F453790

General Info

Members Datasets Scaffolds Average Seq Length
489 239 489 122

Family's Representative Sequence

Representative Sequence 3300025945|Ga0207679_11995811|Ga0207679_119958111
Length 143
Sequence MKTLTKAEEQVMQVIWKLKEGFIRDIMEATPLPKPHQNTVATILKILVEKEFVGVRVYGRQHQYYPLMSKDAYSKASMKSLVKSYFGGSFSDAVSFMVKENNISLEGGGVFSNREHSIAHFLIKEAEEAKAKLEEVGASVEVK

Samples

Sample ID Description Type Environment
1 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
65 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
78 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
79 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
80 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
81 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
88 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
92 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
147 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
148 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
149 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
150 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
151 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
152 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
153 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
154 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
155 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
156 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
157 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
158 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
159 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
160 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
161 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
162 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
163 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
164 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
165 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
166 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
167 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
168 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
169 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
170 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
171 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
172 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
173 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
174 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
175 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
176 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
177 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
178 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
179 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
189 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
190 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
191 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
192 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
193 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
194 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
195 3300049657 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought Metagenome Rhizosphere
196 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
197 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
198 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
199 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
200 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
201 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
202 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
203 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
204 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
205 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
206 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
207 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
208 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
209 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
210 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
211 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
212 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
213 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
214 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
215 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
216 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
217 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
218 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
219 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
220 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
221 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
222 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
223 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
224 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
225 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
226 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
227 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
228 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
229 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
230 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
231 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
234 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
235 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
236 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
237 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
238 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
239 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.43
Nodule 0
Rhizoplane 0
Rhizosphere 97.96
Stem 0
Stem Tuber 0
Unclassified 0.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24751J29686_10001619 3300002459 Unclassified 4649
2 rootH1_10322875 3300003323 Bacteria 1501
3 Ga0065714_10083424 3300005288 Bacteria 2250
4 Ga0065704_10849339 3300005289 Bacteria 509
5 Ga0065712_10002727 3300005290 Bacteria 5996
6 Ga0065712_10016709 3300005290 Bacteria 2290
7 Ga0065712_10073585 3300005290 Bacteria 4332
8 Ga0065715_10226491 3300005293 Bacteria 1250
9 Ga0070658_11100291 3300005327 Bacteria 691
10 Ga0070683_100036619 3300005329 Bacteria 4490
11 Ga0070683_101065820 3300005329 Bacteria 776
12 Ga0070690_100678802 3300005330 Bacteria 789
13 Ga0070670_100038368 3300005331 Bacteria 4119
14 Ga0070670_100100598 3300005331 Bacteria 2489
15 Ga0070670_100228187 3300005331 Bacteria 1620
16 Ga0070670_100556429 3300005331 Unclassified 1024
17 Ga0070670_100588249 3300005331 Unclassified 995
18 Ga0070670_100811831 3300005331 Unclassified 845
19 Ga0068869_100050190 3300005334 Bacteria 3023
20 Ga0068869_100365803 3300005334 Bacteria 1179
21 Ga0068869_101680686 3300005334 Bacteria 566
22 Ga0070666_10909623 3300005335 Bacteria 651
23 Ga0070680_100036976 3300005336 Bacteria 3945
24 Ga0070680_101055103 3300005336 Bacteria 702
25 Ga0070682_100782073 3300005337 Bacteria 774
26 Ga0068868_100671168 3300005338 Bacteria 925
27 Ga0070660_100160370 3300005339 Unclassified 1812
28 Ga0070660_100258811 3300005339 Bacteria 1421
29 Ga0070660_100518906 3300005339 Bacteria 992
30 Ga0070660_101863568 3300005339 Bacteria 512
31 Ga0070689_100250090 3300005340 Bacteria 1462
32 Ga0070689_100362806 3300005340 Bacteria 1217
33 Ga0070687_100523505 3300005343 Bacteria 802
34 Ga0070687_100534318 3300005343 Bacteria 795
35 Ga0070661_100041139 3300005344 Unclassified 3372
36 Ga0070661_100045609 3300005344 Bacteria 3205
37 Ga0070661_100578076 3300005344 Unclassified 906
38 Ga0070669_100290039 3300005353 Bacteria 1313
39 Ga0070669_100431731 3300005353 Bacteria 1083
40 Ga0070669_100467032 3300005353 Bacteria 1042
41 Ga0070669_101883556 3300005353 Unclassified 522
42 Ga0070669_101960788 3300005353 Bacteria 512
43 Ga0070675_100058212 3300005354 Bacteria 3187
44 Ga0070675_100626228 3300005354 Bacteria 977
45 Ga0070671_100342650 3300005355 Unclassified 1275
46 Ga0070674_100137704 3300005356 Bacteria 1828
47 Ga0070673_100056657 3300005364 Bacteria 3093
48 Ga0070688_100020367 3300005365 Bacteria 3856
49 Ga0070688_100188729 3300005365 Bacteria 1434
50 Ga0070688_101623808 3300005365 Bacteria 528
51 Ga0070659_100014169 3300005366 Bacteria 5952
52 Ga0070659_100016720 3300005366 Bacteria 5511
53 Ga0070667_100035440 3300005367 Bacteria 4180
54 Ga0070667_100329239 3300005367 Bacteria 1380
55 Ga0070714_101962302 3300005435 Bacteria 571
56 Ga0070701_10022901 3300005438 Bacteria 3001
57 Ga0070705_101698994 3300005440 Bacteria 533
58 Ga0070700_100103034 3300005441 Bacteria 1884
59 Ga0070700_100497553 3300005441 Bacteria 937
60 Ga0070694_101012650 3300005444 Bacteria 690
61 Ga0070678_101763674 3300005456 Unclassified 583
62 Ga0070681_10082740 3300005458 Bacteria 3164
63 Ga0070681_10238608 3300005458 Bacteria 1732
64 Ga0070681_10553907 3300005458 Bacteria 1064
65 Ga0068867_100021335 3300005459 Bacteria 4621
66 Ga0068867_100219973 3300005459 Bacteria 1530
67 Ga0068867_100681548 3300005459 Bacteria 905
68 Ga0070685_10003936 3300005466 Bacteria 7503
69 Ga0070685_10103395 3300005466 Bacteria 1743
70 Ga0070685_11152644 3300005466 Unclassified 587
71 Ga0070698_100032750 3300005471 Bacteria 5382
72 Ga0070679_100001371 3300005530 Bacteria 21479
73 Ga0070679_100094725 3300005530 Bacteria 2973
74 Ga0070679_100214555 3300005530 Unclassified 1887
75 Ga0070679_100589924 3300005530 Bacteria 1055
76 Ga0070679_101554355 3300005530 Bacteria 609
77 Ga0070684_100008197 3300005535 Bacteria 8163
78 Ga0070684_100973390 3300005535 Bacteria 796
79 Ga0068853_100007200 3300005539 Bacteria 8907
80 Ga0068853_100067705 3300005539 Bacteria 3103
81 Ga0068853_100195406 3300005539 Bacteria 1840
82 Ga0068853_100203552 3300005539 Bacteria 1802
83 Ga0068853_100223470 3300005539 Bacteria 1721
