ga0501297_055750_163_525 | 120 |
| 227 | 3300049521 | Ga0501298_010434 | Ga0501298_010434_738_1100 | 120 |
| 228 | 3300049651 | Ga0501201_000834 | Ga0501201_000834_1846_2208 | 120 |
| 229 | 3300049653 | Ga0501206_001011 | Ga0501206_001011_1556_1918 | 120 |
| 230 | 3300049653 | Ga0501206_003305 | Ga0501206_003305_207_569 | 120 |
| 231 | 3300049654 | Ga0501207_032581 | Ga0501207_032581_463_825 | 120 |
| 232 | 3300049657 | Ga0501210_007348 | Ga0501210_007348_13_375 | 120 |
| 233 | 3300049661 | Ga0501217_000389 | Ga0501217_000389_1134_1496 | 120 |
| 234 | 3300049661 | Ga0501217_022559 | Ga0501217_022559_723_1085 | 120 |
| 235 | 3300049662 | Ga0501222_029785 | Ga0501222_029785_73_435 | 120 |
| 236 | 3300049663 | Ga0501223_003310 | Ga0501223_003310_2424_2786 | 120 |
| 237 | 3300049664 | Ga0501224_011301 | Ga0501224_011301_940_1302 | 120 |
| 238 | 3300049665 | Ga0501227_022377 | Ga0501227_022377_365_727 | 120 |
| 239 | 3300049668 | Ga0501233_020379 | Ga0501233_020379_666_1028 | 120 |
| 240 | 3300049668 | Ga0501233_131455 | Ga0501233_131455_35_397 | 120 |
| 241 | 3300049669 | Ga0501235_005238 | Ga0501235_005238_762_1124 | 120 |
| 242 | 3300049669 | Ga0501235_095244 | Ga0501235_095244_37_399 | 120 |
| 243 | 3300049670 | Ga0501236_023351 | Ga0501236_023351_392_754 | 120 |
| 244 | 3300049670 | Ga0501236_060368 | Ga0501236_060368_78_440 | 120 |
| 245 | 3300049672 | Ga0501239_045723 | Ga0501239_045723_221_583 | 120 |
| 246 | 3300049673 | Ga0501240_063566 | Ga0501240_063566_142_504 | 120 |
| 247 | 3300049673 | Ga0501240_090589 | Ga0501240_090589_48_410 | 120 |
| 248 | 3300049674 | Ga0501242_003117 | Ga0501242_003117_275_637 | 120 |
| 249 | 3300049674 | Ga0501242_004568 | Ga0501242_004568_985_1347 | 120 |
| 250 | 3300049674 | Ga0501242_011274 | Ga0501242_011274_126_488 | 120 |
| 251 | 3300049675 | Ga0501243_016237 | Ga0501243_016237_658_1020 | 120 |
| 252 | 3300049675 | Ga0501243_030475 | Ga0501243_030475_242_604 | 120 |
| 253 | 3300049676 | Ga0501246_044906 | Ga0501246_044906_147_509 | 120 |
| 254 | 3300049680 | Ga0501250_013374 | Ga0501250_013374_280_642 | 120 |
| 255 | 3300049681 | Ga0501251_013541 | Ga0501251_013541_343_705 | 120 |
| 256 | 3300049682 | Ga0501252_002982 | Ga0501252_002982_188_550 | 120 |
| 257 | 3300049683 | Ga0501253_007025 | Ga0501253_007025_897_1259 | 120 |
| 258 | 3300049683 | Ga0501253_083904 | Ga0501253_083904_18_380 | 120 |
| 259 | 3300049685 | Ga0501256_008231 | Ga0501256_008231_349_711 | 120 |
| 260 | 3300049686 | Ga0501257_006054 | Ga0501257_006054_734_1096 | 120 |
| 261 | 3300049686 | Ga0501257_054461 | Ga0501257_054461_147_509 | 120 |
| 262 | 3300049686 | Ga0501257_059892 | Ga0501257_059892_148_510 | 120 |
| 263 | 3300049688 | Ga0501259_000140 | Ga0501259_000140_7551_7913 | 120 |
| 264 | 3300049688 | Ga0501259_008172 | Ga0501259_008172_1105_1467 | 120 |
| 265 | 3300049690 | Ga0501261_034894 | Ga0501261_034894_152_514 | 120 |
| 266 | 3300049704 | Ga0501221_001556 | Ga0501221_001556_519_881 | 120 |
