F453801

General Info

Members Datasets Scaffolds Average Seq Length
489 262 978 208

Family's Representative Sequence

Representative Sequence 3300030521|Ga0307511_10079467|Ga0307511_100794673
Length 241
Sequence LPLQAPYSNDGTTCTSTGHRGRENRGPRDYDYGMTTKRRGRPPHDDVLTPAEWRVVHAVQHGMTNRDIAARKGISVDAVKYHVANAVGKLGVDNRKSLRQWFRAPAGSALSRRGKTVDVTIKLGPIGQISRTVKDIKQAEAWYRDVLGLPHLYTFGKLAFFDCGGTRLFLTQEAQTPKEESILYLRVADIEQGHNELKARGVEFTSAPHMVHRHADGTEEWMAFFTDPEGRPLAIMSQVTT

Samples

Sample ID Description Type Environment
1 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
4 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
64 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
65 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
66 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
67 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
68 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
87 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300013874 Rhizosphere microbial communities from switchgrass harvested rhizosphere in Austin, TX, USA - RS_213 Metagenome Rhizosphere
95 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
96 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
97 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
98 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
99 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
100 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
157 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
161 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
162 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
163 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
164 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
165 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
166 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
167 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
168 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
169 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
170 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
171 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
172 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
173 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
174 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
175 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
176 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
177 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
178 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
179 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
180 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
181 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
182 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
183 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
184 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
185 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
186 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
187 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
188 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
189 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
190 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
191 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
192 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
193 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
194 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
195 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
196 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
197 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
198 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
199 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
200 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
201 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
202 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
203 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
204 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
205 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
206 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
207 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
208 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
209 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
210 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
211 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
212 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
213 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
214 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
215 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
216 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
217 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
218 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
219 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
220 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
221 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
222 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
223 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
224 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
225 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
226 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
227 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
228 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
229 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
233 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
234 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
235 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
236 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
237 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
238 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
239 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
240 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
242 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
243 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
244 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
245 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
246 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
247 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
248 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
249 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
250 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
251 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
252 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
253 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
254 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
255 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
256 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
257 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
258 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
259 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
260 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
261 2643221629 Devosia sp. Root105 Isolate Unclassified
262 2643221662 Devosia sp. Root413D1 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.98
Metatranscriptomes 0.61
Isolates 0.41