84 Ga0068853_100510311 3300005539 Unclassified 1136
85 Ga0068853_101288362 3300005539 Bacteria 706
86 Ga0070672_100374180 3300005543 Bacteria 1217
87 Ga0070672_101159279 3300005543 Bacteria 688
88 Ga0070686_100497594 3300005544 Unclassified 945
89 Ga0070686_101275370 3300005544 Unclassified 613
90 Ga0070665_100927238 3300005548 Bacteria 883
91 Ga0070704_100778286 3300005549 Bacteria 854
92 Ga0068855_100119666 3300005563 Bacteria 3015
93 Ga0068855_100168961 3300005563 Bacteria 2477
94 Ga0068855_101562404 3300005563 Bacteria 676
95 Ga0070664_100002996 3300005564 Bacteria 13660
96 Ga0068857_100167706 3300005577 Bacteria 1995
97 Ga0068857_100345204 3300005577 Bacteria 1378
98 Ga0068857_101282396 3300005577 Bacteria 711
99 Ga0068854_100481228 3300005578 Unclassified 1042
100 Ga0068854_101608575 3300005578 Bacteria 592
101 Ga0068854_102231297 3300005578 Unclassified 507
102 Ga0068856_100100554 3300005614 Bacteria 2884
103 Ga0068852_100004095 3300005616 Bacteria 10264
104 Ga0068852_100005706 3300005616 Bacteria 8928
105 Ga0068852_100337204 3300005616 Unclassified 1468
106 Ga0068852_100631915 3300005616 Bacteria 1077
107 Ga0068859_100134619 3300005617 Bacteria 2543
108 Ga0068859_100148289 3300005617 Bacteria 2421
109 Ga0068859_100223816 3300005617 Bacteria 1969
110 Ga0068859_100336147 3300005617 Bacteria 1605
111 Ga0068859_100779408 3300005617 Bacteria 1044
112 Ga0068859_100921373 3300005617 Bacteria 958
113 Ga0068864_100063729 3300005618 Bacteria 3195
114 Ga0068864_100068118 3300005618 Bacteria 3091
115 Ga0068861_100140344 3300005719 Bacteria 1971
116 Ga0068861_100446128 3300005719 Unclassified 1158
117 Ga0068861_101163888 3300005719 Unclassified 744
118 Ga0068861_101175228 3300005719 Unclassified 741
119 Ga0068851_10050052 3300005834 Unclassified 2121
120 Ga0068870_10138094 3300005840 Bacteria 1423
121 Ga0068870_10284915 3300005840 Unclassified 1037
122 Ga0068863_100038538 3300005841 Bacteria 4547
123 Ga0068863_100191310 3300005841 Bacteria 1966
124 Ga0068863_100582538 3300005841 Bacteria 1106
125 Ga0068863_100893018 3300005841 Bacteria 889
126 Ga0068858_100211806 3300005842 Bacteria 1834
127 Ga0068860_100014531 3300005843 Bacteria 7703
128 Ga0068860_100152717 3300005843 Bacteria 2224
129 Ga0068860_100835875 3300005843 Unclassified 935
130 Ga0068860_101841123 3300005843 Unclassified 627
131 Ga0068860_101932935 3300005843 Bacteria 612
132 Ga0068862_100583034 3300005844 Bacteria 1071
133 Ga0075366_10045238 3300006195 Bacteria 2609
134 Ga0075366_10091700 3300006195 Bacteria 1820
135 Ga0075366_10228791 3300006195 Bacteria 1133
136 Ga0097621_100010162 3300006237 Bacteria 6871
137 Ga0097621_101072204 3300006237 Bacteria 755
138 Ga0068871_100832504 3300006358 Bacteria 852
139 Ga0068871_101990468 3300006358 Bacteria 553
140 Ga0075428_100026453 3300006844 Bacteria 6422
141 Ga0075430_100262442 3300006846 Bacteria 1430
142 Ga0075431_100073802 3300006847 Bacteria 3520
143 Ga0075429_100045901 3300006880 Bacteria 3801
144 Ga0097620_100134629 3300006931 Bacteria 2543
145 Ga0097620_100148296 3300006931 Bacteria 2421
146 Ga0097620_100223813 3300006931 Bacteria 1969
147 Ga0097620_100336133 3300006931 Bacteria 1605
148 Ga0097620_100779399 3300006931 Bacteria 1044
149 Ga0097620_100921262 3300006931 Bacteria 958
150 Ga0105251_10412929 3300009011 Bacteria 622
151 Ga0111539_10683122 3300009094 Bacteria 1195
152 Ga0105247_10000640 3300009101 Bacteria 28018
153 Ga0105243_11529585 3300009148 Unclassified 692
154 Ga0105241_10053700 3300009174 Bacteria 3082
155 Ga0105241_10293154 3300009174 Bacteria 1394
156 Ga0105242_10034920 3300009176 Bacteria 4031
157 Ga0105242_10166907 3300009176 Bacteria 1932
158 Ga0105242_13013095 3300009176 Bacteria 521
159 Ga0105237_10158080 3300009545 Bacteria 2264
160 Ga0105249_10002821 3300009553 Bacteria 14998
161 Ga0105249_10005620 3300009553 Bacteria 10847
162 Ga0105249_10009722 3300009553 Bacteria 8428
163 Ga0105249_10027485 3300009553 Bacteria 5133
164 Ga0105249_10094029 3300009553 Bacteria 2809
165 Ga0105249_10376527 3300009553 Bacteria 1445
166 Ga0105249_11007097 3300009553 Unclassified 902
167 Ga0105239_10010402 3300010375 Bacteria 10409
168 Ga0105246_10883907 3300011119 Bacteria 800
169 Ga0157373_10010357 3300013100 Bacteria 6864
170 Ga0157373_10048108 3300013100 Bacteria 3041
171 Ga0157371_10001525 3300013102 Bacteria 23896
172 Ga0157371_10011091 3300013102 Bacteria 6978
173 Ga0157371_10035442 3300013102 Unclassified 3575
174 Ga0157371_10040227 3300013102 Bacteria 3340
175 Ga0157371_10080418 3300013102 Bacteria 2308
176 Ga0157371_10180449 3300013102 Bacteria 1510
177 Ga0157371_10240209 3300013102 Bacteria 1303
178 Ga0157371_10240471 3300013102 Bacteria 1302
179 Ga0157371_10287936 3300013102 Bacteria 1187
180 Ga0157371_10312967 3300013102 Unclassified 1138
181 Ga0157371_10325460 3300013102 Bacteria 1116
182 Ga0157371_10451987 3300013102 Bacteria 945
183 Ga0157371_10462747 3300013102 Bacteria 933
184 Ga0157371_10671711 3300013102 Bacteria 774
185 Ga0157371_11095214 3300013102 Bacteria 611
186 Ga0157371_11125522 3300013102 Bacteria 603
187 Ga0157370_10000405 3300013104 Bacteria 54383
188 Ga0157370_10056705 3300013104 Bacteria 3728
189 Ga0157370_10173003 3300013104 Bacteria 2007
190 Ga0157370_10408255 3300013104 Bacteria 1250
191 Ga0157370_10884935 3300013104 Unclassified 811
192 Ga0157370_10990339 3300013104 Bacteria 761
193 Ga0157370_11019795 3300013104 Bacteria 749
194 Ga0157369_10015578 3300013105 Bacteria 8567
195 Ga0157369_10099420 3300013105 Bacteria 3101
196 Ga0157369_10116752 3300013105 Bacteria 2833
197 Ga0157369_10210068 3300013105 Bacteria 2040
198 Ga0157374_10060543 3300013296 Unclassified 3543
199 Ga0157374_10847877 3300013296 Bacteria 930
200 Ga0157374_12038300 3300013296 Unclassified 600
201 Ga0163162_10072994 3300013306 Bacteria 3487
202 Ga0163162_10419275 3300013306 Bacteria 1471
203 Ga0163162_10451852 3300013306 Bacteria 1417
204 Ga0157372_10015792 3300013307 Bacteria 8099
205 Ga0157372_10061447 3300013307 Bacteria 4207
206 Ga0157372_10091821 3300013307 Bacteria 3453
207 Ga0157372_10147832 3300013307 Bacteria 2710
208 Ga0157372_10165541 3300013307 Bacteria 2557
209 Ga0157372_10183084 3300013307 Bacteria 2425
210 Ga0157372_10184092 3300013307 Bacteria 2419
211 Ga0157372_10392177 3300013307 Bacteria 1618
212 Ga0157372_10434674 3300013307 Bacteria 1530
213 Ga0157372_10474666 3300013307 Bacteria 1458
214 Ga0157372_10827790 3300013307 Unclassified 1075
215 Ga0157372_10941356 3300013307 Bacteria 1001
216 Ga0157372_11342863 3300013307 Bacteria 825
217 Ga0157372_11668931 3300013307 Bacteria 733
218 Ga0157372_12763264 3300013307 Bacteria 563
219 Ga0157372_13059747 3300013307 Bacteria 534
220 Ga0157375_10044031 3300013308 Bacteria 4332
221 Ga0157375_10903592 3300013308 Bacteria 1027
222 Ga0157375_11402660 3300013308 Archaea 823
223 Ga0157375_12504408 3300013308 Bacteria 616
224 Ga0157375_13098924 3300013308 Bacteria 555
225 Ga0163163_10112836 3300014325 Bacteria 2748
226 Ga0163163_10168049 3300014325 Bacteria 2240
227 Ga0163163_10544902 3300014325 Bacteria 1223
228 Ga0157380_10009854 3300014326 Bacteria 6859
229 Ga0157377_10000850 3300014745 Bacteria 12689
230 Ga0157377_10235339 3300014745 Unclassified 1180
231 Ga0157377_10831640 3300014745 Bacteria 684
232 Ga0157379_10860232 3300014968 Bacteria 858
233 Ga0157376_10177830 3300014969 Bacteria 1942
234 Ga0157376_10329528 3300014969 Bacteria 1454
235 Ga0157376_11236227 3300014969 Bacteria 776
236 Ga0157376_11279825 3300014969 Bacteria 763
237 Ga0157376_11833067 3300014969 Bacteria 643
238 Ga0163161_10040415 3300017792 Bacteria 3350
239 Ga0163161_10153465 3300017792 Bacteria 1751
240 Ga0163161_10316739 3300017792 Bacteria 1232
241 Ga0163161_10734993 3300017792 Bacteria 824
242 Ga0207697_10193836 3300025315 Bacteria 892
243 Ga0207656_10043348 3300025321 Bacteria 1919
244 Ga0207682_10375984 3300025893 Bacteria 671
245 Ga0207682_10381313 3300025893 Unclassified 666
246 Ga0207710_10230926 3300025900 Bacteria 921
247 Ga0207680_10921194 3300025903 Bacteria 626
248 Ga0207647_10000631 3300025904 Bacteria 27434
249 Ga0207647_10333925 3300025904 Bacteria 860
250 Ga0207699_11371624 3300025906 Bacteria 523
251 Ga0207643_10042108 3300025908 Bacteria 2574
252 Ga0207705_10124763 3300025909 Bacteria 1913
253 Ga0207705_10134071 3300025909 Bacteria 1845
254 Ga0207705_10198865 3300025909 Bacteria 1518
255 Ga0207705_11174925 3300025909 Bacteria 589
256 Ga0207654_10052355 3300025911 Bacteria 2352
257 Ga0207707_10208744 3300025912 Bacteria 1702
258 Ga0207707_10237157 3300025912 Bacteria 1586
259 Ga0207707_10513706 3300025912 Bacteria 1021
260 Ga0207695_10043451 3300025913 Bacteria 4789
261 Ga0207671_10094034 3300025914 Bacteria 2262
262 Ga0207660_10072536 3300025917 Bacteria 2508
263 Ga0207660_10270871 3300025917 Bacteria 1345
264 Ga0207662_10704543 3300025918 Bacteria 708
265 Ga0207657_10337755 3300025919 Bacteria 1189
266 Ga0207649_10030254 3300025920 Bacteria 3205
267 Ga0207649_10115780 3300025920 Bacteria 1799
268 Ga0207649_11310748 3300025920 Bacteria 573
269 Ga0207652_10000011 3300025921 Bacteria 246742
270 Ga0207652_10010507 3300025921 Bacteria 7452
271 Ga0207652_10386729 3300025921 Bacteria 1262
272 Ga0207681_10163199 3300025923 Bacteria 1682
273 Ga0207650_10024753 3300025925 Bacteria 4272
274 Ga0207650_10090506 3300025925 Unclassified 2337
275 Ga0207650_10291363 3300025925 Bacteria 1331
276 Ga0207650_10345411 3300025925 Bacteria 1223
277 Ga0207650_11222498 3300025925 Bacteria 640
278 Ga0207659_10058933 3300025926 Bacteria 2758
279 Ga0207659_10357557 3300025926 Bacteria 1213
280 Ga0207659_10522240 3300025926 Bacteria 1007
281 Ga0207659_10546507 3300025926 Unclassified 984
282 Ga0207664_11437300 3300025929 Bacteria 611
283 Ga0207644_10573251 3300025931 Bacteria 936
284 Ga0207644_10693599 3300025931 Unclassified 849