| 267 | 3300049705 | Ga0501225_0007459 | Ga0501225_0007459_1095_1457 | 120 |
| 268 | 3300049705 | Ga0501225_0093190 | Ga0501225_0093190_316_678 | 120 |
| 269 | 3300049706 | Ga0501229_008822 | Ga0501229_008822_687_1049 | 120 |
| 270 | 3300049707 | Ga0501234_002359 | Ga0501234_002359_1444_1806 | 120 |
| 271 | 3300049707 | Ga0501234_054510 | Ga0501234_054510_23_385 | 120 |
| 272 | 3300049708 | Ga0501245_001734 | Ga0501245_001734_547_909 | 120 |
| 273 | 3300049708 | Ga0501245_003425 | Ga0501245_003425_286_648 | 120 |
| 274 | 3300049757 | Ga0501232_023963 | Ga0501232_023963_408_770 | 120 |
| 275 | 3300049758 | Ga0501241_018069 | Ga0501241_018069_387_749 | 120 |
| 276 | 3300049765 | Ga0501268_059759 | Ga0501268_059759_354_716 | 120 |
| 277 | 3300049768 | Ga0501271_061595 | Ga0501271_061595_36_398 | 120 |
| 278 | 3300049772 | Ga0501275_086225 | Ga0501275_086225_142_504 | 120 |
| 279 | 3300049778 | Ga0501282_007908 | Ga0501282_007908_220_582 | 120 |
| 280 | 3300049851 | Ga0501212_011247 | Ga0501212_011247_487_849 | 120 |
| 281 | 3300025981 | Ga0207640_10340771 | Ga0207640_103407712 | 121 |
| 282 | 3300002459 | JGI24751J29686_10001619 | JGI24751J29686_100016192 | 123 |
| 283 | 3300003323 | rootH1_10322875 | rootH1_103228752 | 123 |
| 284 | 3300005288 | Ga0065714_10083424 | Ga0065714_100834243 | 123 |
| 285 | 3300005289 | Ga0065704_10849339 | Ga0065704_108493391 | 123 |
| 286 | 3300005290 | Ga0065712_10002727 | Ga0065712_100027273 | 123 |
| 287 | 3300005290 | Ga0065712_10016709 | Ga0065712_100167092 | 123 |
| 288 | 3300005290 | Ga0065712_10073585 | Ga0065712_100735853 | 123 |
| 289 | 3300005293 | Ga0065715_10226491 | Ga0065715_102264912 | 123 |
| 290 | 3300005330 | Ga0070690_100678802 | Ga0070690_1006788021 | 123 |
| 291 | 3300005331 | Ga0070670_100100598 | Ga0070670_1001005983 | 123 |
| 292 | 3300005331 | Ga0070670_100228187 | Ga0070670_1002281872 | 123 |
| 293 | 3300005331 | Ga0070670_100556429 | Ga0070670_1005564292 | 123 |
| 294 | 3300005331 | Ga0070670_100588249 | Ga0070670_1005882492 | 123 |
| 295 | 3300005334 | Ga0068869_100050190 | Ga0068869_1000501902 | 123 |
| 296 | 3300005334 | Ga0068869_100365803 | Ga0068869_1003658032 | 123 |
| 297 | 3300005334 | Ga0068869_101680686 | Ga0068869_1016806861 | 123 |
| 298 | 3300005335 | Ga0070666_10909623 | Ga0070666_109096231 | 123 |
| 299 | 3300005337 | Ga0070682_100782073 | Ga0070682_1007820732 | 123 |
| 300 | 3300005338 | Ga0068868_100671168 | Ga0068868_1006711682 | 123 |
| 301 | 3300005340 | Ga0070689_100250090 | Ga0070689_1002500902 | 123 |
| 302 | 3300005340 | Ga0070689_100362806 | Ga0070689_1003628062 | 123 |
| 303 | 3300005343 | Ga0070687_100534318 | Ga0070687_1005343181 | 123 |
| 304 | 3300005353 | Ga0070669_100431731 | Ga0070669_1004317312 | 123 |
| 305 | 3300005353 | Ga0070669_100467032 | Ga0070669_1004670322 | 123 |
| 306 | 3300005353 | Ga0070669_101960788 | Ga0070669_1019607881 | 123 |
| 307 | 3300005354 | Ga0070675_100058212 | Ga0070675_1000582124 | 123 |
| 308 | 3300005354 | Ga0070675_100626228 | Ga0070675_1006262282 | 123 |