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.7
Nodule 0
Rhizoplane 3.89
Rhizosphere 88.96
Stem 0
Stem Tuber 0
Unclassified 12.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307511_10079467 3300030521 Bacteria 2318
2 rootH2_10005210 3300003320 Bacteria 1937
3 rootH2_10137352 3300003320 Bacteria 4375
4 Ga0055536_1002645 3300003781 Bacteria 9958
5 Ga0055530_10003058 3300003791 Bacteria 9958
6 Ga0070658_10229763 3300005327 Bacteria 1571
7 Ga0070676_10150145 3300005328 Bacteria 1491
8 Ga0070683_100032985 3300005329 Bacteria 4719
9 Ga0070683_100676571 3300005329 Bacteria 988
10 Ga0070683_100834462 3300005329 Bacteria 884
11 Ga0070690_100026836 3300005330 Unclassified 3556
12 Ga0070690_100028524 3300005330 Bacteria 3457
13 Ga0070690_100051492 3300005330 Bacteria 2629
14 Ga0070670_100064099 3300005331 Bacteria 3153
15 Ga0070670_100124236 3300005331 Bacteria 2227
16 Ga0070677_10106183 3300005333 Bacteria 1247
17 Ga0068869_100346393 3300005334 Bacteria 1210
18 Ga0068869_100430883 3300005334 Bacteria 1090
19 Ga0070666_10009632 3300005335 Bacteria 6029
20 Ga0070666_10029340 3300005335 Bacteria 3615
21 Ga0070680_100030770 3300005336 Bacteria 4312
22 Ga0070680_100170701 3300005336 Bacteria 1830
23 Ga0070682_100154178 3300005337 Unclassified 1579
24 Ga0070682_100223623 3300005337 Unclassified 1341
25 Ga0070682_100311929 3300005337 Bacteria 1158
26 Ga0070682_100384133 3300005337 Bacteria 1057
27 Ga0068868_100005759 3300005338 Bacteria 8722
28 Ga0068868_100096798 3300005338 Bacteria 2384
29 Ga0070660_100173631 3300005339 Bacteria 1742
30 Ga0070689_100003975 3300005340 Bacteria 9929
31 Ga0070689_100066804 3300005340 Bacteria 2802
32 Ga0070687_100186419 3300005343 Unclassified 1247
33 Ga0070661_100130227 3300005344 Bacteria 1889
34 Ga0070661_100400695 3300005344 Bacteria 1085
35 Ga0070675_100025614 3300005354 Bacteria 4729
36 Ga0070675_100190079 3300005354 Bacteria 1779
37 Ga0070671_100019798 3300005355 Bacteria 5482
38 Ga0070673_100005037 3300005364 Bacteria 8429
39 Ga0070673_100028756 3300005364 Bacteria 4138
40 Ga0070688_100010251 3300005365 Bacteria 5162
41 Ga0070667_100006099 3300005367 Bacteria 10008
42 Ga0070667_100011891 3300005367 Bacteria 7199
43 Ga0070667_100024037 3300005367 Bacteria 5061
44 Ga0070667_100046788 3300005367 Bacteria 3639
45 Ga0070709_10026292 3300005434 Bacteria 3449
46 Ga0070709_10212119 3300005434 Bacteria 1377
47 Ga0070714_100013938 3300005435 Bacteria 6450
48 Ga0070713_100001972 3300005436 Bacteria 13250
49 Ga0070713_100148509 3300005436 Bacteria 2083
50 Ga0070710_10006352 3300005437 Bacteria 5672
51 Ga0070710_10018633 3300005437 Bacteria 3574
52 Ga0070711_100002297 3300005439 Bacteria 10836
53 Ga0070711_100040319 3300005439 Bacteria 3148
54 Ga0070705_100093336 3300005440 Bacteria 1881
55 Ga0070700_100150012 3300005441 Bacteria 1594
56 Ga0070694_100016768 3300005444 Bacteria 4615
57 Ga0070678_100009852 3300005456 Bacteria 5809
58 Ga0070678_100019347 3300005456 Bacteria 4435
59 Ga0070678_100021623 3300005456 Bacteria 4247
60 Ga0070678_100190243 3300005456 Bacteria 1687
61 Ga0070678_100205962 3300005456 Bacteria 1627
62 Ga0070678_100536581 3300005456 Bacteria 1037
63 Ga0070678_100962615 3300005456 Unclassified 783
64 Ga0070662_100045930 3300005457 Bacteria 3136
65 Ga0070662_100258233 3300005457 Bacteria 1403
66 Ga0070681_10025516 3300005458 Bacteria 5945
67 Ga0070681_10049411 3300005458 Bacteria 4200
68 Ga0070681_10773521 3300005458 Bacteria 877
69 Ga0068867_100009462 3300005459 Bacteria 6871
70 Ga0068867_100085932 3300005459 Bacteria 2379
71 Ga0070685_10018432 3300005466 Bacteria 3753
72 Ga0070699_100258159 3300005518 Bacteria 1558
73 Ga0070679_100067633 3300005530 Bacteria 3563
74 Ga0070679_100287073 3300005530 Bacteria 1597
75 Ga0070679_100379814 3300005530 Bacteria 1360
76 Ga0070679_100740080 3300005530 Bacteria 926
77 Ga0070684_100159913 3300005535 Bacteria 2043
78 Ga0070684_100176194 3300005535 Bacteria 1943
79 Ga0070684_100518973 3300005535 Bacteria 1104
80 Ga0070684_100796712 3300005535 Bacteria 883
81 Ga0068853_100000494 3300005539 Bacteria 26960
82 Ga0070672_100086570 3300005543 Bacteria 2520
83 Ga0070672_100241651 3300005543 Bacteria 1519
84 Ga0070686_100008212 3300005544 Bacteria 5843
85 Ga0070686_100149684 3300005544 Bacteria 1633
86 Ga0070686_100586722 3300005544 Bacteria 876
87 Ga0070695_100006694 3300005545 Bacteria 6816
88 Ga0070693_100285029 3300005547 Unclassified 1108
89 Ga0070665_100000069 3300005548 Bacteria 202384
90 Ga0070665_100012815 3300005548 Bacteria 8442
91 Ga0070665_100257050 3300005548 Bacteria 1748
92 Ga0070665_100634402 3300005548 Bacteria 1081
93 Ga0070704_100202157 3300005549 Unclassified 1604
94 Ga0068855_100000628 3300005563 Bacteria 43316
95 Ga0068855_100019225 3300005563 Bacteria 8211
96 Ga0068855_100330728 3300005563 Bacteria 1682
97 Ga0068855_101308280 3300005563 Bacteria 750
98 Ga0070664_100283781 3300005564 Bacteria 1493
99 Ga0070664_100309768 3300005564 Unclassified 1428
100 Ga0068854_100620630 3300005578 Unclassified 925
101 Ga0068856_100032372 3300005614 Bacteria 5119
102 Ga0068856_100200189 3300005614 Bacteria 2011
103 Ga0068856_100281014 3300005614 Bacteria 1681
104 Ga0070702_100009212 3300005615 Bacteria 4821
105 Ga0070702_100015629 3300005615 Bacteria 3879
106 Ga0068852_100237862 3300005616 Bacteria 1739
107 Ga0068852_100273459 3300005616 Bacteria 1626
108 Ga0068852_100593605 3300005616 Bacteria 1111
109 Ga0068859_100155974 3300005617 Bacteria 2360
110 Ga0068864_100133621 3300005618 Unclassified 2232
111 Ga0068866_10139591 3300005718 Bacteria 1389
112 Ga0068866_10172257 3300005718 Bacteria 1271
113 Ga0068861_100011423 3300005719 Bacteria 6174
114 Ga0068870_10058428 3300005840 Bacteria 2065
115 Ga0068870_10059520 3300005840 Bacteria 2048
116 Ga0068863_100027169 3300005841 Bacteria 5458
117 Ga0068863_100052524 3300005841 Bacteria 3862