285 Ga0207690_10077056 3300025932 Archaea 2317
286 Ga0207690_10214244 3300025932 Bacteria 1470
287 Ga0207686_10002295 3300025934 Bacteria 10475
288 Ga0207670_10011943 3300025936 Bacteria 5059
289 Ga0207670_10012135 3300025936 Bacteria 5028
290 Ga0207669_10417077 3300025937 Bacteria 1056
291 Ga0207704_10704473 3300025938 Bacteria 836
292 Ga0207691_10011763 3300025940 Bacteria 8400
293 Ga0207691_10280931 3300025940 Unclassified 1432
294 Ga0207691_11426297 3300025940 Bacteria 568
295 Ga0207689_10026995 3300025942 Bacteria 4807
296 Ga0207689_10366816 3300025942 Bacteria 1198
297 Ga0207661_10013907 3300025944 Bacteria 5883
298 Ga0207661_10126985 3300025944 Bacteria 2179
299 Ga0207679_10010234 3300025945 Bacteria 6033
300 Ga0207679_11995811 3300025945 Bacteria 528
301 Ga0207667_10047267 3300025949 Bacteria 4555
302 Ga0207667_10382848 3300025949 Bacteria 1433
303 Ga0207667_11401981 3300025949 Bacteria 672
304 Ga0207651_10489515 3300025960 Bacteria 1061
305 Ga0207712_10012625 3300025961 Bacteria 5398
306 Ga0207712_10036938 3300025961 Bacteria 3330
307 Ga0207712_10038726 3300025961 Bacteria 3261
308 Ga0207712_10337853 3300025961 Bacteria 1248
309 Ga0207712_10366597 3300025961 Bacteria 1202
310 Ga0207712_10860227 3300025961 Bacteria 800
311 Ga0207668_10065467 3300025972 Bacteria 2573
312 Ga0207640_10340771 3300025981 Unclassified 1201
313 Ga0207640_10505048 3300025981 Unclassified 1008
314 Ga0207640_10535461 3300025981 Unclassified 981
315 Ga0207640_12203939 3300025981 Unclassified 500
316 Ga0207658_10075665 3300025986 Bacteria 2562
317 Ga0207658_10332220 3300025986 Bacteria 1319
318 Ga0207677_10171462 3300026023 Bacteria 1697
319 Ga0207677_10176062 3300026023 Unclassified 1678
320 Ga0207677_11659020 3300026023 Bacteria 592
321 Ga0207639_10014093 3300026041 Bacteria 5613
322 Ga0207639_10395255 3300026041 Unclassified 1244
323 Ga0207639_10457222 3300026041 Unclassified 1160
324 Ga0207639_11040349 3300026041 Unclassified 767
325 Ga0207639_11184843 3300026041 Bacteria 717
326 Ga0207678_10009847 3300026067 Bacteria 8398
327 Ga0207708_10569129 3300026075 Bacteria 957
328 Ga0207702_10729732 3300026078 Bacteria 977
329 Ga0207641_10032262 3300026088 Bacteria 4348
330 Ga0207641_10523637 3300026088 Bacteria 1153
331 Ga0207641_11479572 3300026088 Bacteria 681
332 Ga0207648_10002286 3300026089 Bacteria 20689
333 Ga0207648_10187738 3300026089 Bacteria 1831
334 Ga0207648_10839511 3300026089 Bacteria 856
335 Ga0207648_10862815 3300026089 Bacteria 844
336 Ga0207676_10058081 3300026095 Bacteria 3050
337 Ga0207676_10187526 3300026095 Bacteria 1817
338 Ga0207676_11010900 3300026095 Bacteria 820
339 Ga0207676_11624698 3300026095 Bacteria 644
340 Ga0207676_12580218 3300026095 Bacteria 504
341 Ga0207674_10175238 3300026116 Bacteria 2097
342 Ga0207674_10207901 3300026116 Bacteria 1906
343 Ga0207674_10391447 3300026116 Unclassified 1343
344 Ga0207674_10461249 3300026116 Unclassified 1228
345 Ga0207674_10486236 3300026116 Bacteria 1193
346 Ga0207674_10591515 3300026116 Bacteria 1072
347 Ga0207674_10657407 3300026116 Bacteria 1012
348 Ga0207675_100183166 3300026118 Bacteria 2006
349 Ga0207675_100194739 3300026118 Bacteria 1945
350 Ga0207675_100350934 3300026118 Bacteria 1446
351 Ga0207683_10095532 3300026121 Bacteria 2650
352 Ga0207698_10137739 3300026142 Bacteria 2097
353 Ga0207698_10475378 3300026142 Bacteria 1211
354 Ga0207698_10587356 3300026142 Unclassified 1096
355 Ga0207698_10887484 3300026142 Bacteria 898
356 Ga0207698_11066291 3300026142 Bacteria 820
357 Ga0209969_1041694 3300027360 Unclassified 713
358 Ga0268266_11332733 3300028379 Bacteria 693
359 Ga0268265_10126162 3300028380 Bacteria 2118
360 Ga0268265_10530885 3300028380 Bacteria 1114
361 Ga0268265_10564875 3300028380 Bacteria 1082
362 Ga0268265_10998824 3300028380 Bacteria 826
363 Ga0268264_10125691 3300028381 Bacteria 2266
364 Ga0268264_10142752 3300028381 Bacteria 2137
365 Ga0268264_10520629 3300028381 Bacteria 1163
366 Ga0268264_10909242 3300028381 Bacteria 884
367 Ga0307410_10775276 3300031852 Bacteria 814
368 Ga0307412_10892053 3300031911 Unclassified 779
369 Ga0307414_10077584 3300032004 Bacteria 2419
370 Ga0307414_10292078 3300032004 Bacteria 1375
371 Ga0307415_100835047 3300032126 Unclassified 844
372 Ga0395899_0015849 3300037312 Bacteria 5747
373 Ga0395899_0079554 3300037312 Bacteria 2387
374 Ga0395899_0200182 3300037312 Bacteria 1393
375 Ga0395900_0103902 3300037418 Bacteria 2918
376 Ga0395900_0348733 3300037418 Bacteria 1454
377 Ga0395900_0602430 3300037418 Bacteria 1039
378 Ga0395898_0015199 3300037466 Bacteria 7902
379 Ga0395898_0137204 3300037466 Bacteria 2342
380 Ga0395898_0262695 3300037466 Bacteria 1647
381 Ga0395905_0008340 3300037471 Bacteria 10221
382 Ga0395905_0061061 3300037471 Bacteria 3525
383 Ga0395901_0034894 3300038443 Bacteria 5196
384 Ga0395901_0166042 3300038443 Bacteria 2318
385 Ga0436365_0701472 3300039437 Bacteria 614
386 Ga0439461_0045037 3300041410 Bacteria 964
387 Ga0439465_0231858 3300041413 Bacteria 679
388 Ga0451835_0593670 3300041492 Bacteria 671
389 Ga0439442_026709 3300042002 Bacteria 1202
390 Ga0439445_0051755 3300042004 Unclassified 1110
391 Ga0439449_0117790 3300042007 Unclassified 985
392 Ga0439457_061210 3300042014 Bacteria 852
393 Ga0439462_0014193 3300042015 Bacteria 2046
394 Ga0450923_016511 3300042125 Bacteria 1392
395 Ga0450923_026516 3300042125 Bacteria 1161
396 Ga0450894_011316 3300042131 Bacteria 1162
397 Ga0450898_000876 3300042134 Bacteria 3763
398 Ga0450899_006909 3300042135 Bacteria 1232
399 Ga0439434_0003068 3300042435 Bacteria 4901
400 Ga0466966_0422811 3300044684 Unclassified 801
401 Ga0495644_0117958 3300046523 Bacteria 1009
402 Ga0495598_0046006 3300046537 Bacteria 1296
403 Ga0495670_0555725 3300046691 Bacteria 625
404 Ga0495672_0520976 3300047320 Unclassified 525
405 Ga0495686_0018868 3300047472 Bacteria 4620
406 Ga0501292_062512 3300049515 Unclassified 678
407 Ga0501292_067179 3300049515 Bacteria 660
408 Ga0501294_023354 3300049517 Bacteria 683
409 Ga0501297_055750 3300049520 Bacteria 593
410 Ga0501298_010434 3300049521 Bacteria 1599
411 Ga0501032_0005429 3300049569 Bacteria 9471
412 Ga0501034_0001294 3300049571 Bacteria 33843
413 Ga0501036_0002885 3300049572 Bacteria 13631
414 Ga0501037_0024522 3300049573 Bacteria 4461
415 Ga0501038_0160650 3300049574 Bacteria 1826
416 Ga0501039_0034378 3300049575 Bacteria 3912
417 Ga0501043_0021899 3300049579 Bacteria 5012
418 Ga0501046_0019988 3300049580 Bacteria 5544
419 Ga0501047_0026380 3300049581 Bacteria 5590
420 Ga0501068_0296254 3300049584 Bacteria 1035
421 Ga0501070_0379301 3300049586 Bacteria 1145
422 Ga0501073_0005146 3300049589 Bacteria 9815
423 Ga0501074_0034770 3300049590 Bacteria 3652
424 Ga0501201_000834 3300049651 Bacteria 2900
425 Ga0501206_001011 3300049653 Bacteria 3508
426 Ga0501206_003305 3300049653 Bacteria 2046
427 Ga0501207_032581 3300049654 Bacteria 881
428 Ga0501210_007348 3300049657 Unclassified 828
429 Ga0501217_000389 3300049661 Bacteria 7073
430 Ga0501217_022559 3300049661 Bacteria 1494
431 Ga0501222_029785 3300049662 Bacteria 748
432 Ga0501223_003310 3300049663 Bacteria 3523
433 Ga0501224_011301 3300049664 Bacteria 1313
434 Ga0501227_022377 3300049665 Bacteria 1462
435 Ga0501233_020379 3300049668 Bacteria 1414
436 Ga0501233_131455 3300049668 Unclassified 684
437 Ga0501235_005238 3300049669 Bacteria 2820
438 Ga0501235_095244 3300049669 Bacteria 722
439 Ga0501236_023351 3300049670 Unclassified 931
440 Ga0501236_060368 3300049670 Bacteria 671
441 Ga0501239_045723 3300049672 Bacteria 619
442 Ga0501240_063566 3300049673 Bacteria 656
443 Ga0501240_090589 3300049673 Unclassified 577
444 Ga0501242_003117 3300049674 Bacteria 1778
445 Ga0501242_004568 3300049674 Bacteria 1538
446 Ga0501242_011274 3300049674 Bacteria 1077
447 Ga0501243_016237 3300049675 Bacteria 1200
448 Ga0501243_030475 3300049675 Bacteria 919
449 Ga0501246_044906 3300049676 Bacteria 538
450 Ga0501250_013374 3300049680 Unclassified 983
451 Ga0501251_013541 3300049681 Bacteria 1001
452 Ga0501252_002982 3300049682 Bacteria 1716
453 Ga0501253_007025 3300049683 Bacteria 1554
454 Ga0501253_083904 3300049683 Bacteria 723
455 Ga0501256_008231 3300049685 Unclassified 969
456 Ga0501257_006054 3300049686 Bacteria 2680
457 Ga0501257_054461 3300049686 Bacteria 1002
458 Ga0501257_059892 3300049686 Unclassified 961
459 Ga0501259_000140 3300049688 Bacteria 10848
460 Ga0501259_008172 3300049688 Bacteria 1683
461 Ga0501261_034894 3300049690 Bacteria 773
462 Ga0501221_001556 3300049704 Bacteria 3804
463 Ga0501225_0007459 3300049705 Bacteria 3167
464 Ga0501225_0093190 3300049705 Unclassified 874
465 Ga0501229_008822 3300049706 Bacteria 1263
466 Ga0501234_002359 3300049707 Bacteria 2972
467 Ga0501234_054510 3300049707 Unclassified 670
468 Ga0501245_001734 3300049708 Bacteria 2856
469 Ga0501245_003425 3300049708 Bacteria 2152
470 Ga0501079_0106114 3300049741 Bacteria 2180
471 Ga0501080_0082434 3300049742 Bacteria 2987
472 Ga0501083_0045805 3300049744 Bacteria 2958
473 Ga0501232_023963 3300049757 Unclassified 806
474 Ga0501241_018069 3300049758 Bacteria 1291
475 Ga0501268_059759 3300049765 Unclassified 753
476 Ga0501271_061595 3300049768 Bacteria 527
477 Ga0501275_086225 3300049772 Bacteria 516
478 Ga0501282_007908 3300049778 Bacteria 1138
479 Ga0501035_0008435 3300049822 Bacteria 9595
480 Ga0501044_0103815 3300049823 Bacteria 2857
481 Ga0501212_011247 3300049851 Bacteria 1287
482 nmdc:mga0k408_153361_c1 3300050493 Bacteria 1372
483 nmdc:mga0k408_180857_c1 3300050493 Bacteria 1258
484 nmdc:mga0k408_491049_c1 3300050493 Unclassified 728
485 nmdc:mga09592_62139_c1 3300050508 Bacteria 3160
486 nmdc:mga0qj67_205728_c1 3300050509 Bacteria 1599
487 nmdc:mga06r32_727338_c1 3300050510 Bacteria 957
488 nmdc:mga08y16_944207_c1 3300050511 Bacteria 846
489 Ga0500645_198032 3300053730 Bacteria 542