| 309 | 3300005356 | Ga0070674_100137704 | Ga0070674_1001377042 | 123 |
| 310 | 3300005364 | Ga0070673_100056657 | Ga0070673_1000566573 | 123 |
| 311 | 3300005365 | Ga0070688_100020367 | Ga0070688_1000203672 | 123 |
| 312 | 3300005365 | Ga0070688_100188729 | Ga0070688_1001887292 | 123 |
| 313 | 3300005365 | Ga0070688_101623808 | Ga0070688_1016238081 | 123 |
| 314 | 3300005367 | Ga0070667_100329239 | Ga0070667_1003292391 | 123 |
| 315 | 3300005438 | Ga0070701_10022901 | Ga0070701_100229014 | 123 |
| 316 | 3300005440 | Ga0070705_101698994 | Ga0070705_1016989941 | 123 |
| 317 | 3300005441 | Ga0070700_100103034 | Ga0070700_1001030343 | 123 |
| 318 | 3300005441 | Ga0070700_100497553 | Ga0070700_1004975531 | 123 |
| 319 | 3300005444 | Ga0070694_101012650 | Ga0070694_1010126502 | 123 |
| 320 | 3300005456 | Ga0070678_101763674 | Ga0070678_1017636741 | 123 |
| 321 | 3300005459 | Ga0068867_100021335 | Ga0068867_1000213351 | 123 |
| 322 | 3300005466 | Ga0070685_10003936 | Ga0070685_100039366 | 123 |
| 323 | 3300005466 | Ga0070685_10103395 | Ga0070685_101033951 | 123 |
| 324 | 3300005466 | Ga0070685_11152644 | Ga0070685_111526441 | 123 |
| 325 | 3300005471 | Ga0070698_100032750 | Ga0070698_1000327503 | 123 |
| 326 | 3300005539 | Ga0068853_100007200 | Ga0068853_1000072006 | 123 |
| 327 | 3300005539 | Ga0068853_100223470 | Ga0068853_1002234703 | 123 |
| 328 | 3300005543 | Ga0070672_100374180 | Ga0070672_1003741802 | 123 |
| 329 | 3300005549 | Ga0070704_100778286 | Ga0070704_1007782862 | 123 |
| 330 | 3300005577 | Ga0068857_101282396 | Ga0068857_1012823961 | 123 |
| 331 | 3300005578 | Ga0068854_102231297 | Ga0068854_1022312971 | 123 |
| 332 | 3300005616 | Ga0068852_100631915 | Ga0068852_1006319152 | 123 |
| 333 | 3300005617 | Ga0068859_100134619 | Ga0068859_1001346191 | 123 |
| 334 | 3300005617 | Ga0068859_100148289 | Ga0068859_1001482894 | 123 |
| 335 | 3300005617 | Ga0068859_100223816 | Ga0068859_1002238162 | 123 |
| 336 | 3300005617 | Ga0068859_100779408 | Ga0068859_1007794081 | 123 |
| 337 | 3300005617 | Ga0068859_100921373 | Ga0068859_1009213732 | 123 |
| 338 | 3300005618 | Ga0068864_100063729 | Ga0068864_1000637293 | 123 |
| 339 | 3300005719 | Ga0068861_100140344 | Ga0068861_1001403442 | 123 |
| 340 | 3300005719 | Ga0068861_101175228 | Ga0068861_1011752282 | 123 |
| 341 | 3300005840 | Ga0068870_10138094 | Ga0068870_101380942 | 123 |
| 342 | 3300005841 | Ga0068863_100038538 | Ga0068863_1000385383 | 123 |
| 343 | 3300005841 | Ga0068863_100191310 | Ga0068863_1001913103 | 123 |
| 344 | 3300005841 | Ga0068863_100582538 | Ga0068863_1005825382 | 123 |
| 345 | 3300005842 | Ga0068858_100211806 | Ga0068858_1002118064 | 123 |
| 346 | 3300005843 | Ga0068860_101841123 | Ga0068860_1018411232 | 123 |
| 347 | 3300005843 | Ga0068860_101932935 | Ga0068860_1019329351 | 123 |
| 348 | 3300005844 | Ga0068862_100583034 | Ga0068862_1005830342 | 123 |
| 349 | 3300006195 | Ga0075366_10045238 | Ga0075366_100452382 | 123 |