118 Ga0068863_100267167 3300005841 Unclassified 1655
119 Ga0068858_100005750 3300005842 Bacteria 12115
120 Ga0068858_100079204 3300005842 Bacteria 3053
121 Ga0068858_100096057 3300005842 Bacteria 2761
122 Ga0068858_100199320 3300005842 Bacteria 1892
123 Ga0068860_100078534 3300005843 Unclassified 3138
124 Ga0068860_100173412 3300005843 Bacteria 2084
125 Ga0068860_100432723 3300005843 Bacteria 1306
126 Ga0068860_100863231 3300005843 Bacteria 920
127 Ga0068860_101148447 3300005843 Bacteria 797
128 Ga0068862_100095727 3300005844 Bacteria 2591
129 Ga0068862_100144886 3300005844 Bacteria 2111
130 Ga0081455_10003572 3300005937 Bacteria 17852
131 Ga0081539_10014713 3300005985 Bacteria 5755
132 Ga0070715_10009047 3300006163 Bacteria 3496
133 Ga0070716_100006262 3300006173 Bacteria 5809
134 Ga0070712_100006074 3300006175 Bacteria 7476
135 Ga0075366_10288621 3300006195 Bacteria 1003
136 Ga0075366_10401840 3300006195 Unclassified 843
137 Ga0097621_100000074 3300006237 Bacteria 51891
138 Ga0097621_100016285 3300006237 Bacteria 5615
139 Ga0097621_100083588 3300006237 Bacteria 2660
140 Ga0097621_100212146 3300006237 Unclassified 1684
141 Ga0068871_100009338 3300006358 Bacteria 7102
142 Ga0068871_100060184 3300006358 Bacteria 3097
143 Ga0068871_100085843 3300006358 Bacteria 2614
144 Ga0068871_100137415 3300006358 Bacteria 2076
145 Ga0068871_100152318 3300006358 Bacteria 1972
146 Ga0068871_100187940 3300006358 Unclassified 1778
147 Ga0068871_100189478 3300006358 Bacteria 1771
148 Ga0068871_100272619 3300006358 Bacteria 1478
149 Ga0075434_100420632 3300006871 Unclassified 1357
150 Ga0068865_100000854 3300006881 Bacteria 17259
151 Ga0068865_100179877 3300006881 Bacteria 1628
152 Ga0068865_100335653 3300006881 Bacteria 1220
153 Ga0075436_100163066 3300006914 Unclassified 1572
154 Ga0075436_100164490 3300006914 Bacteria 1565
155 Ga0097620_100155969 3300006931 Bacteria 2360
156 Ga0099794_10052865 3300007265 Bacteria 1958
157 Ga0105240_10003134 3300009093 Bacteria 26039
158 Ga0105240_10250758 3300009093 Bacteria 2047
159 Ga0105240_10476650 3300009093 Bacteria 1392
160 Ga0105240_10597690 3300009093 Bacteria 1215
161 Ga0105240_10922015 3300009093 Bacteria 938
162 Ga0105245_10004279 3300009098 Bacteria 12658
163 Ga0105245_10025156 3300009098 Bacteria 5235
164 Ga0105245_10175054 3300009098 Bacteria 2046
165 Ga0105247_10005871 3300009101 Bacteria 7671
166 Ga0105241_10081167 3300009174 Bacteria 2539
167 Ga0105241_10126486 3300009174 Bacteria 2064
168 Ga0105241_10176960 3300009174 Bacteria 1766
169 Ga0105242_10001176 3300009176 Bacteria 20604
170 Ga0105242_10067178 3300009176 Bacteria 2963
171 Ga0105248_10010200 3300009177 Bacteria 10346
172 Ga0105248_10381980 3300009177 Bacteria 1586
173 Ga0105248_10620282 3300009177 Bacteria 1220
174 Ga0105248_10992892 3300009177 Unclassified 948
175 Ga0105248_11467277 3300009177 Bacteria 772
176 Ga0105237_10006476 3300009545 Bacteria 12977
177 Ga0105237_10023430 3300009545 Bacteria 6326
178 Ga0105237_10084132 3300009545 Bacteria 3172
179 Ga0105237_10106244 3300009545 Bacteria 2799
180 Ga0105238_10019479 3300009551 Bacteria 6910
181 Ga0105238_10139343 3300009551 Bacteria 2403
182 Ga0105238_10373212 3300009551 Bacteria 1417
183 Ga0105238_10486501 3300009551 Bacteria 1234
184 Ga0105238_10511598 3300009551 Unclassified 1202
185 Ga0105238_10518646 3300009551 Unclassified 1194
186 Ga0105249_10031618 3300009553 Bacteria 4787
187 Ga0105239_10080739 3300010375 Bacteria 3578
188 Ga0105239_10093301 3300010375 Bacteria 3323
189 Ga0105239_10172850 3300010375 Bacteria 2416
190 Ga0105239_10199605 3300010375 Bacteria 2241
191 Ga0105239_11057602 3300010375 Bacteria 934
192 Ga0105239_11283815 3300010375 Bacteria 844
193 Ga0105246_10027895 3300011119 Bacteria 3705
194 Ga0105246_10301345 3300011119 Unclassified 1294
195 Ga0157370_10601662 3300013104 Bacteria 1007
196 Ga0157369_10134694 3300013105 Bacteria 2616
197 Ga0157374_10005518 3300013296 Bacteria 10633
198 Ga0157374_10420484 3300013296 Bacteria 1335
199 Ga0157378_10013059 3300013297 Bacteria 7265
200 Ga0157378_10066739 3300013297 Bacteria 3223
201 Ga0157378_10120588 3300013297 Bacteria 2417
202 Ga0157378_10813082 3300013297 Bacteria 961
203 Ga0163162_10051708 3300013306 Bacteria 4123
204 Ga0163162_10158612 3300013306 Unclassified 2383
205 Ga0163162_10462100 3300013306 Bacteria 1401
206 Ga0157372_10034831 3300013307 Bacteria 5539
207 Ga0157372_10046195 3300013307 Bacteria 4834
208 Ga0157372_10143378 3300013307 Unclassified 2754
209 Ga0157372_10521032 3300013307 Bacteria 1386
210 Ga0157375_10132407 3300013308 Bacteria 2614
211 Ga0157375_10167947 3300013308 Bacteria 2340
212 Ga0157375_10348485 3300013308 Unclassified 1647
213 Ga0157375_10416809 3300013308 Unclassified 1509
214 Ga0157375_10814524 3300013308 Bacteria 1082
215 Ga0157514_101347 3300013874 Bacteria 1216
216 Ga0163163_10025454 3300014325 Bacteria 5641
217 Ga0163163_10086585 3300014325 Bacteria 3142
218 Ga0163163_10090267 3300014325 Bacteria 3077
219 Ga0163163_10117772 3300014325 Bacteria 2688
220 Ga0163163_10234099 3300014325 Bacteria 1886
221 Ga0157380_10021340 3300014326 Bacteria 4856
222 Ga0157379_10073535 3300014968 Bacteria 3059
223 Ga0157379_10160273 3300014968 Bacteria 2031
224 Ga0157379_10177792 3300014968 Bacteria 1922
225 Ga0157379_10225877 3300014968 Bacteria 1697
226 Ga0157379_10267758 3300014968 Bacteria 1553
227 Ga0157376_10068716 3300014969 Bacteria 3001
228 Ga0157376_10204921 3300014969 Unclassified 1817
229 Ga0157376_10247225 3300014969 Bacteria 1664
230 Ga0157376_10269060 3300014969 Bacteria 1600
231 Ga0157376_10484540 3300014969 Bacteria 1212
232 Ga0163161_10033481 3300017792 Bacteria 3672
233 Ga0206353_12002535 3300020082 Bacteria 4390
234 Ga0209676_1000467 3300025292 Bacteria 67659
235 Ga0209050_1000461 3300025298 Bacteria 72912
236 Ga0209051_1010813 3300025303 Bacteria 4566
237 Ga0209051_1024249 3300025303 Bacteria 2499