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005355 Ga0070671_100342650 Ga0070671_1003426501 118
2 3300005543 Ga0070672_101159279 Ga0070672_1011592791 118
3 3300005544 Ga0070686_100497594 Ga0070686_1004975942 118
4 3300005843 Ga0068860_100152717 Ga0068860_1001527172 118
5 3300013102 Ga0157371_10001525 Ga0157371_1000152513 118
6 3300013104 Ga0157370_10056705 Ga0157370_100567052 118
7 3300013306 Ga0163162_10419275 Ga0163162_104192752 118
8 3300013307 Ga0157372_11342863 Ga0157372_113428632 118
9 3300013308 Ga0157375_11402660 Ga0157375_114026602 118
10 3300013308 Ga0157375_12504408 Ga0157375_125044081 118
11 3300014969 Ga0157376_10329528 Ga0157376_103295282 118
12 3300017792 Ga0163161_10153465 Ga0163161_101534652 118
13 3300025926 Ga0207659_10357557 Ga0207659_103575572 118
14 3300025931 Ga0207644_10693599 Ga0207644_106935992 118
15 3300025940 Ga0207691_11426297 Ga0207691_114262971 118
16 3300026142 Ga0207698_10475378 Ga0207698_104753782 118
17 3300028381 Ga0268264_10520629 Ga0268264_105206292 118
18 3300005327 Ga0070658_11100291 Ga0070658_111002911 119
19 3300005329 Ga0070683_101065820 Ga0070683_1010658202 119
20 3300005336 Ga0070680_100036976 Ga0070680_1000369762 119
21 3300005336 Ga0070680_101055103 Ga0070680_1010551032 119
22 3300005339 Ga0070660_100258811 Ga0070660_1002588113 119
23 3300005339 Ga0070660_100518906 Ga0070660_1005189061 119
24 3300005339 Ga0070660_101863568 Ga0070660_1018635681 119
25 3300005353 Ga0070669_100290039 Ga0070669_1002900392 119
26 3300005366 Ga0070659_100016720 Ga0070659_1000167203 119
27 3300005367 Ga0070667_100035440 Ga0070667_1000354403 119
28 3300005435 Ga0070714_101962302 Ga0070714_1019623021 119
29 3300005458 Ga0070681_10082740 Ga0070681_100827403 119
30 3300005458 Ga0070681_10238608 Ga0070681_102386082 119
31 3300005458 Ga0070681_10553907 Ga0070681_105539072 119
32 3300005459 Ga0068867_100219973 Ga0068867_1002199732 119
33 3300005530 Ga0070679_100001371 Ga0070679_1000013717 119
34 3300005530 Ga0070679_100094725 Ga0070679_1000947253 119
35 3300005530 Ga0070679_100214555 Ga0070679_1002145552 119
36 3300005530 Ga0070679_100589924 Ga0070679_1005899241 119
37 3300005530 Ga0070679_101554355 Ga0070679_1015543551 119
38 3300005539 Ga0068853_100067705 Ga0068853_1000677052 119
39 3300005539 Ga0068853_100203552 Ga0068853_1002035522 119
40 3300005539 Ga0068853_101288362 Ga0068853_1012883621 119
41 3300005548 Ga0070665_100927238 Ga0070665_1009272381 119
42 3300005563 Ga0068855_100119666 Ga0068855_1001196664 119
43 3300005563 Ga0068855_100168961 Ga0068855_1001689612 119
44 3300005563 Ga0068855_101562404 Ga0068855_1015624041 119
45 3300005577 Ga0068857_100167706 Ga0068857_1001677062 119
46 3300005577 Ga0068857_100345204 Ga0068857_1003452041 119
47 3300005578 Ga0068854_100481228 Ga0068854_1004812281 119
48 3300005614 Ga0068856_100100554 Ga0068856_1001005542 119
49 3300005616 Ga0068852_100004095 Ga0068852_10000409510 119
50 3300005617 Ga0068859_100336147 Ga0068859_1003361472 119
51 3300005618 Ga0068864_100068118 Ga0068864_1000681183 119
52 3300005840 Ga0068870_10284915 Ga0068870_102849152 119
53 3300005841 Ga0068863_100893018 Ga0068863_1008930182 119
54 3300005843 Ga0068860_100014531 Ga0068860_1000145315 119
55 3300005843 Ga0068860_100835875 Ga0068860_1008358751 119
56 3300006358 Ga0068871_100832504 Ga0068871_1008325041 119
57 3300006931 Ga0097620_100336133 Ga0097620_1003361332 119
58 3300009011 Ga0105251_10412929 Ga0105251_104129291 119
59 3300009174 Ga0105241_10053700 Ga0105241_100537002 119
60 3300009174 Ga0105241_10293154 Ga0105241_102931541 119
61 3300009545 Ga0105237_10158080 Ga0105237_101580803 119
62 3300009553 Ga0105249_10376527 Ga0105249_103765272 119
63 3300010375 Ga0105239_10010402 Ga0105239_100104025 119
64 3300013100 Ga0157373_10010357 Ga0157373_100103573 119
65 3300013100 Ga0157373_10048108 Ga0157373_100481085 119
66 3300013102 Ga0157371_10011091 Ga0157371_100110916 119
67 3300013102 Ga0157371_10035442 Ga0157371_100354422 119
68 3300013102 Ga0157371_10040227 Ga0157371_100402272 119
69 3300013102 Ga0157371_10080418 Ga0157371_100804183 119
70 3300013102 Ga0157371_10240209 Ga0157371_102402092 119
71 3300013102 Ga0157371_10240471 Ga0157371_102404712 119
72 3300013102 Ga0157371_10451987 Ga0157371_104519871 119
73 3300013102 Ga0157371_10462747 Ga0157371_104627472 119
74 3300013102 Ga0157371_11125522 Ga0157371_111255221 119
75 3300013104 Ga0157370_10173003 Ga0157370_101730032 119
76 3300013104 Ga0157370_10990339 Ga0157370_109903391 119
77 3300013104 Ga0157370_11019795 Ga0157370_110197951 119
78 3300013105 Ga0157369_10015578 Ga0157369_1001557810 119
79 3300013105 Ga0157369_10099420 Ga0157369_100994202 119
80 3300013105 Ga0157369_10116752 Ga0157369_101167522 119
81 3300013296 Ga0157374_10847877 Ga0157374_108478772 119
82 3300013296 Ga0157374_12038300 Ga0157374_120383001 119
83 3300013307 Ga0157372_10015792 Ga0157372_100157922 119
84 3300013307 Ga0157372_10061447 Ga0157372_100614473 119
85 3300013307 Ga0157372_10183084 Ga0157372_101830842 119
86 3300013307 Ga0157372_10392177 Ga0157372_103921771 119
87 3300013307 Ga0157372_10827790 Ga0157372_108277901 119
88 3300014325 Ga0163163_10168049 Ga0163163_101680492 119
89 3300014325 Ga0163163_10544902 Ga0163163_105449022 119
90 3300025904 Ga0207647_10333925 Ga0207647_103339251 119
91 3300025909 Ga0207705_10124763 Ga0207705_101247632 119
92 3300025909 Ga0207705_10134071 Ga0207705_101340711 119
93 3300025909 Ga0207705_10198865 Ga0207705_101988652 119
94 3300025909 Ga0207705_11174925 Ga0207705_111749251 119
95 3300025911 Ga0207654_10052355 Ga0207654_100523552 119
96 3300025912 Ga0207707_10208744 Ga0207707_102087442 119
97 3300025912 Ga0207707_10237157 Ga0207707_102371572 119
98 3300025912 Ga0207707_10513706 Ga0207707_105137061 119
99 3300025913 Ga0207695_10043451 Ga0207695_100434514 119
100 3300025914 Ga0207671_10094034 Ga0207671_100940342 119
101 3300025917 Ga0207660_10072536 Ga0207660_100725362 119
102 3300025917 Ga0207660_10270871 Ga0207660_102708711 119
103 3300025919 Ga0207657_10337755 Ga0207657_103377551 119
104 3300025921 Ga0207652_10000011 Ga0207652_1000001115 119
105 3300025921 Ga0207652_10010507 Ga0207652_100105074 119
106 3300025921 Ga0207652_10386729 Ga0207652_103867292 119
107 3300025923 Ga0207681_10163199 Ga0207681_101631992 119
108 3300025929 Ga0207664_11437300 Ga0207664_114373001 119
109 3300025932 Ga0207690_10214244 Ga0207690_102142441 119
110 3300025944 Ga0207661_10126985 Ga0207661_101269852 119
111 3300025949 Ga0207667_10047267 Ga0207667_100472672 119
112 3300025949 Ga0207667_10382848 Ga0207667_103828482 119
113 3300025949 Ga0207667_11401981 Ga0207667_114019811 119
114 3300025961 Ga0207712_10860227 Ga0207712_108602271 119
115 3300025981 Ga0207640_10505048 Ga0207640_105050481 119
116 3300025981 Ga0207640_10535461 Ga0207640_105354612 119
117 3300025986 Ga0207658_10332220 Ga0207658_103322202 119
118 3300026023 Ga0207677_11659020 Ga0207677_116590201 119
119 3300026041 Ga0207639_11040349 Ga0207639_110403491 119
120 3300026041 Ga0207639_11184843 Ga0207639_111848432 119
121 3300026067 Ga0207678_10009847 Ga0207678_100098472 119
122 3300026078 Ga0207702_10729732 Ga0207702_107297321 119
123 3300026088 Ga0207641_11479572 Ga0207641_114795721 119
124 3300026089 Ga0207648_10187738 Ga0207648_101877382 119
125 3300026095 Ga0207676_10187526 Ga0207676_101875262 119