| 350 | 3300006195 | Ga0075366_10091700 | Ga0075366_100917003 | 123 |
| 351 | 3300006195 | Ga0075366_10228791 | Ga0075366_102287911 | 123 |
| 352 | 3300006237 | Ga0097621_100010162 | Ga0097621_1000101624 | 123 |
| 353 | 3300006237 | Ga0097621_101072204 | Ga0097621_1010722042 | 123 |
| 354 | 3300006844 | Ga0075428_100026453 | Ga0075428_1000264535 | 123 |
| 355 | 3300006846 | Ga0075430_100262442 | Ga0075430_1002624422 | 123 |
| 356 | 3300006847 | Ga0075431_100073802 | Ga0075431_1000738023 | 123 |
| 357 | 3300006880 | Ga0075429_100045901 | Ga0075429_1000459014 | 123 |
| 358 | 3300006931 | Ga0097620_100134629 | Ga0097620_1001346291 | 123 |
| 359 | 3300006931 | Ga0097620_100148296 | Ga0097620_1001482961 | 123 |
| 360 | 3300006931 | Ga0097620_100223813 | Ga0097620_1002238132 | 123 |
| 361 | 3300006931 | Ga0097620_100779399 | Ga0097620_1007793991 | 123 |
| 362 | 3300006931 | Ga0097620_100921262 | Ga0097620_1009212621 | 123 |
| 363 | 3300009094 | Ga0111539_10683122 | Ga0111539_106831222 | 123 |
| 364 | 3300009101 | Ga0105247_10000640 | Ga0105247_1000064021 | 123 |
| 365 | 3300009148 | Ga0105243_11529585 | Ga0105243_115295851 | 123 |
| 366 | 3300009176 | Ga0105242_10034920 | Ga0105242_100349203 | 123 |
| 367 | 3300009176 | Ga0105242_10166907 | Ga0105242_101669072 | 123 |
| 368 | 3300009176 | Ga0105242_13013095 | Ga0105242_130130951 | 123 |
| 369 | 3300009553 | Ga0105249_10002821 | Ga0105249_100028215 | 123 |
| 370 | 3300009553 | Ga0105249_10005620 | Ga0105249_100056202 | 123 |
| 371 | 3300009553 | Ga0105249_10009722 | Ga0105249_100097222 | 123 |
| 372 | 3300009553 | Ga0105249_10027485 | Ga0105249_100274854 | 123 |
| 373 | 3300009553 | Ga0105249_10094029 | Ga0105249_100940292 | 123 |
| 374 | 3300009553 | Ga0105249_11007097 | Ga0105249_110070971 | 123 |
| 375 | 3300011119 | Ga0105246_10883907 | Ga0105246_108839071 | 123 |
| 376 | 3300013306 | Ga0163162_10072994 | Ga0163162_100729942 | 123 |
| 377 | 3300013306 | Ga0163162_10451852 | Ga0163162_104518522 | 123 |
| 378 | 3300013308 | Ga0157375_10044031 | Ga0157375_100440313 | 123 |
| 379 | 3300013308 | Ga0157375_10903592 | Ga0157375_109035922 | 123 |
| 380 | 3300014325 | Ga0163163_10112836 | Ga0163163_101128362 | 123 |
| 381 | 3300014326 | Ga0157380_10009854 | Ga0157380_100098544 | 123 |
| 382 | 3300014745 | Ga0157377_10000850 | Ga0157377_100008508 | 123 |
| 383 | 3300014745 | Ga0157377_10831640 | Ga0157377_108316401 | 123 |
| 384 | 3300014968 | Ga0157379_10860232 | Ga0157379_108602321 | 123 |
| 385 | 3300014969 | Ga0157376_10177830 | Ga0157376_101778302 | 123 |
| 386 | 3300014969 | Ga0157376_11236227 | Ga0157376_112362272 | 123 |
| 387 | 3300014969 | Ga0157376_11279825 | Ga0157376_112798252 | 123 |
| 388 | 3300014969 | Ga0157376_11833067 | Ga0157376_118330672 | 123 |
| 389 | 3300017792 | Ga0163161_10040415 | Ga0163161_100404153 | 123 |
| 390 | 3300017792 | Ga0163161_10316739 | Ga0163161_103167391 | 123 |
| 391 | 3300017792 | Ga0163161_10734993 | Ga0163161_107349931 | 123 |
| 392 | 3300025315 | Ga0207697_10193836 | Ga0207697_101938362 | 123 |