238 Ga0209257_1018338 3300025304 Bacteria 2698
239 Ga0207642_10016989 3300025899 Bacteria 2756
240 Ga0207642_10475253 3300025899 Bacteria 761
241 Ga0207680_10173612 3300025903 Unclassified 1453
242 Ga0207685_10272838 3300025905 Bacteria 827
243 Ga0207699_10012427 3300025906 Bacteria 4331
244 Ga0207699_10017761 3300025906 Bacteria 3754
245 Ga0207645_10159195 3300025907 Bacteria 1476
246 Ga0207645_10577456 3300025907 Bacteria 763
247 Ga0207705_10598312 3300025909 Bacteria 857
248 Ga0207654_10049024 3300025911 Bacteria 2420
249 Ga0207654_10143481 3300025911 Bacteria 1525
250 Ga0207654_10242515 3300025911 Bacteria 1205
251 Ga0207707_10201287 3300025912 Bacteria 1736
252 Ga0207695_10043013 3300025913 Bacteria 4818
253 Ga0207695_10229205 3300025913 Bacteria 1763
254 Ga0207695_10428023 3300025913 Bacteria 1207
255 Ga0207671_10011845 3300025914 Bacteria 7057
256 Ga0207671_10048576 3300025914 Bacteria 3141
257 Ga0207671_10696720 3300025914 Bacteria 808
258 Ga0207693_10000245 3300025915 Bacteria 50171
259 Ga0207663_10179402 3300025916 Unclassified 1511
260 Ga0207660_10092930 3300025917 Bacteria 2240
261 Ga0207660_10178056 3300025917 Bacteria 1650
262 Ga0207662_10114687 3300025918 Unclassified 1683
263 Ga0207657_10215688 3300025919 Unclassified 1539
264 Ga0207657_10388223 3300025919 Bacteria 1099
265 Ga0207652_10249761 3300025921 Bacteria 1600
266 Ga0207652_10274087 3300025921 Bacteria 1522
267 Ga0207652_10620578 3300025921 Bacteria 968
268 Ga0207650_10042068 3300025925 Bacteria 3351
269 Ga0207650_10279235 3300025925 Bacteria 1360
270 Ga0207659_10155728 3300025926 Bacteria 1789
271 Ga0207687_10171131 3300025927 Bacteria 1675
272 Ga0207687_10541397 3300025927 Bacteria 976
273 Ga0207687_10771846 3300025927 Bacteria 819
274 Ga0207700_10262545 3300025928 Bacteria 1479
275 Ga0207700_10563051 3300025928 Bacteria 1012
276 Ga0207664_10012413 3300025929 Bacteria 6089
277 Ga0207644_10115479 3300025931 Unclassified 2036
278 Ga0207644_10150250 3300025931 Bacteria 1802
279 Ga0207644_10721269 3300025931 Bacteria 832
280 Ga0207690_10632746 3300025932 Bacteria 875
281 Ga0207706_10097592 3300025933 Bacteria 2584
282 Ga0207706_10132385 3300025933 Bacteria 2193
283 Ga0207706_10225907 3300025933 Bacteria 1638
284 Ga0207686_10068407 3300025934 Bacteria 2275
285 Ga0207686_10247714 3300025934 Unclassified 1300
286 Ga0207670_10003235 3300025936 Bacteria 8631
287 Ga0207670_10077959 3300025936 Bacteria 2310
288 Ga0207669_10545076 3300025937 Bacteria 935
289 Ga0207704_10039989 3300025938 Unclassified 2736
290 Ga0207704_10268791 3300025938 Bacteria 1290
291 Ga0207704_11086832 3300025938 Bacteria 679
292 Ga0207665_10010871 3300025939 Bacteria 5975
293 Ga0207691_10025185 3300025940 Bacteria 5588
294 Ga0207691_10162710 3300025940 Bacteria 1957
295 Ga0207711_10004858 3300025941 Bacteria 11416
296 Ga0207711_10131390 3300025941 Bacteria 2245
297 Ga0207711_10488465 3300025941 Bacteria 1147
298 Ga0207711_10509972 3300025941 Bacteria 1121
299 Ga0207689_10031665 3300025942 Bacteria 4401
300 Ga0207689_10035429 3300025942 Bacteria 4146
301 Ga0207661_10120205 3300025944 Bacteria 2235
302 Ga0207661_10389337 3300025944 Bacteria 1263
303 Ga0207661_11003313 3300025944 Bacteria 769
304 Ga0207679_10209565 3300025945 Unclassified 1633
305 Ga0207667_10002658 3300025949 Bacteria 22087
306 Ga0207667_10105779 3300025949 Bacteria 2903
307 Ga0207667_10490929 3300025949 Bacteria 1246
308 Ga0207651_10542948 3300025960 Bacteria 1010
309 Ga0207712_10505644 3300025961 Bacteria 1033
310 Ga0207712_11009325 3300025961 Unclassified 738
311 Ga0207658_10017718 3300025986 Bacteria 4909
312 Ga0207658_10210254 3300025986 Bacteria 1630
313 Ga0207677_10019565 3300026023 Bacteria 4092
314 Ga0207677_10168383 3300026023 Bacteria 1710
315 Ga0207677_10217909 3300026023 Unclassified 1529
316 Ga0207677_10228836 3300026023 Bacteria 1496
317 Ga0207677_11009673 3300026023 Unclassified 755
318 Ga0207703_10038017 3300026035 Bacteria 3838
319 Ga0207703_10164417 3300026035 Bacteria 1946
320 Ga0207639_10042788 3300026041 Bacteria 3396
321 Ga0207639_11004456 3300026041 Unclassified 781
322 Ga0207678_10297286 3300026067 Bacteria 1387
323 Ga0207708_10120970 3300026075 Bacteria 2040
324 Ga0207702_10069066 3300026078 Bacteria 3037
325 Ga0207702_10218688 3300026078 Bacteria 1775
326 Ga0207641_10017714 3300026088 Bacteria 5835
327 Ga0207641_10200735 3300026088 Bacteria 1838
328 Ga0207641_10266045 3300026088 Bacteria 1607
329 Ga0207648_10016981 3300026089 Bacteria 6633
330 Ga0207648_10097930 3300026089 Bacteria 2567
331 Ga0207648_10108821 3300026089 Bacteria 2433
332 Ga0207648_10257841 3300026089 Bacteria 1555
333 Ga0207676_10107287 3300026095 Bacteria 2329
334 Ga0207676_10124778 3300026095 Unclassified 2178
335 Ga0207676_10897097 3300026095 Unclassified 869
336 Ga0207674_10067855 3300026116 Bacteria 3590
337 Ga0207675_100006336 3300026118 Bacteria 11218
338 Ga0207675_100026791 3300026118 Bacteria 5365
339 Ga0207683_10005009 3300026121 Bacteria 11378
340 Ga0207683_10015593 3300026121 Bacteria 6468
341 Ga0207683_10029847 3300026121 Bacteria 4722
342 Ga0207683_10729525 3300026121 Bacteria 919
343 Ga0207683_10924090 3300026121 Unclassified 810
344 Ga0209998_10050917 3300027717 Bacteria 958
345 Ga0265354_1001251 3300028016 Bacteria 3809
346 Ga0268266_10000001 3300028379 Bacteria 4040580
347 Ga0268266_10116039 3300028379 Bacteria 2377
348 Ga0268266_10202255 3300028379 Unclassified 1818
349 Ga0268266_10488129 3300028379 Bacteria 1175
350 Ga0268266_10766397 3300028379 Unclassified 931
351 Ga0268265_10033585 3300028380 Bacteria 3731
352 Ga0268264_10402309 3300028381 Bacteria 1316
353 Ga0268264_10701445 3300028381 Unclassified 1005
354 Ga0265334_10043623 3300028573 Bacteria 1745
355 Ga0265318_10001334 3300028577 Bacteria 14766
356 Ga0265318_10050005 3300028577 Bacteria 1572
357 Ga0265318_10059422 3300028577 Bacteria 1426
358 Ga0265770_1001557 3300030878 Bacteria 3146