126 3300026116 Ga0207674_10175238 Ga0207674_101752382 119
127 3300026116 Ga0207674_10207901 Ga0207674_102079012 119
128 3300026116 Ga0207674_10657407 Ga0207674_106574071 119
129 3300026142 Ga0207698_10887484 Ga0207698_108874841 119
130 3300028379 Ga0268266_11332733 Ga0268266_113327331 119
131 3300028380 Ga0268265_10998824 Ga0268265_109988242 119
132 3300028381 Ga0268264_10142752 Ga0268264_101427522 119
133 3300037312 Ga0395899_0015849 Ga0395899_0015849_2319_2687 119
134 3300037312 Ga0395899_0079554 Ga0395899_0079554_1702_2070 119
135 3300037312 Ga0395899_0200182 Ga0395899_0200182_28_387 119
136 3300037418 Ga0395900_0103902 Ga0395900_0103902_2044_2412 119
137 3300037418 Ga0395900_0602430 Ga0395900_0602430_176_535 119
138 3300037466 Ga0395898_0015199 Ga0395898_0015199_5673_6041 119
139 3300037466 Ga0395898_0137204 Ga0395898_0137204_203_562 119
140 3300038443 Ga0395901_0034894 Ga0395901_0034894_617_985 119
141 3300038443 Ga0395901_0166042 Ga0395901_0166042_689_1048 119
142 3300005329 Ga0070683_100036619 Ga0070683_1000366194 120
143 3300005331 Ga0070670_100038368 Ga0070670_1000383683 120
144 3300005331 Ga0070670_100811831 Ga0070670_1008118312 120
145 3300005339 Ga0070660_100160370 Ga0070660_1001603701 120
146 3300005343 Ga0070687_100523505 Ga0070687_1005235051 120
147 3300005344 Ga0070661_100041139 Ga0070661_1000411392 120
148 3300005344 Ga0070661_100045609 Ga0070661_1000456093 120
149 3300005344 Ga0070661_100578076 Ga0070661_1005780761 120
150 3300005353 Ga0070669_101883556 Ga0070669_1018835561 120
151 3300005366 Ga0070659_100014169 Ga0070659_1000141694 120
152 3300005459 Ga0068867_100681548 Ga0068867_1006815482 120
153 3300005535 Ga0070684_100008197 Ga0070684_1000081976 120
154 3300005535 Ga0070684_100973390 Ga0070684_1009733902 120
155 3300005539 Ga0068853_100195406 Ga0068853_1001954063 120
156 3300005539 Ga0068853_100510311 Ga0068853_1005103112 120
157 3300005544 Ga0070686_101275370 Ga0070686_1012753701 120
158 3300005564 Ga0070664_100002996 Ga0070664_1000029962 120
159 3300005578 Ga0068854_101608575 Ga0068854_1016085752 120
160 3300005616 Ga0068852_100005706 Ga0068852_1000057063 120
161 3300005616 Ga0068852_100337204 Ga0068852_1003372042 120
162 3300005719 Ga0068861_100446128 Ga0068861_1004461281 120
163 3300005719 Ga0068861_101163888 Ga0068861_1011638881 120
164 3300005834 Ga0068851_10050052 Ga0068851_100500522 120
165 3300006358 Ga0068871_101990468 Ga0068871_1019904681 120
166 3300013102 Ga0157371_10180449 Ga0157371_101804492 120
167 3300013102 Ga0157371_10287936 Ga0157371_102879362 120
168 3300013102 Ga0157371_10312967 Ga0157371_103129672 120
169 3300013102 Ga0157371_10325460 Ga0157371_103254602 120
170 3300013102 Ga0157371_10671711 Ga0157371_106717111 120
171 3300013102 Ga0157371_11095214 Ga0157371_110952141 120
172 3300013104 Ga0157370_10000405 Ga0157370_100004056 120
173 3300013104 Ga0157370_10408255 Ga0157370_104082552 120
174 3300013104 Ga0157370_10884935 Ga0157370_108849351 120
175 3300013105 Ga0157369_10210068 Ga0157369_102100682 120
176 3300013296 Ga0157374_10060543 Ga0157374_100605432 120
177 3300013307 Ga0157372_10091821 Ga0157372_100918213 120
178 3300013307 Ga0157372_10147832 Ga0157372_101478323 120
179 3300013307 Ga0157372_10165541 Ga0157372_101655413 120
180 3300013307 Ga0157372_10184092 Ga0157372_101840924 120
181 3300013307 Ga0157372_10434674 Ga0157372_104346742 120
182 3300013307 Ga0157372_10474666 Ga0157372_104746663 120
183 3300013307 Ga0157372_10941356 Ga0157372_109413562 120
184 3300013307 Ga0157372_11668931 Ga0157372_116689311 120
185 3300013307 Ga0157372_12763264 Ga0157372_127632641 120
186 3300013307 Ga0157372_13059747 Ga0157372_130597471 120
187 3300013308 Ga0157375_13098924 Ga0157375_130989241 120
188 3300014745 Ga0157377_10235339 Ga0157377_102353391 120
189 3300025321 Ga0207656_10043348 Ga0207656_100433482 120
190 3300025893 Ga0207682_10381313 Ga0207682_103813131 120
191 3300025904 Ga0207647_10000631 Ga0207647_100006318 120
192 3300025906 Ga0207699_11371624 Ga0207699_113716241 120
193 3300025920 Ga0207649_10030254 Ga0207649_100302543 120
194 3300025920 Ga0207649_10115780 Ga0207649_101157802 120
195 3300025920 Ga0207649_11310748 Ga0207649_113107481 120
196 3300025925 Ga0207650_11222498 Ga0207650_112224981 120
197 3300025926 Ga0207659_10546507 Ga0207659_105465072 120
198 3300025932 Ga0207690_10077056 Ga0207690_100770562 120
199 3300025940 Ga0207691_10280931 Ga0207691_102809312 120
200 3300025944 Ga0207661_10013907 Ga0207661_100139076 120
201 3300025945 Ga0207679_10010234 Ga0207679_100102344 120
202 3300026023 Ga0207677_10176062 Ga0207677_101760622 120
203 3300026041 Ga0207639_10014093 Ga0207639_100140932 120
204 3300026041 Ga0207639_10395255 Ga0207639_103952552 120
205 3300026089 Ga0207648_10839511 Ga0207648_108395112 120
206 3300026095 Ga0207676_11010900 Ga0207676_110109002 120
207 3300026116 Ga0207674_10461249 Ga0207674_104612492 120
208 3300026116 Ga0207674_10486236 Ga0207674_104862362 120
209 3300026142 Ga0207698_10137739 Ga0207698_101377392 120
210 3300026142 Ga0207698_10587356 Ga0207698_105873562 120
211 3300027360 Ga0209969_1041694 Ga0209969_10416942 120
212 3300031852 Ga0307410_10775276 Ga0307410_107752761 120
213 3300031911 Ga0307412_10892053 Ga0307412_108920531 120
214 3300032004 Ga0307414_10077584 Ga0307414_100775842 120
215 3300032004 Ga0307414_10292078 Ga0307414_102920782 120
216 3300032126 Ga0307415_100835047 Ga0307415_1008350471 120
217 3300037418 Ga0395900_0348733 Ga0395900_0348733_303_665 120
218 3300037466 Ga0395898_0262695 Ga0395898_0262695_217_579 120
219 3300037471 Ga0395905_0008340 Ga0395905_0008340_2209_2571 120
220 3300037471 Ga0395905_0061061 Ga0395905_0061061_2024_2386 120
221 3300039437 Ga0436365_0701472 Ga0436365_0701472_224_586 120
222 3300044684 Ga0466966_0422811 Ga0466966_0422811_158_520 120
223 3300049515 Ga0501292_062512 Ga0501292_062512_177_539 120
224 3300049515 Ga0501292_067179 Ga0501292_067179_42_404 120
225 3300049517 Ga0501294_023354 Ga0501294_023354_176_538 120
226 3300049520 Ga0501297_055750 Ga0501297_055750_163_525 120
227 3300049521 Ga0501298_010434 Ga0501298_010434_738_1100 120
228 3300049651 Ga0501201_000834 Ga0501201_000834_1846_2208 120
229 3300049653 Ga0501206_001011 Ga0501206_001011_1556_1918 120
230 3300049653 Ga0501206_003305 Ga0501206_003305_207_569 120
231 3300049654 Ga0501207_032581 Ga0501207_032581_463_825 120
232 3300049657 Ga0501210_007348 Ga0501210_007348_13_375 120
233 3300049661 Ga0501217_000389 Ga0501217_000389_1134_1496 120
234 3300049661 Ga0501217_022559 Ga0501217_022559_723_1085 120
235 3300049662 Ga0501222_029785 Ga0501222_029785_73_435 120
236 3300049663 Ga0501223_003310 Ga0501223_003310_2424_2786 120
237 3300049664 Ga0501224_011301 Ga0501224_011301_940_1302 120
238 3300049665 Ga0501227_022377 Ga0501227_022377_365_727 120
239 3300049668 Ga0501233_020379 Ga0501233_020379_666_1028 120
240 3300049668 Ga0501233_131455 Ga0501233_131455_35_397 120
241 3300049669 Ga0501235_005238 Ga0501235_005238_762_1124 120
242 3300049669 Ga0501235_095244 Ga0501235_095244_37_399 120
243 3300049670 Ga0501236_023351 Ga0501236_023351_392_754 120
244 3300049670 Ga0501236_060368 Ga0501236_060368_78_440 120
245 3300049672 Ga0501239_045723 Ga0501239_045723_221_583 120
246 3300049673 Ga0501240_063566 Ga0501240_063566_142_504 120
247 3300049673 Ga0501240_090589 Ga0501240_090589_48_410 120
248 3300049674 Ga0501242_003117 Ga0501242_003117_275_637 120
249 3300049674 Ga0501242_004568 Ga0501242_004568_985_1347 120
250 3300049674 Ga0501242_011274 Ga0501242_011274_126_488 120
251 3300049675 Ga0501243_016237 Ga0501243_016237_658_1020 120
252 3300049675 Ga0501243_030475 Ga0501243_030475_242_604 120
253 3300049676 Ga0501246_044906 Ga0501246_044906_147_509 120
254 3300049680 Ga0501250_013374 Ga0501250_013374_280_642 120
255 3300049681 Ga0501251_013541 Ga0501251_013541_343_705 120
256 3300049682 Ga0501252_002982 Ga0501252_002982_188_550 120
257 3300049683 Ga0501253_007025 Ga0501253_007025_897_1259 120
258 3300049683 Ga0501253_083904 Ga0501253_083904_18_380 120
259 3300049685 Ga0501256_008231 Ga0501256_008231_349_711 120
260 3300049686 Ga0501257_006054 Ga0501257_006054_734_1096 120
261 3300049686 Ga0501257_054461 Ga0501257_054461_147_509 120
262 3300049686 Ga0501257_059892 Ga0501257_059892_148_510 120
263 3300049688 Ga0501259_000140 Ga0501259_000140_7551_7913 120
264 3300049688 Ga0501259_008172 Ga0501259_008172_1105_1467 120
265 3300049690 Ga0501261_034894 Ga0501261_034894_152_514 120
266 3300049704 Ga0501221_001556 Ga0501221_001556_519_881 120
267 3300049705 Ga0501225_0007459 Ga0501225_0007459_1095_1457 120
268 3300049705 Ga0501225_0093190 Ga0501225_0093190_316_678 120
269 3300049706 Ga0501229_008822 Ga0501229_008822_687_1049 120
270 3300049707 Ga0501234_002359 Ga0501234_002359_1444_1806 120
271 3300049707 Ga0501234_054510 Ga0501234_054510_23_385 120
272 3300049708 Ga0501245_001734 Ga0501245_001734_547_909 120
273 3300049708 Ga0501245_003425 Ga0501245_003425_286_648 120
274 3300049757 Ga0501232_023963 Ga0501232_023963_408_770 120
275 3300049758 Ga0501241_018069 Ga0501241_018069_387_749 120
276 3300049765 Ga0501268_059759 Ga0501268_059759_354_716 120
277 3300049768 Ga0501271_061595 Ga0501271_061595_36_398 120
278 3300049772 Ga0501275_086225 Ga0501275_086225_142_504 120
279 3300049778 Ga0501282_007908 Ga0501282_007908_220_582 120
280 3300049851 Ga0501212_011247 Ga0501212_011247_487_849 120
281 3300025981 Ga0207640_10340771 Ga0207640_103407712 121
282 3300002459 JGI24751J29686_10001619 JGI24751J29686_100016192 123
283 3300003323 rootH1_10322875 rootH1_103228752 123
284 3300005288 Ga0065714_10083424 Ga0065714_100834243 123
285 3300005289 Ga0065704_10849339 Ga0065704_108493391 123
286 3300005290 Ga0065712_10002727 Ga0065712_100027273 123
287 3300005290 Ga0065712_10016709 Ga0065712_100167092 123
288 3300005290 Ga0065712_10073585 Ga0065712_100735853 123
289 3300005293 Ga0065715_10226491 Ga0065715_102264912 123
290 3300005330 Ga0070690_100678802 Ga0070690_1006788021 123
291 3300005331 Ga0070670_100100598 Ga0070670_1001005983 123
292 3300005331 Ga0070670_100228187 Ga0070670_1002281872 123
293 3300005331 Ga0070670_100556429 Ga0070670_1005564292 123
294 3300005331 Ga0070670_100588249 Ga0070670_1005882492 123
295 3300005334 Ga0068869_100050190 Ga0068869_1000501902 123
296 3300005334 Ga0068869_100365803 Ga0068869_1003658032 123
297 3300005334 Ga0068869_101680686 Ga0068869_1016806861 123
298 3300005335 Ga0070666_10909623 Ga0070666_109096231 123
299 3300005337 Ga0070682_100782073 Ga0070682_1007820732 123
300 3300005338 Ga0068868_100671168 Ga0068868_1006711682 123
301 3300005340 Ga0070689_100250090 Ga0070689_1002500902 123
302 3300005340 Ga0070689_100362806 Ga0070689_1003628062 123
303 3300005343 Ga0070687_100534318 Ga0070687_1005343181 123
304 3300005353 Ga0070669_100431731 Ga0070669_1004317312 123
305 3300005353 Ga0070669_100467032 Ga0070669_1004670322 123
306 3300005353 Ga0070669_101960788 Ga0070669_1019607881 123
307 3300005354 Ga0070675_100058212 Ga0070675_1000582124 123
308 3300005354 Ga0070675_100626228 Ga0070675_1006262282 123
309 3300005356 Ga0070674_100137704 Ga0070674_1001377042 123
310 3300005364 Ga0070673_100056657 Ga0070673_1000566573 123
311 3300005365 Ga0070688_100020367 Ga0070688_1000203672 123
312 3300005365 Ga0070688_100188729 Ga0070688_1001887292 123
313 3300005365 Ga0070688_101623808 Ga0070688_1016238081 123
314 3300005367 Ga0070667_100329239 Ga0070667_1003292391 123
315 3300005438 Ga0070701_10022901 Ga0070701_100229014 123
316 3300005440 Ga0070705_101698994 Ga0070705_1016989941 123
317 3300005441 Ga0070700_100103034 Ga0070700_1001030343 123
318 3300005441 Ga0070700_100497553 Ga0070700_1004975531 123
319 3300005444 Ga0070694_101012650 Ga0070694_1010126502 123
320 3300005456 Ga0070678_101763674 Ga0070678_1017636741 123
321 3300005459 Ga0068867_100021335 Ga0068867_1000213351 123
322 3300005466 Ga0070685_10003936 Ga0070685_100039366 123
323 3300005466 Ga0070685_10103395 Ga0070685_101033951 123
324 3300005466 Ga0070685_11152644 Ga0070685_111526441 123
325 3300005471 Ga0070698_100032750 Ga0070698_1000327503 123
326 3300005539 Ga0068853_100007200 Ga0068853_1000072006 123
327 3300005539 Ga0068853_100223470 Ga0068853_1002234703 123
328 3300005543 Ga0070672_100374180 Ga0070672_1003741802 123
329 3300005549 Ga0070704_100778286 Ga0070704_1007782862 123
330 3300005577 Ga0068857_101282396 Ga0068857_1012823961 123
331 3300005578 Ga0068854_102231297 Ga0068854_1022312971 123
332 3300005616 Ga0068852_100631915 Ga0068852_1006319152 123
333 3300005617 Ga0068859_100134619 Ga0068859_1001346191 123
334 3300005617 Ga0068859_100148289 Ga0068859_1001482894 123
335 3300005617 Ga0068859_100223816 Ga0068859_1002238162 123
336 3300005617 Ga0068859_100779408 Ga0068859_1007794081 123
337 3300005617 Ga0068859_100921373 Ga0068859_1009213732 123
338 3300005618 Ga0068864_100063729 Ga0068864_1000637293 123
339 3300005719 Ga0068861_100140344 Ga0068861_1001403442 123
340 3300005719 Ga0068861_101175228 Ga0068861_1011752282 123
341 3300005840 Ga0068870_10138094 Ga0068870_101380942 123
342 3300005841 Ga0068863_100038538 Ga0068863_1000385383 123
343 3300005841 Ga0068863_100191310 Ga0068863_1001913103 123
344 3300005841 Ga0068863_100582538 Ga0068863_1005825382 123
345 3300005842 Ga0068858_100211806 Ga0068858_1002118064 123
346 3300005843 Ga0068860_101841123 Ga0068860_1018411232 123
347 3300005843 Ga0068860_101932935 Ga0068860_1019329351 123
348 3300005844 Ga0068862_100583034 Ga0068862_1005830342 123
349 3300006195 Ga0075366_10045238 Ga0075366_100452382 123
350 3300006195 Ga0075366_10091700 Ga0075366_100917003 123
351 3300006195 Ga0075366_10228791 Ga0075366_102287911 123
352 3300006237 Ga0097621_100010162 Ga0097621_1000101624 123
353 3300006237 Ga0097621_101072204 Ga0097621_1010722042 123
354 3300006844 Ga0075428_100026453 Ga0075428_1000264535 123
355 3300006846 Ga0075430_100262442 Ga0075430_1002624422 123
356 3300006847 Ga0075431_100073802 Ga0075431_1000738023 123
357 3300006880 Ga0075429_100045901 Ga0075429_1000459014 123
358 3300006931 Ga0097620_100134629 Ga0097620_1001346291 123
359 3300006931 Ga0097620_100148296 Ga0097620_1001482961 123
360 3300006931 Ga0097620_100223813 Ga0097620_1002238132 123
361 3300006931 Ga0097620_100779399 Ga0097620_1007793991 123
362 3300006931 Ga0097620_100921262 Ga0097620_1009212621 123
363 3300009094 Ga0111539_10683122 Ga0111539_106831222 123
364 3300009101 Ga0105247_10000640 Ga0105247_1000064021 123
365 3300009148 Ga0105243_11529585 Ga0105243_115295851 123
366 3300009176 Ga0105242_10034920 Ga0105242_100349203 123
367 3300009176 Ga0105242_10166907 Ga0105242_101669072 123
368 3300009176 Ga0105242_13013095 Ga0105242_130130951 123
369 3300009553 Ga0105249_10002821 Ga0105249_100028215 123
370 3300009553 Ga0105249_10005620 Ga0105249_100056202 123
371 3300009553 Ga0105249_10009722 Ga0105249_100097222 123
372 3300009553 Ga0105249_10027485 Ga0105249_100274854 123
373 3300009553 Ga0105249_10094029 Ga0105249_100940292 123
374 3300009553 Ga0105249_11007097 Ga0105249_110070971 123
375 3300011119 Ga0105246_10883907 Ga0105246_108839071 123
376 3300013306 Ga0163162_10072994 Ga0163162_100729942 123
377 3300013306 Ga0163162_10451852 Ga0163162_104518522 123
378 3300013308 Ga0157375_10044031 Ga0157375_100440313 123
379 3300013308 Ga0157375_10903592 Ga0157375_109035922 123
380 3300014325 Ga0163163_10112836 Ga0163163_101128362 123
381 3300014326 Ga0157380_10009854 Ga0157380_100098544 123
382 3300014745 Ga0157377_10000850 Ga0157377_100008508 123
383 3300014745 Ga0157377_10831640 Ga0157377_108316401 123
384 3300014968 Ga0157379_10860232 Ga0157379_108602321 123
385 3300014969 Ga0157376_10177830 Ga0157376_101778302 123
386 3300014969 Ga0157376_11236227 Ga0157376_112362272 123
387 3300014969 Ga0157376_11279825 Ga0157376_112798252 123
388 3300014969 Ga0157376_11833067 Ga0157376_118330672 123
389 3300017792 Ga0163161_10040415 Ga0163161_100404153 123
390 3300017792 Ga0163161_10316739 Ga0163161_103167391 123
391 3300017792 Ga0163161_10734993 Ga0163161_107349931 123
392 3300025315 Ga0207697_10193836 Ga0207697_101938362 123
393 3300025893 Ga0207682_10375984 Ga0207682_103759842 123
394 3300025900 Ga0207710_10230926 Ga0207710_102309262 123
395 3300025903 Ga0207680_10921194 Ga0207680_109211941 123
396 3300025908 Ga0207643_10042108 Ga0207643_100421082 123
397 3300025918 Ga0207662_10704543 Ga0207662_107045432 123
398 3300025925 Ga0207650_10024753 Ga0207650_100247534 123
399 3300025925 Ga0207650_10090506 Ga0207650_100905062 123
400 3300025925 Ga0207650_10291363 Ga0207650_102913632 123
401 3300025925 Ga0207650_10345411 Ga0207650_103454112 123
402 3300025926 Ga0207659_10058933 Ga0207659_100589333 123
403 3300025926 Ga0207659_10522240 Ga0207659_105222402 123
404 3300025931 Ga0207644_10573251 Ga0207644_105732512 123
405 3300025934 Ga0207686_10002295 Ga0207686_100022957 123
406 3300025936 Ga0207670_10011943 Ga0207670_100119432 123
407 3300025936 Ga0207670_10012135 Ga0207670_100121353 123
408 3300025937 Ga0207669_10417077 Ga0207669_104170772 123
409 3300025938 Ga0207704_10704473 Ga0207704_107044731 123
410 3300025940 Ga0207691_10011763 Ga0207691_100117636 123
411 3300025942 Ga0207689_10026995 Ga0207689_100269953 123
412 3300025942 Ga0207689_10366816 Ga0207689_103668162 123
413 3300025945 Ga0207679_11995811 Ga0207679_119958111 123
414 3300025960 Ga0207651_10489515 Ga0207651_104895152 123
415 3300025961 Ga0207712_10012625 Ga0207712_100126253 123
416 3300025961 Ga0207712_10036938 Ga0207712_100369384 123
417 3300025961 Ga0207712_10038726 Ga0207712_100387262 123
418 3300025961 Ga0207712_10337853 Ga0207712_103378532 123
419 3300025961 Ga0207712_10366597 Ga0207712_103665972 123
420 3300025972 Ga0207668_10065467 Ga0207668_100654673 123
421 3300025981 Ga0207640_12203939 Ga0207640_122039391 123
422 3300025986 Ga0207658_10075665 Ga0207658_100756652 123
423 3300026023 Ga0207677_10171462 Ga0207677_101714622 123
424 3300026041 Ga0207639_10457222 Ga0207639_104572222 123
425 3300026075 Ga0207708_10569129 Ga0207708_105691292 123
426 3300026088 Ga0207641_10032262 Ga0207641_100322623 123
427 3300026088 Ga0207641_10523637 Ga0207641_105236372 123
428 3300026089 Ga0207648_10002286 Ga0207648_100022868 123
429 3300026089 Ga0207648_10862815 Ga0207648_108628151 123
430 3300026095 Ga0207676_10058081 Ga0207676_100580811 123
431 3300026095 Ga0207676_11624698 Ga0207676_116246981 123
432 3300026095 Ga0207676_12580218 Ga0207676_125802181 123
433 3300026116 Ga0207674_10391447 Ga0207674_103914472 123
434 3300026116 Ga0207674_10591515 Ga0207674_105915151 123
435 3300026118 Ga0207675_100183166 Ga0207675_1001831662 123
436 3300026118 Ga0207675_100194739 Ga0207675_1001947393 123
437 3300026118 Ga0207675_100350934 Ga0207675_1003509342 123
438 3300026121 Ga0207683_10095532 Ga0207683_100955324 123
439 3300026142 Ga0207698_11066291 Ga0207698_110662912 123
440 3300028380 Ga0268265_10126162 Ga0268265_101261622 123
441 3300028380 Ga0268265_10530885 Ga0268265_105308851 123
442 3300028380 Ga0268265_10564875 Ga0268265_105648752 123
443 3300028381 Ga0268264_10125691 Ga0268264_101256913 123
444 3300028381 Ga0268264_10909242 Ga0268264_109092422 123
445 3300041410 Ga0439461_0045037 Ga0439461_0045037_477_848 123
446 3300041413 Ga0439465_0231858 Ga0439465_0231858_24_395 123
447 3300041492 Ga0451835_0593670 Ga0451835_0593670_32_403 123
448 3300042002 Ga0439442_026709 Ga0439442_026709_21_392 123
449 3300042004 Ga0439445_0051755 Ga0439445_0051755_436_807 123
450 3300042007 Ga0439449_0117790 Ga0439449_0117790_294_665 123
451 3300042014 Ga0439457_061210 Ga0439457_061210_167_538 123
452 3300042015 Ga0439462_0014193 Ga0439462_0014193_1470_1841 123
453 3300042125 Ga0450923_016511 Ga0450923_016511_870_1241 123
454 3300042125 Ga0450923_026516 Ga0450923_026516_156_527 123
455 3300042131 Ga0450894_011316 Ga0450894_011316_747_1118 123
456 3300042134 Ga0450898_000876 Ga0450898_000876_2729_3100 123
457 3300042135 Ga0450899_006909 Ga0450899_006909_297_668 123
458 3300042435 Ga0439434_0003068 Ga0439434_0003068_384_755 123
459 3300046523 Ga0495644_0117958 Ga0495644_0117958_335_706 123
460 3300046537 Ga0495598_0046006 Ga0495598_0046006_57_428 123
461 3300046691 Ga0495670_0555725 Ga0495670_0555725_124_495 123
462 3300047320 Ga0495672_0520976 Ga0495672_0520976_49_420 123
463 3300047472 Ga0495686_0018868 Ga0495686_0018868_2757_3128 123
464 3300049569 Ga0501032_0005429 Ga0501032_0005429_6989_7360 123
465 3300049571 Ga0501034_0001294 Ga0501034_0001294_25701_26072 123
466 3300049572 Ga0501036_0002885 Ga0501036_0002885_2114_2485 123
467 3300049573 Ga0501037_0024522 Ga0501037_0024522_1388_1759 123
468 3300049574 Ga0501038_0160650 Ga0501038_0160650_777_1148 123
469 3300049575 Ga0501039_0034378 Ga0501039_0034378_1528_1899 123
470 3300049579 Ga0501043_0021899 Ga0501043_0021899_2588_2959 123
471 3300049580 Ga0501046_0019988 Ga0501046_0019988_3375_3746 123
472 3300049581 Ga0501047_0026380 Ga0501047_0026380_935_1306 123
473 3300049584 Ga0501068_0296254 Ga0501068_0296254_645_1016 123
474 3300049586 Ga0501070_0379301 Ga0501070_0379301_61_432 123
475 3300049589 Ga0501073_0005146 Ga0501073_0005146_6585_6956 123
476 3300049590 Ga0501074_0034770 Ga0501074_0034770_2504_2875 123
477 3300049741 Ga0501079_0106114 Ga0501079_0106114_700_1071 123
478 3300049742 Ga0501080_0082434 Ga0501080_0082434_629_1000 123
479 3300049744 Ga0501083_0045805 Ga0501083_0045805_1825_2196 123
480 3300049822 Ga0501035_0008435 Ga0501035_0008435_3590_3961 123
481 3300049823 Ga0501044_0103815 Ga0501044_0103815_1951_2322 123
482 3300050493 nmdc:mga0k408_153361_c1 nmdc:mga0k408_153361_c1_984_1355 123
483 3300050493 nmdc:mga0k408_180857_c1 nmdc:mga0k408_180857_c1_162_533 123
484 3300050493 nmdc:mga0k408_491049_c1 nmdc:mga0k408_491049_c1_277_648 123
485 3300050508 nmdc:mga09592_62139_c1 nmdc:mga09592_62139_c1_458_829 123
486 3300050509 nmdc:mga0qj67_205728_c1 nmdc:mga0qj67_205728_c1_714_1085 123
487 3300050510 nmdc:mga06r32_727338_c1 nmdc:mga06r32_727338_c1_427_798 123
488 3300050511 nmdc:mga08y16_944207_c1 nmdc:mga08y16_944207_c1_65_436 123
489 3300053730 Ga0500645_198032 Ga0500645_198032_141_512 123

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03965

Penicillinase_R

Penicillinase repressor

4

107

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ne9-assembly1.cif.gz_CCC a single sensor controls large variations in zinc quotas in a marine cyanobacterium 0.9469 3 66
7ne9-assembly1.cif.gz_DDD a single sensor controls large variations in zinc quotas in a marine cyanobacterium 0.9326 3 66
4lb5-assembly1.cif.gz_B crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) 0.919 6 68
6j0e-assembly1.cif.gz_B structures of two arsr as(iii)-responsive repressors: implications for the mechanism of derepression 0.8996 5 66
5j6x-assembly2.cif.gz_B crystal structure of the apo-zalpha of zebrafish pkz 0.8993 6 68
ID Description Score Start End Superfamily
4lb5A00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9438 6 67 1.10.10.10
4lb5A00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9281 6 67 1.10.10.10
af_Q4DZU8_467_618_3.30.230.130 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Cullin; Chain C, Domain 2 0.9253 18 66 3.30.230.130
af_Q57824_147_206_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9191 4 65 1.10.10.10
4lb5B00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.919 6 68 1.10.10.10
ID Description Score Start End GO Terms
AF-H1DIA1-F1-model_v4 Penicillinase repressor 0.9812 1 74 GO:0003677
GO:0005737
GO:0045892
AF-H1DIA1-F1-model_v4 Penicillinase repressor 0.9559 1 74 GO:0003677
GO:0005737
GO:0045892
AF-A0A519ZH08-F1-model_v4 BlaI/MecI/CopY family transcriptional regulator 0.9432 1 68 GO:0003677
GO:0005737
GO:0045892
AF-A0A7J7AZU7-F1-model_v4 deleted 0.9312 1 81
AF-A0A2N2VVW2-F1-model_v4 Transcriptional regulator 0.93 1 73 GO:0003677
GO:0005737
GO:0045892

Feature Viewer

pLDDT pTM Quality
77.37 0.54 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map