| 393 | 3300025893 | Ga0207682_10375984 | Ga0207682_103759842 | 123 |
| 394 | 3300025900 | Ga0207710_10230926 | Ga0207710_102309262 | 123 |
| 395 | 3300025903 | Ga0207680_10921194 | Ga0207680_109211941 | 123 |
| 396 | 3300025908 | Ga0207643_10042108 | Ga0207643_100421082 | 123 |
| 397 | 3300025918 | Ga0207662_10704543 | Ga0207662_107045432 | 123 |
| 398 | 3300025925 | Ga0207650_10024753 | Ga0207650_100247534 | 123 |
| 399 | 3300025925 | Ga0207650_10090506 | Ga0207650_100905062 | 123 |
| 400 | 3300025925 | Ga0207650_10291363 | Ga0207650_102913632 | 123 |
| 401 | 3300025925 | Ga0207650_10345411 | Ga0207650_103454112 | 123 |
| 402 | 3300025926 | Ga0207659_10058933 | Ga0207659_100589333 | 123 |
| 403 | 3300025926 | Ga0207659_10522240 | Ga0207659_105222402 | 123 |
| 404 | 3300025931 | Ga0207644_10573251 | Ga0207644_105732512 | 123 |
| 405 | 3300025934 | Ga0207686_10002295 | Ga0207686_100022957 | 123 |
| 406 | 3300025936 | Ga0207670_10011943 | Ga0207670_100119432 | 123 |
| 407 | 3300025936 | Ga0207670_10012135 | Ga0207670_100121353 | 123 |
| 408 | 3300025937 | Ga0207669_10417077 | Ga0207669_104170772 | 123 |
| 409 | 3300025938 | Ga0207704_10704473 | Ga0207704_107044731 | 123 |
| 410 | 3300025940 | Ga0207691_10011763 | Ga0207691_100117636 | 123 |
| 411 | 3300025942 | Ga0207689_10026995 | Ga0207689_100269953 | 123 |
| 412 | 3300025942 | Ga0207689_10366816 | Ga0207689_103668162 | 123 |
| 413 | 3300025945 | Ga0207679_11995811 | Ga0207679_119958111 | 123 |
| 414 | 3300025960 | Ga0207651_10489515 | Ga0207651_104895152 | 123 |
| 415 | 3300025961 | Ga0207712_10012625 | Ga0207712_100126253 | 123 |
| 416 | 3300025961 | Ga0207712_10036938 | Ga0207712_100369384 | 123 |
| 417 | 3300025961 | Ga0207712_10038726 | Ga0207712_100387262 | 123 |
| 418 | 3300025961 | Ga0207712_10337853 | Ga0207712_103378532 | 123 |
| 419 | 3300025961 | Ga0207712_10366597 | Ga0207712_103665972 | 123 |
| 420 | 3300025972 | Ga0207668_10065467 | Ga0207668_100654673 | 123 |
| 421 | 3300025981 | Ga0207640_12203939 | Ga0207640_122039391 | 123 |
| 422 | 3300025986 | Ga0207658_10075665 | Ga0207658_100756652 | 123 |
| 423 | 3300026023 | Ga0207677_10171462 | Ga0207677_101714622 | 123 |
| 424 | 3300026041 | Ga0207639_10457222 | Ga0207639_104572222 | 123 |
| 425 | 3300026075 | Ga0207708_10569129 | Ga0207708_105691292 | 123 |
| 426 | 3300026088 | Ga0207641_10032262 | Ga0207641_100322623 | 123 |
| 427 | 3300026088 | Ga0207641_10523637 | Ga0207641_105236372 | 123 |
| 428 | 3300026089 | Ga0207648_10002286 | Ga0207648_100022868 | 123 |
| 429 | 3300026089 | Ga0207648_10862815 | Ga0207648_108628151 | 123 |
| 430 | 3300026095 | Ga0207676_10058081 | Ga0207676_100580811 | 123 |
| 431 | 3300026095 | Ga0207676_11624698 | Ga0207676_116246981 | 123 |
| 432 | 3300026095 | Ga0207676_12580218 | Ga0207676_125802181 | 123 |
| 433 | 3300026116 | Ga0207674_10391447 | Ga0207674_103914472 | 123 |
| 434 | 3300026116 | Ga0207674_10591515 | Ga0207674_105915151 | 123 |
| 435 | 3300026118 | Ga0207675_100183166 | Ga0207675_1001831662 | 123 |