359 Ga0265760_10000302 3300031090 Bacteria 13569
360 Ga0265316_10091790 3300031344 Unclassified 2316
361 Ga0307513_10009953 3300031456 Bacteria 11992
362 Ga0307513_10057690 3300031456 Bacteria 4134
363 Ga0307513_10216648 3300031456 Bacteria 1740
364 Ga0307408_100670666 3300031548 Unclassified 929
365 Ga0265313_10008051 3300031595 Bacteria 7059
366 Ga0307514_10228548 3300031649 Unclassified 1131
367 Ga0265314_10008386 3300031711 Bacteria 8855
368 Ga0265314_10119105 3300031711 Bacteria 1665
369 Ga0307405_10649041 3300031731 Bacteria 868
370 Ga0307410_10402579 3300031852 Bacteria 1106
371 Ga0307410_10531015 3300031852 Bacteria 972
372 Ga0307416_100167733 3300032002 Bacteria 2039
373 Ga0307414_11114447 3300032004 Bacteria 729
374 Ga0307411_10081023 3300032005 Bacteria 2234
375 Ga0307415_100107315 3300032126 Bacteria 2063
376 Ga0307415_100455350 3300032126 Bacteria 1107
377 Ga0373956_0030184 3300035119 Bacteria 2368
378 Ga0373956_0321531 3300035119 Unclassified 737
379 Ga0373943_0115998 3300035170 Bacteria 1418
380 Ga0373955_0048591 3300035172 Bacteria 2301
381 Ga0373955_0071013 3300035172 Bacteria 1947
382 Ga0373955_0094305 3300035172 Bacteria 1710
383 Ga0373942_0137861 3300035207 Unclassified 775
384 Ga0373962_0025372 3300035242 Bacteria 1592
385 Ga0373935_0506186 3300035692 Bacteria 877
386 Ga0373927_0039001 3300035695 Bacteria 3083
387 Ga0373937_0020533 3300036401 Bacteria 5921
388 Ga0373937_0114946 3300036401 Bacteria 2505
389 Ga0373937_0184415 3300036401 Bacteria 1960
390 Ga0373937_0372528 3300036401 Unclassified 1354
391 Ga0395901_0320797 3300038443 Bacteria 1603
392 Ga0439465_0239595 3300041413 Bacteria 669
393 Ga0451804_0361793 3300041463 Bacteria 816
394 Ga0451841_0778883 3300041498 Bacteria 1227
395 Ga0450912_002279 3300042116 Bacteria 1276
396 Ga0450912_010826 3300042116 Bacteria 786
397 Ga0450893_0014604 3300042532 Bacteria 1318
398 Ga0466969_0022778 3300044656 Unclassified 3231
399 Ga0466972_0131240 3300044658 Bacteria 1180
400 Ga0466966_0028050 3300044684 Unclassified 3668
401 Ga0466963_0228146 3300044694 Bacteria 1305
402 Ga0466970_0488688 3300044765 Unclassified 708
403 Ga0466959_0005578 3300045049 Bacteria 8645
404 Ga0466959_0011655 3300045049 Bacteria 6322
405 Ga0466959_0054147 3300045049 Bacteria 2932
406 Ga0451576_0191817 3300045051 Bacteria 2134
407 Ga0451576_0197108 3300045051 Bacteria 2104
408 Ga0495580_0002011 3300046472 Bacteria 17897
409 Ga0495582_0566134 3300046473 Bacteria 657
410 Ga0495616_0041642 3300046513 Bacteria 2342
411 Ga0495618_0239410 3300046514 Bacteria 1141
412 Ga0495628_0309477 3300046516 Bacteria 1168
413 Ga0495630_0151076 3300046517 Bacteria 1767
414 Ga0495652_0513930 3300046529 Bacteria 829
415 Ga0495598_0003770 3300046537 Bacteria 3239
416 Ga0495645_0264721 3300046543 Bacteria 1137
417 Ga0495622_0169965 3300046557 Unclassified 980
418 Ga0495625_0010233 3300046660 Bacteria 7778
419 Ga0495625_0351265 3300046660 Bacteria 932
420 Ga0495635_0285427 3300046663 Bacteria 1108
421 Ga0495649_0073158 3300046694 Bacteria 1836
422 Ga0495674_0038540 3300047319 Bacteria 4289
423 Ga0495674_0237267 3300047319 Bacteria 1504
424 Ga0495683_0236006 3300047323 Unclassified 809
425 Ga0495686_0109570 3300047472 Bacteria 1657
426 Ga0496100_0765655 3300048903 Bacteria 755
427 Ga0496101_0142369 3300048904 Bacteria 1828
428 Ga0496102_0097034 3300048905 Bacteria 2733
429 Ga0496104_0068526 3300048907 Bacteria 3371
430 Ga0496106_0517896 3300048909 Bacteria 958
431 Ga0496107_0011527 3300048910 Bacteria 6159
432 Ga0496108_0179830 3300048911 Bacteria 1831
433 Ga0496108_0585020 3300048911 Bacteria 973
434 Ga0496109_0027144 3300048912 Bacteria 5110
435 Ga0496110_0000704 3300048913 Bacteria 23091
436 Ga0496111_0171407 3300048914 Bacteria 1612
437 Ga0496112_0211712 3300048915 Bacteria 1895
438 Ga0496112_1139604 3300048915 Bacteria 697
439 Ga0496113_0154530 3300048916 Bacteria 1811
440 Ga0496114_0005266 3300048917 Bacteria 10108
441 Ga0496114_0012513 3300048917 Bacteria 6795
442 Ga0496114_0022876 3300048917 Bacteria 5094
443 Ga0496115_0012207 3300048918 Bacteria 6459
444 Ga0496117_0026790 3300048920 Bacteria 4503
445 Ga0496118_0000264 3300048921 Bacteria 91882
446 Ga0501032_0000604 3300049569 Bacteria 29036
447 Ga0501034_0030836 3300049571 Bacteria 5449
448 Ga0501034_0970102 3300049571 Bacteria 735
449 Ga0501037_0105631 3300049573 Unclassified 2030
450 Ga0501037_0423225 3300049573 Bacteria 911
451 Ga0501067_0000293 3300049583 Bacteria 27335
452 Ga0501067_0037841 3300049583 Bacteria 2679
453 Ga0501068_0001293 3300049584 Bacteria 13272
454 Ga0501068_0020955 3300049584 Bacteria 3815
455 Ga0501073_0000083 3300049589 Bacteria 59733
456 Ga0501073_0052254 3300049589 Bacteria 2861
457 Ga0501076_0352011 3300049592 Bacteria 1209
458 Ga0501077_0000088 3300049593 Bacteria 46551
459 Ga0501077_0081385 3300049593 Bacteria 2051
460 Ga0501079_0084045 3300049741 Bacteria 2463
461 Ga0501080_0004105 3300049742 Bacteria 12905
462 Ga0501080_0006575 3300049742 Bacteria 10444
463 Ga0501083_0100120 3300049744 Bacteria 1911
464 Ga0501044_0012503 3300049823 Bacteria 9191
465 Ga0501045_0692961 3300049824 Bacteria 752
466 nmdc:mga0k408_121288_c1 3300050493 Unclassified 1548
467 nmdc:mga0k408_245289_c1 3300050493 Bacteria 1070
468 nmdc:mga08y16_70427_c1 3300050511 Bacteria 3646
469 nmdc:mga0n895_747867_c1 3300050512 Bacteria 971
470 nmdc:mga0rr50_18128_c1 3300050513 Bacteria 4720
471 nmdc:mga08x19_146534_c1 3300050514 Unclassified 1597
472 Ga0495601_0005402 3300053077 Bacteria 7445
473 Ga0495612_0304218 3300053078 Unclassified 715
474 Ga0500641_0001054 3300053096 Bacteria 9834
475 Ga0500641_0056572 3300053096 Bacteria 1625
476 Ga0500556_0024156 3300053104 Bacteria 1994
477 Ga0500562_057496 3300053108 Bacteria 1043
478 Ga0500595_002162 3300053119 Bacteria 10002
479 Ga0500595_071580 3300053119 Unclassified 1027
480 Ga0500573_0000009 3300053140 Bacteria 230823
481 Ga0500616_0053309 3300053153 Bacteria 2123
482 Ga0500624_079494 3300053157 Bacteria 652
483 Ga0500630_238784 3300053159 Bacteria 659
484 Ga0500645_002077 3300053730 Bacteria 9280
485 Ga0500587_000194 3300053739 Bacteria 6289
486 Ga0501084_0171461 3300054114 Bacteria 1831
487 Ga0501082_0002534 3300060353 Bacteria 15994
488 2644167427 2643221629 Bacteria 5850260
489 2644347190 2643221662 Bacteria 5851492
490 Ga0307511_10079467
491 rootH2_10005210
492 rootH2_10137352
493 Ga0055536_1002645
494 Ga0055530_10003058
495 Ga0070658_10229763
496 Ga0070676_10150145
497 Ga0070683_100032985
498 Ga0070683_100676571
499 Ga0070683_100834462
500 Ga0070690_100026836
501 Ga0070690_100028524
502 Ga0070690_100051492
503 Ga0070670_100064099
504 Ga0070670_100124236
505 Ga0070677_10106183
506 Ga0068869_100346393
507 Ga0068869_100430883
508 Ga0070666_10009632
509 Ga0070666_10029340
510 Ga0070680_100030770
511 Ga0070680_100170701
512 Ga0070682_100154178
513 Ga0070682_100223623
514 Ga0070682_100311929
515 Ga0070682_100384133
516 Ga0068868_100005759
517 Ga0068868_100096798
518 Ga0070660_100173631
519 Ga0070689_100003975
520 Ga0070689_100066804
521 Ga0070687_100186419
522 Ga0070661_100130227
523 Ga0070661_100400695
524 Ga0070675_100025614
525 Ga0070675_100190079
526 Ga0070671_100019798
527 Ga0070673_100005037
528 Ga0070673_100028756
529 Ga0070688_100010251
530 Ga0070667_100006099
531 Ga0070667_100011891
532 Ga0070667_100024037
533 Ga0070667_100046788
534 Ga0070709_10026292
535 Ga0070709_10212119
536 Ga0070714_100013938
537 Ga0070713_100001972
538 Ga0070713_100148509
539 Ga0070710_10006352
540 Ga0070710_10018633
541 Ga0070711_100002297
542 Ga0070711_100040319
543 Ga0070705_100093336
544 Ga0070700_100150012
545 Ga0070694_100016768
546 Ga0070678_100009852
547 Ga0070678_100019347
548 Ga0070678_100021623
549 Ga0070678_100190243
550 Ga0070678_100205962
551 Ga0070678_100536581
552 Ga0070678_100962615
553 Ga0070662_100045930
554 Ga0070662_100258233
555 Ga0070681_10025516
556 Ga0070681_10049411
557 Ga0070681_10773521
558 Ga0068867_100009462
559 Ga0068867_100085932
560 Ga0070685_10018432
561 Ga0070699_100258159
562 Ga0070679_100067633
563 Ga0070679_100287073
564 Ga0070679_100379814
565 Ga0070679_100740080
566 Ga0070684_100159913
567 Ga0070684_100176194
568 Ga0070684_100518973
569 Ga0070684_100796712
570 Ga0068853_100000494
571 Ga0070672_100086570
572 Ga0070672_100241651
573 Ga0070686_100008212
574 Ga0070686_100149684
575 Ga0070686_100586722
576 Ga0070695_100006694
577 Ga0070693_100285029
578 Ga0070665_100000069
579 Ga0070665_100012815
580 Ga0070665_100257050
581 Ga0070665_100634402
582 Ga0070704_100202157
583 Ga0068855_100000628
584 Ga0068855_100019225
585 Ga0068855_100330728
586 Ga0068855_101308280
587 Ga0070664_100283781
588 Ga0070664_100309768
589 Ga0068854_100620630
590 Ga0068856_100032372
591 Ga0068856_100200189
592 Ga0068856_100281014
593 Ga0070702_100009212
594 Ga0070702_100015629
595 Ga0068852_100237862
596 Ga0068852_100273459
597 Ga0068852_100593605
598 Ga0068859_100155974
599 Ga0068864_100133621
600 Ga0068866_10139591
601 Ga0068866_10172257
602 Ga0068861_100011423
603 Ga0068870_10058428
604 Ga0068870_10059520
605 Ga0068863_100027169
606 Ga0068863_100052524
607 Ga0068863_100267167
608 Ga0068858_100005750
609 Ga0068858_100079204
610 Ga0068858_100096057
611 Ga0068858_100199320
612 Ga0068860_100078534
613 Ga0068860_100173412
614 Ga0068860_100432723
615 Ga0068860_100863231
616 Ga0068860_101148447
617 Ga0068862_100095727
618 Ga0068862_100144886
619 Ga0081455_10003572
620 Ga0081539_10014713
621 Ga0070715_10009047
622 Ga0070716_100006262
623 Ga0070712_100006074
624 Ga0075366_10288621
625 Ga0075366_10401840
626 Ga0097621_100000074
627 Ga0097621_100016285
628 Ga0097621_100083588
629 Ga0097621_100212146
630 Ga0068871_100009338
631 Ga0068871_100060184
632 Ga0068871_100085843
633 Ga0068871_100137415
634 Ga0068871_100152318
635 Ga0068871_100187940
636 Ga0068871_100189478
637 Ga0068871_100272619
638 Ga0075434_100420632
639 Ga0068865_100000854
640 Ga0068865_100179877
641 Ga0068865_100335653
642 Ga0075436_100163066
643 Ga0075436_100164490
644 Ga0097620_100155969
645 Ga0099794_10052865
646 Ga0105240_10003134
647 Ga0105240_10250758
648 Ga0105240_10476650
649 Ga0105240_10597690
650 Ga0105240_10922015
651 Ga0105245_10004279
652 Ga0105245_10025156
653 Ga0105245_10175054
654 Ga0105247_10005871
655 Ga0105241_10081167
656 Ga0105241_10126486
657 Ga0105241_10176960
658 Ga0105242_10001176
659 Ga0105242_10067178
660 Ga0105248_10010200
661 Ga0105248_10381980
662 Ga0105248_10620282
663 Ga0105248_10992892
664 Ga0105248_11467277
665 Ga0105237_10006476
666 Ga0105237_10023430
667 Ga0105237_10084132
668 Ga0105237_10106244
669 Ga0105238_10019479
670 Ga0105238_10139343
671 Ga0105238_10373212
672 Ga0105238_10486501
673 Ga0105238_10511598
674 Ga0105238_10518646
675 Ga0105249_10031618
676 Ga0105239_10080739
677 Ga0105239_10093301
678 Ga0105239_10172850
679 Ga0105239_10199605
680 Ga0105239_11057602
681 Ga0105239_11283815
682 Ga0105246_10027895
683 Ga0105246_10301345
684 Ga0157370_10601662
685 Ga0157369_10134694
686 Ga0157374_10005518
687 Ga0157374_10420484
688 Ga0157378_10013059
689 Ga0157378_10066739
690 Ga0157378_10120588
691 Ga0157378_10813082
692 Ga0163162_10051708
693 Ga0163162_10158612
694 Ga0163162_10462100
695 Ga0157372_10034831
696 Ga0157372_10046195
697 Ga0157372_10143378
698 Ga0157372_10521032
699 Ga0157375_10132407
700 Ga0157375_10167947
701 Ga0157375_10348485
702 Ga0157375_10416809
703 Ga0157375_10814524
704 Ga0157514_101347
705 Ga0163163_10025454
706 Ga0163163_10086585
707 Ga0163163_10090267
708 Ga0163163_10117772
709 Ga0163163_10234099
710 Ga0157380_10021340
711 Ga0157379_10073535
712 Ga0157379_10160273
713 Ga0157379_10177792
714 Ga0157379_10225877
715 Ga0157379_10267758
716 Ga0157376_10068716
717 Ga0157376_10204921
718 Ga0157376_10247225
719 Ga0157376_10269060
720 Ga0157376_10484540
721 Ga0163161_10033481
722 Ga0206353_12002535
723 Ga0209676_1000467
724 Ga0209050_1000461
725 Ga0209051_1010813
726 Ga0209051_1024249
727 Ga0209257_1018338
728 Ga0207642_10016989
729 Ga0207642_10475253
730 Ga0207680_10173612
731 Ga0207685_10272838
732 Ga0207699_10012427
733 Ga0207699_10017761
734 Ga0207645_10159195
735 Ga0207645_10577456
736 Ga0207705_10598312
737 Ga0207654_10049024
738 Ga0207654_10143481
739 Ga0207654_10242515
740 Ga0207707_10201287
741 Ga0207695_10043013
742 Ga0207695_10229205
743 Ga0207695_10428023
744 Ga0207671_10011845
745 Ga0207671_10048576
746 Ga0207671_10696720
747 Ga0207693_10000245
748 Ga0207663_10179402
749 Ga0207660_10092930
750 Ga0207660_10178056
751 Ga0207662_10114687
752 Ga0207657_10215688
753 Ga0207657_10388223
754 Ga0207652_10249761
755 Ga0207652_10274087
756 Ga0207652_10620578
757 Ga0207650_10042068
758 Ga0207650_10279235
759 Ga0207659_10155728
760 Ga0207687_10171131
761 Ga0207687_10541397
762 Ga0207687_10771846
763 Ga0207700_10262545
764 Ga0207700_10563051
765 Ga0207664_10012413
766 Ga0207644_10115479
767 Ga0207644_10150250
768 Ga0207644_10721269
769 Ga0207690_10632746
770 Ga0207706_10097592
771 Ga0207706_10132385
772 Ga0207706_10225907
773 Ga0207686_10068407
774 Ga0207686_10247714
775 Ga0207670_10003235
776 Ga0207670_10077959
777 Ga0207669_10545076
778 Ga0207704_10039989
779 Ga0207704_10268791
780 Ga0207704_11086832
781 Ga0207665_10010871
782 Ga0207691_10025185
783 Ga0207691_10162710
784 Ga0207711_10004858
785 Ga0207711_10131390
786 Ga0207711_10488465
787 Ga0207711_10509972
788 Ga0207689_10031665
789 Ga0207689_10035429
790 Ga0207661_10120205
791 Ga0207661_10389337
792 Ga0207661_11003313
793 Ga0207679_10209565
794 Ga0207667_10002658
795 Ga0207667_10105779
796 Ga0207667_10490929
797 Ga0207651_10542948
798 Ga0207712_10505644
799 Ga0207712_11009325
800 Ga0207658_10017718
801 Ga0207658_10210254
802 Ga0207677_10019565
803 Ga0207677_10168383
804 Ga0207677_10217909
805 Ga0207677_10228836
806 Ga0207677_11009673
807 Ga0207703_10038017
808 Ga0207703_10164417
809 Ga0207639_10042788
810 Ga0207639_11004456
811 Ga0207678_10297286
812 Ga0207708_10120970
813 Ga0207702_10069066
814 Ga0207702_10218688
815 Ga0207641_10017714
816 Ga0207641_10200735
817 Ga0207641_10266045
818 Ga0207648_10016981
819 Ga0207648_10097930
820 Ga0207648_10108821
821 Ga0207648_10257841
822 Ga0207676_10107287
823 Ga0207676_10124778
824 Ga0207676_10897097
825 Ga0207674_10067855
826 Ga0207675_100006336
827 Ga0207675_100026791
828 Ga0207683_10005009
829 Ga0207683_10015593
830 Ga0207683_10029847
831 Ga0207683_10729525
832 Ga0207683_10924090
833 Ga0209998_10050917
834 Ga0265354_1001251
835 Ga0268266_10000001
836 Ga0268266_10116039
837 Ga0268266_10202255
838 Ga0268266_10488129
839 Ga0268266_10766397
840 Ga0268265_10033585
841 Ga0268264_10402309
842 Ga0268264_10701445
843 Ga0265334_10043623
844 Ga0265318_10001334
845 Ga0265318_10050005
846 Ga0265318_10059422
847 Ga0265770_1001557
848 Ga0265760_10000302
849 Ga0265316_10091790
850 Ga0307513_10009953
851 Ga0307513_10057690
852 Ga0307513_10216648
853 Ga0307408_100670666
854 Ga0265313_10008051
855 Ga0307514_10228548
856 Ga0265314_10008386
857 Ga0265314_10119105
858 Ga0307405_10649041
859 Ga0307410_10402579
860 Ga0307410_10531015
861 Ga0307416_100167733
862 Ga0307414_11114447
863 Ga0307411_10081023
864 Ga0307415_100107315
865 Ga0307415_100455350
866 Ga0373956_0030184
867 Ga0373956_0321531
868 Ga0373943_0115998
869 Ga0373955_0048591
870 Ga0373955_0071013
871 Ga0373955_0094305
872 Ga0373942_0137861
873 Ga0373962_0025372
874 Ga0373935_0506186
875 Ga0373927_0039001
876 Ga0373937_0020533
877 Ga0373937_0114946
878 Ga0373937_0184415
879 Ga0373937_0372528
880 Ga0395901_0320797
881 Ga0439465_0239595
882 Ga0451804_0361793
883 Ga0451841_0778883
884 Ga0450912_002279
885 Ga0450912_010826
886 Ga0450893_0014604
887 Ga0466969_0022778
888 Ga0466972_0131240
889 Ga0466966_0028050
890 Ga0466963_0228146
891 Ga0466970_0488688
892 Ga0466959_0005578
893 Ga0466959_0011655
894 Ga0466959_0054147
895 Ga0451576_0191817
896 Ga0451576_0197108
897 Ga0495580_0002011
898 Ga0495582_0566134
899 Ga0495616_0041642
900 Ga0495618_0239410
901 Ga0495628_0309477
902 Ga0495630_0151076
903 Ga0495652_0513930
904 Ga0495598_0003770
905 Ga0495645_0264721
906 Ga0495622_0169965
907 Ga0495625_0010233
908 Ga0495625_0351265
909 Ga0495635_0285427
910 Ga0495649_0073158
911 Ga0495674_0038540
912 Ga0495674_0237267
913 Ga0495683_0236006
914 Ga0495686_0109570
915 Ga0496100_0765655
916 Ga0496101_0142369
917 Ga0496102_0097034
918 Ga0496104_0068526
919 Ga0496106_0517896
920 Ga0496107_0011527
921 Ga0496108_0179830
922 Ga0496108_0585020
923 Ga0496109_0027144
924 Ga0496110_0000704
925 Ga0496111_0171407
926 Ga0496112_0211712
927 Ga0496112_1139604
928 Ga0496113_0154530
929 Ga0496114_0005266
930 Ga0496114_0012513
931 Ga0496114_0022876
932 Ga0496115_0012207
933 Ga0496117_0026790
934 Ga0496118_0000264
935 Ga0501032_0000604
936 Ga0501034_0030836
937 Ga0501034_0970102
938 Ga0501037_0105631
939 Ga0501037_0423225
940 Ga0501067_0000293
941 Ga0501067_0037841
942 Ga0501068_0001293
943 Ga0501068_0020955
944 Ga0501073_0000083
945 Ga0501073_0052254
946 Ga0501076_0352011
947 Ga0501077_0000088
948 Ga0501077_0081385
949 Ga0501079_0084045
950 Ga0501080_0004105
951 Ga0501080_0006575
952 Ga0501083_0100120
953 Ga0501044_0012503
954 Ga0501045_0692961
955 nmdc:mga0k408_121288_c1
956 nmdc:mga0k408_245289_c1
957 nmdc:mga08y16_70427_c1
958 nmdc:mga0n895_747867_c1
959 nmdc:mga0rr50_18128_c1
960 nmdc:mga08x19_146534_c1
961 Ga0495601_0005402
962 Ga0495612_0304218
963 Ga0500641_0001054
964 Ga0500641_0056572
965 Ga0500556_0024156
966 Ga0500562_057496
967 Ga0500595_002162
968 Ga0500595_071580
969 Ga0500573_0000009
970 Ga0500616_0053309
971 Ga0500624_079494
972 Ga0500630_238784
973 Ga0500645_002077
974 Ga0500587_000194
975 Ga0501084_0171461
976 Ga0501082_0002534
977 2644167427
978 2644347190

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00196

GerE

Bacterial regulatory proteins, luxR family

46

102

0.95

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

125

235

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
4wsz-assembly1.cif.gz_B crystal structure of the dna binding domains of wild type liar from e. faecalis 0.9871 15 69
4gvp-assembly1.cif.gz_A crystal structure of the response regulator protein vrar from staphylococcus aureus 0.9838 15 66
8a5s-assembly1.cif.gz_AAA crystal structure of light-activated dna-binding protein el222 from erythrobacter litoralis crystallized in dark, measured illuminated. 0.9828 15 67
1je8-assembly2.cif.gz_E two-component response regulator narl/dna complex: dna bending found in a high affinity site 0.9827 14 68
4wsz-assembly1.cif.gz_A crystal structure of the dna binding domains of wild type liar from e. faecalis 0.9819 15 69
ID Description Score Start End Superfamily
af_O53213_1064_1134_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9949 15 67 1.10.10.10
af_Q2FX97_3_207_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9934 15 67 3.40.50.2300
af_P31802_7_212_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9851 15 66 3.40.50.2300
4gvpA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9838 15 66 3.40.50.2300
af_P06993_830_894_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9825 15 67 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A4R7ZN98-F1-model_v4 Methylmalonyl-CoA epimerase 0.9664 87 206
AF-A0A7X3K4T0-F1-model_v4 VOC domain-containing protein 0.955 85 210
AF-A0A1E4KNB4-F1-model_v4 deleted 0.9536 89 210
AF-A0A4R7ZN98-F1-model_v4 Methylmalonyl-CoA epimerase 0.9506 87 206
AF-A0A3N5PLC3-F1-model_v4 VOC family protein 0.9499 85 210

Map