| 436 | 3300026118 | Ga0207675_100194739 | Ga0207675_1001947393 | 123 |
| 437 | 3300026118 | Ga0207675_100350934 | Ga0207675_1003509342 | 123 |
| 438 | 3300026121 | Ga0207683_10095532 | Ga0207683_100955324 | 123 |
| 439 | 3300026142 | Ga0207698_11066291 | Ga0207698_110662912 | 123 |
| 440 | 3300028380 | Ga0268265_10126162 | Ga0268265_101261622 | 123 |
| 441 | 3300028380 | Ga0268265_10530885 | Ga0268265_105308851 | 123 |
| 442 | 3300028380 | Ga0268265_10564875 | Ga0268265_105648752 | 123 |
| 443 | 3300028381 | Ga0268264_10125691 | Ga0268264_101256913 | 123 |
| 444 | 3300028381 | Ga0268264_10909242 | Ga0268264_109092422 | 123 |
| 445 | 3300041410 | Ga0439461_0045037 | Ga0439461_0045037_477_848 | 123 |
| 446 | 3300041413 | Ga0439465_0231858 | Ga0439465_0231858_24_395 | 123 |
| 447 | 3300041492 | Ga0451835_0593670 | Ga0451835_0593670_32_403 | 123 |
| 448 | 3300042002 | Ga0439442_026709 | Ga0439442_026709_21_392 | 123 |
| 449 | 3300042004 | Ga0439445_0051755 | Ga0439445_0051755_436_807 | 123 |
| 450 | 3300042007 | Ga0439449_0117790 | Ga0439449_0117790_294_665 | 123 |
| 451 | 3300042014 | Ga0439457_061210 | Ga0439457_061210_167_538 | 123 |
| 452 | 3300042015 | Ga0439462_0014193 | Ga0439462_0014193_1470_1841 | 123 |
| 453 | 3300042125 | Ga0450923_016511 | Ga0450923_016511_870_1241 | 123 |
| 454 | 3300042125 | Ga0450923_026516 | Ga0450923_026516_156_527 | 123 |
| 455 | 3300042131 | Ga0450894_011316 | Ga0450894_011316_747_1118 | 123 |
| 456 | 3300042134 | Ga0450898_000876 | Ga0450898_000876_2729_3100 | 123 |
| 457 | 3300042135 | Ga0450899_006909 | Ga0450899_006909_297_668 | 123 |
| 458 | 3300042435 | Ga0439434_0003068 | Ga0439434_0003068_384_755 | 123 |
| 459 | 3300046523 | Ga0495644_0117958 | Ga0495644_0117958_335_706 | 123 |
| 460 | 3300046537 | Ga0495598_0046006 | Ga0495598_0046006_57_428 | 123 |
| 461 | 3300046691 | Ga0495670_0555725 | Ga0495670_0555725_124_495 | 123 |
| 462 | 3300047320 | Ga0495672_0520976 | Ga0495672_0520976_49_420 | 123 |
| 463 | 3300047472 | Ga0495686_0018868 | Ga0495686_0018868_2757_3128 | 123 |
| 464 | 3300049569 | Ga0501032_0005429 | Ga0501032_0005429_6989_7360 | 123 |
| 465 | 3300049571 | Ga0501034_0001294 | Ga0501034_0001294_25701_26072 | 123 |
| 466 | 3300049572 | Ga0501036_0002885 | Ga0501036_0002885_2114_2485 | 123 |
| 467 | 3300049573 | Ga0501037_0024522 | Ga0501037_0024522_1388_1759 | 123 |
| 468 | 3300049574 | Ga0501038_0160650 | Ga0501038_0160650_777_1148 | 123 |
| 469 | 3300049575 | Ga0501039_0034378 | Ga0501039_0034378_1528_1899 | 123 |
| 470 | 3300049579 | Ga0501043_0021899 | Ga0501043_0021899_2588_2959 | 123 |
| 471 | 3300049580 | Ga0501046_0019988 | Ga0501046_0019988_3375_3746 | 123 |
| 472 | 3300049581 | Ga0501047_0026380 | Ga0501047_0026380_935_1306 | 123 |
| 473 | 3300049584 | Ga0501068_0296254 | Ga0501068_0296254_645_1016 | 123 |
| 474 | 3300049586 | Ga0501070_0379301 | Ga0501070_0379301_61_432 | 123 |
| 475 | 3300049589 | Ga0501073_0005146 | Ga0501073_0005146_6585_6956 | 123 |
| 476 | 3300049590 | Ga0501074_0034770 | Ga0501074_0034770_2504_2875 | 123 |
| 477 | 3300049741 | Ga0501079_0106114 | Ga0501079_0106114_700_1071 | 123 |
| 478 | 3300049742 | Ga0501080_0082434 | Ga0501080_0082434_629_1000 | 123 |
| 479 | 3300049744 | Ga0501083_0045805 | Ga0501083_0045805_1825_2196 | 123 |
| 480 | 3300049822 | Ga0501035_0008435 | Ga0501035_0008435_3590_3961 | 123 |
| 481 | 3300049823 | Ga0501044_0103815 | Ga0501044_0103815_1951_2322 | 123 |
| 482 | 3300050493 | nmdc:mga0k408_153361_c1 | nmdc:mga0k408_153361_c1_984_1355 | 123 |
| 483 | 3300050493 | nmdc:mga0k408_180857_c1 | nmdc:mga0k408_180857_c1_162_533 | 123 |
| 484 | 3300050493 | nmdc:mga0k408_491049_c1 | nmdc:mga0k408_491049_c1_277_648 | 123 |
| 485 | 3300050508 | nmdc:mga09592_62139_c1 | nmdc:mga09592_62139_c1_458_829 | 123 |
| 486 | 3300050509 | nmdc:mga0qj67_205728_c1 | nmdc:mga0qj67_205728_c1_714_1085 | 123 |
| 487 | 3300050510 | nmdc:mga06r32_727338_c1 | nmdc:mga06r32_727338_c1_427_798 | 123 |
| 488 | 3300050511 | nmdc:mga08y16_944207_c1 | nmdc:mga08y16_944207_c1_65_436 | 123 |
| 489 | 3300053730 | Ga0500645_198032 | Ga0500645_198032_141_512 | 123 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7ne9-assembly1.cif.gz_CCC | a single sensor controls large variations in zinc quotas in a marine cyanobacterium | 0.9469 | 3 | 66 |
| 7ne9-assembly1.cif.gz_DDD | a single sensor controls large variations in zinc quotas in a marine cyanobacterium | 0.9326 | 3 | 66 |
| 4lb5-assembly1.cif.gz_B | crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) | 0.919 | 6 | 68 |
| 6j0e-assembly1.cif.gz_B | structures of two arsr as(iii)-responsive repressors: implications for the mechanism of derepression | 0.8996 | 5 | 66 |
| 5j6x-assembly2.cif.gz_B | crystal structure of the apo-zalpha of zebrafish pkz | 0.8993 | 6 | 68 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4lb5A00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9438 | 6 | 67 | 1.10.10.10 |
| 4lb5A00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9281 | 6 | 67 | 1.10.10.10 |
| af_Q4DZU8_467_618_3.30.230.130 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Cullin; Chain C, Domain 2 | 0.9253 | 18 | 66 | 3.30.230.130 |
| af_Q57824_147_206_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9191 | 4 | 65 | 1.10.10.10 |
| 4lb5B00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.919 | 6 | 68 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-H1DIA1-F1-model_v4 | Penicillinase repressor | 0.9812 | 1 | 74 |
GO:0003677
GO:0005737 GO:0045892 |
| AF-H1DIA1-F1-model_v4 | Penicillinase repressor | 0.9559 | 1 | 74 |
GO:0003677
GO:0005737 GO:0045892 |
| AF-A0A519ZH08-F1-model_v4 | BlaI/MecI/CopY family transcriptional regulator | 0.9432 | 1 | 68 |
GO:0003677
GO:0005737 GO:0045892 |
| AF-A0A7J7AZU7-F1-model_v4 | deleted | 0.9312 | 1 | 81 |
|
| AF-A0A2N2VVW2-F1-model_v4 | Transcriptional regulator | 0.93 | 1 | 73 |
GO:0003677
GO:0005737 GO:0045892 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar