F453841

General Info

Members Datasets Scaffolds Average Seq Length
489 267 978 326

Family's Representative Sequence

Representative Sequence 3300046514|Ga0495618_0137209|Ga0495618_0137209_49_1134
Length 361
Sequence MPGAGRMLSGMTLPPERHRIRMRGRHLTSDRSREVFMEYVNLGSTGLRVSRICLGMMSFGDRSSRQWVLEEDAAEPLVKAAADGGVIFYDTADTYANGASEVVTGRLLGKLFRREDIVVATKVFSPMSDAENDRGLSRKHILAGIDNSLRRLGMDYVDLYQIHRWDPRTPVEETMEALHDVVKAGKARYIGASSMYAWQFAKAQHAAERHGWTRFVSMQNHYNLLYREEEREMIPQCIDQGVGVIPWSPLARGVLTGNRTRDGQRLTTRAGSDPFGDSLYSQADFDVVDAVAEVAAGRGVPAAQVALAWLLRRPGVTAPIVGTTKASHVDDALAAVKLDLTEEEIRRMEEHYVPHPVLGHR

Samples

Sample ID Description Type Environment
1 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
2 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
3 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
6 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
49 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
50 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
51 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
52 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
53 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
54 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
55 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
56 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
57 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
58 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
59 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
64 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
78 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
83 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
84 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
85 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
86 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
87 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
88 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
89 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
133 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
137 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
138 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
139 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
140 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
141 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
142 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
143 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
144 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
145 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
146 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
147 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
148 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
149 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
150 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
151 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
152 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
153 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
154 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
155 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
156 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
157 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
158 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
159 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
160 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
161 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
162 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
163 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
164 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
165 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
166 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
167 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
168 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
169 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
170 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
171 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
172 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
173 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
174 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
175 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
176 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
177 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
178 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
179 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
180 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
181 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
182 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
183 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
184 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
185 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
186 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
187 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
188 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
189 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
190 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
191 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
192 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
193 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
194 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
195 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
196 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
197 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
198 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
199 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
200 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
201 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
202 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
203 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
204 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
205 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
206 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
207 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
208 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
209 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
210 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
211 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
212 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
213 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
214 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
215 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
216 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
217 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
218 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
219 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
220 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
229 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
234 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
235 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
236 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
237 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
238 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
240 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
241 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
242 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
243 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
244 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
245 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
246 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
247 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
248 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
249 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
250 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
251 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
252 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
253 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
254 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
255 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
256 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
257 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
258 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
259 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
260 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
261 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
262 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
263 2808606372 Agromyces sp. 23-23 Isolate Unclassified
264 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
265 2884763398 Leifsonia sp. PS1209 Isolate Stem Tuber
266 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
267 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.57
Metatranscriptomes 0
Isolates 1.43

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.45
Nodule 0
Rhizoplane 5.32
Rhizosphere 88.75
Stem 0
Stem Tuber 0.2
Unclassified 0.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495618_0137209 3300046514 Bacteria 1565
2 JGI25162J39368_1008414 3300002737 Bacteria 1482
3 JGI25164J39214_1000445 3300002772 Bacteria 21955
4 JGI25406J46586_10030294 3300003203 Bacteria 2038
5 JGI25165J46597_1000107 3300003214 Bacteria 150846
6 Ga0058692_1000119 3300003856 Bacteria 50893
7 Ga0070658_10025597 3300005327 Bacteria 4729
8 Ga0070683_100002863 3300005329 Bacteria 13819
9 Ga0070683_100003716 3300005329 Bacteria 12443
10 Ga0070670_100000101 3300005331 Bacteria 79628
11 Ga0070670_100000770 3300005331 Bacteria 24907
12 Ga0070670_100003548 3300005331 Bacteria 12978
13 Ga0068869_100143417 3300005334 Bacteria 1846
14 Ga0070682_100012746 3300005337 Bacteria 4825
15 Ga0070660_100021295 3300005339 Bacteria 4778
16 Ga0070689_100058915 3300005340 Bacteria 2983
17 Ga0070692_10030529 3300005345 Bacteria 2695
18 Ga0070668_100000138 3300005347 Bacteria 45978
19 Ga0070668_100000294 3300005347 Bacteria 32833
20 Ga0070668_100000406 3300005347 Bacteria 28559
21 Ga0070668_100000416 3300005347 Bacteria 28331
22 Ga0070669_100147466 3300005353 Bacteria 1819
23 Ga0070671_100000425 3300005355 Bacteria 29406
24 Ga0070674_100195621 3300005356 Bacteria 1558
25 Ga0070667_100000146 3300005367 Bacteria 88847
26 Ga0070667_100000401 3300005367 Bacteria 46849
27 Ga0070667_100000926 3300005367 Bacteria 27083
28 Ga0070667_100002254 3300005367 Bacteria 16971
29 Ga0070667_100320873 3300005367 Bacteria 1398
30 Ga0070709_10000647 3300005434 Bacteria 19792
31 Ga0070714_100003363 3300005435 Bacteria 11923
32 Ga0070713_100001678 3300005436 Bacteria 14221
33 Ga0070713_100027213 3300005436 Bacteria 4500
34 Ga0070710_10003135 3300005437 Bacteria 7836
35 Ga0070701_10000007 3300005438 Bacteria 53673
36 Ga0070711_100002647 3300005439 Bacteria 10254
37 Ga0070700_100108593 3300005441 Bacteria 1840
38 Ga0070708_100165852 3300005445 Bacteria 2060
39 Ga0070708_100411798 3300005445 Bacteria 1275
40 Ga0070678_100148532 3300005456 Bacteria 1885
41 Ga0070685_10103269 3300005466 Bacteria 1744
42 Ga0070706_100188454 3300005467 Bacteria 1928
43 Ga0070707_100019509 3300005468 Bacteria 6388
44 Ga0070698_100001139 3300005471 Bacteria 29426
45 Ga0070698_100225030 3300005471 Bacteria 1809
46 Ga0070679_100232239 3300005530 Bacteria 1804
47 Ga0070684_100012029 3300005535 Bacteria 6917
48 Ga0070684_100019743 3300005535 Bacteria 5578
49 Ga0070684_100145334 3300005535 Bacteria 2146
50 Ga0070695_100004345 3300005545 Bacteria 8306
51 Ga0070665_100000915 3300005548 Bacteria 37838
52 Ga0070665_100002604 3300005548 Bacteria 19697
53 Ga0070665_100006821 3300005548 Bacteria 11614
54 Ga0070665_100013229 3300005548 Bacteria 8314
55 Ga0070665_100260719 3300005548 Bacteria 1735
56 Ga0068855_100163045 3300005563 Bacteria 2529
57 Ga0068855_100199552 3300005563 Bacteria 2253
58 Ga0068856_100020364 3300005614 Bacteria 6443
59 Ga0068856_100192274 3300005614 Bacteria 2054
60 Ga0070702_100125754 3300005615 Bacteria 1612
61 Ga0068859_100024211 3300005617 Bacteria 6092
62 Ga0068859_100443960 3300005617 Bacteria 1393
63 Ga0068864_100000137 3300005618 Bacteria 70702
64 Ga0068864_100000529 3300005618 Bacteria 32834
65 Ga0068864_100000658 3300005618 Bacteria 28843
66 Ga0068864_100008149 3300005618 Bacteria 8642
67 Ga0068866_10204582 3300005718 Bacteria 1181
68 Ga0068861_100306068 3300005719 Bacteria 1378
69 Ga0068863_100000165 3300005841 Bacteria 71079
70 Ga0068863_100000515 3300005841 Bacteria 39374
71 Ga0068863_100000736 3300005841 Bacteria 32808
72 Ga0068863_100001341 3300005841 Bacteria 24489
73 Ga0068858_100003996 3300005842 Bacteria 14552
74 Ga0068858_100010783 3300005842 Bacteria 8640
75 Ga0068858_100019174 3300005842 Bacteria 6399
76 Ga0068858_100027765 3300005842 Bacteria 5258
77 Ga0068858_100058691 3300005842 Bacteria 3558
78 Ga0068860_100000076 3300005843 Bacteria 171786
79 Ga0068860_100000501 3300005843 Bacteria 48658
80 Ga0068860_100000581 3300005843 Bacteria 43890
81 Ga0068860_100006101 3300005843 Bacteria 12127
82 Ga0068862_100000129 3300005844 Bacteria 88141
83 Ga0068862_100000874 3300005844 Bacteria 29378
84 Ga0068862_100006339 3300005844 Bacteria 9833
85 Ga0068862_100107249 3300005844 Bacteria 2449
86 Ga0081455_10019486 3300005937 Bacteria 6418
87 Ga0081538_10005567 3300005981 Bacteria 11304
88 Ga0081539_10032007 3300005985 Bacteria 3229
89 Ga0070717_10020848 3300006028 Bacteria 5159
90 Ga0070717_10084338 3300006028 Bacteria 2673
91 Ga0070717_10113220 3300006028 Bacteria 2316
92 Ga0075364_10012387 3300006051 Bacteria 5215
93 Ga0070712_100003938 3300006175 Bacteria 9143
94 Ga0070712_100051989 3300006175 Bacteria 2856
95 Ga0075428_100018339 3300006844 Bacteria 7736
96 Ga0075430_100096119 3300006846 Bacteria 2476
97 Ga0075431_100018921 3300006847 Bacteria 7016
98 Ga0075433_10026890 3300006852 Bacteria 4876
99 Ga0075433_10099037 3300006852 Bacteria 2581
100 Ga0075433_10191259 3300006852 Bacteria 1821
101 Ga0075434_100011898 3300006871 Bacteria 8229
102 Ga0075429_100004057 3300006880 Bacteria 12543
103 Ga0068865_100071701 3300006881 Bacteria 2458
104 Ga0075436_100319925 3300006914 Bacteria 1115
105 Ga0097620_100024213 3300006931 Bacteria 6092
106 Ga0097620_100443962 3300006931 Bacteria 1393
107 Ga0075435_100050305 3300007076 Bacteria 3353
108 Ga0075435_100213782 3300007076 Bacteria 1636
109 Ga0099794_10023869 3300007265 Bacteria 2802
110 Ga0105240_10002529 3300009093 Bacteria 29354
111 Ga0105245_10078948 3300009098 Bacteria 3004
112 Ga0105245_10294231 3300009098 Bacteria 1591
113 Ga0105247_10020928 3300009101 Bacteria 3935
114 Ga0114129_10131464 3300009147 Bacteria 3437
115 Ga0114129_10399506 3300009147 Bacteria 1811
116 Ga0114129_10818655 3300009147 Bacteria 1186
117 Ga0114129_10908068 3300009147 Bacteria 1115
118 Ga0105243_10147319 3300009148 Bacteria 2016
119 Ga0105243_10517956 3300009148 Bacteria 1134
120 Ga0105241_10036343 3300009174 Bacteria 3706
121 Ga0105241_10164005 3300009174 Bacteria 1829
122 Ga0105242_10084293 3300009176 Bacteria 2663
123 Ga0105248_10033767 3300009177 Bacteria 5717
124 Ga0105248_10122712 3300009177 Bacteria 2931
125 Ga0105248_10273570 3300009177 Bacteria 1902
126 Ga0105237_10411305 3300009545 Bacteria 1358
127 Ga0105238_10304293 3300009551 Bacteria 1578
128 Ga0105249_10000337 3300009553 Bacteria 47466
129 Ga0105249_10000667 3300009553 Bacteria 31155
130 Ga0105249_10000697 3300009553 Bacteria 30479
131 Ga0105249_10004403 3300009553 Bacteria 12179
132 Ga0105249_10085579 3300009553 Bacteria 2938
133 Ga0105239_10005281 3300010375 Bacteria 15180
134 Ga0105239_10088395 3300010375 Bacteria 3416
135 Ga0105239_10135453 3300010375 Bacteria 2742
136 Ga0157370_10103165 3300013104 Bacteria 2670
137 Ga0157369_10023659 3300013105 Bacteria 6843
138 Ga0157369_10026527 3300013105 Bacteria 6426
139 Ga0163162_10002659 3300013306 Bacteria 16932
140 Ga0163162_10008536 3300013306 Bacteria 9989
141 Ga0163162_10136704 3300013306 Bacteria 2562
142 Ga0163162_10436849 3300013306 Bacteria 1441
143 Ga0157375_10017625 3300013308 Bacteria 6449
144 Ga0163163_10026238 3300014325 Bacteria 5566
145 Ga0163163_10040744 3300014325 Bacteria 4538
146 Ga0157380_10138715 3300014326 Bacteria 2086
147 Ga0157380_10237721 3300014326 Bacteria 1640
148 Ga0157380_10314756 3300014326 Bacteria 1448
149 Ga0157379_10007213 3300014968 Bacteria 9616
150 Ga0157379_10022513 3300014968 Bacteria 5581
151 Ga0157379_10025238 3300014968 Bacteria 5277
152 Ga0157379_10050493 3300014968 Bacteria 3713
153 Ga0213876_10007232 3300021384 Bacteria 6053
154 Ga0213875_10000126 3300021388 Bacteria 84171
155 Ga0213875_10001924 3300021388 Bacteria 12862
156 Ga0207427_100028 3300025231 Bacteria 388949
157 Ga0207427_101814 3300025231 Bacteria 6832
158 Ga0209437_100561 3300025233 Bacteria 24582
159 Ga0209233_1000001 3300025261 Bacteria 2992747
160 Ga0209233_1003205 3300025261 Bacteria 5798
161 Ga0207697_10052241 3300025315 Bacteria 1691
162 Ga0207692_10000145 3300025898 Bacteria 22081
163 Ga0207680_10006816 3300025903 Bacteria 5542
164 Ga0207680_10009398 3300025903 Bacteria 4850
165 Ga0207647_10015991 3300025904 Bacteria 5129
166 Ga0207699_10043219 3300025906 Bacteria 2616
167 Ga0207643_10015181 3300025908 Bacteria 4191
168 Ga0207705_10067816 3300025909 Bacteria 2582
169 Ga0207654_10260163 3300025911 Bacteria 1166
170 Ga0207707_10359160 3300025912 Bacteria 1254
171 Ga0207695_10006572 3300025913 Bacteria 15042
172 Ga0207693_10014616 3300025915 Bacteria 6307
173 Ga0207693_10061497 3300025915 Bacteria 2941
174 Ga0207663_10000523 3300025916 Bacteria 16877
175 Ga0207663_10082378 3300025916 Bacteria 2110
176 Ga0207657_10009690 3300025919 Bacteria 9663
177 Ga0207657_10049555 3300025919 Bacteria 3659
178 Ga0207652_10016017 3300025921 Bacteria 6113
179 Ga0207646_10000105 3300025922 Bacteria 114126
180 Ga0207681_10127116 3300025923 Bacteria 1879
181 Ga0207694_10245561 3300025924 Bacteria 1464
182 Ga0207650_10000014 3300025925 Bacteria 398063
183 Ga0207650_10000064 3300025925 Bacteria 142969
184 Ga0207650_10000443 3300025925 Bacteria 35591
185 Ga0207650_10215887 3300025925 Bacteria 1542
186 Ga0207687_10078353 3300025927 Bacteria 2379
187 Ga0207687_10162798 3300025927 Bacteria 1714
188 Ga0207700_10001505 3300025928 Bacteria 13191
189 Ga0207700_10002742 3300025928 Bacteria 10153
190 Ga0207700_10037009 3300025928 Bacteria 3530
191 Ga0207700_10061879 3300025928 Bacteria 2840
192 Ga0207664_10001607 3300025929 Bacteria 14864
193 Ga0207664_10053134 3300025929 Bacteria 3206
194 Ga0207664_10055702 3300025929 Bacteria 3138
195 Ga0207664_10276218 3300025929 Bacteria 1473
196 Ga0207644_10002020 3300025931 Bacteria 13112
197 Ga0207690_10076735 3300025932 Bacteria 2321
198 Ga0207686_10045797 3300025934 Bacteria 2693
199 Ga0207704_10063227 3300025938 Bacteria 2306
200 Ga0207665_10002163 3300025939 Bacteria 13285
201 Ga0207665_10010853 3300025939 Bacteria 5982
202 Ga0207711_10116183 3300025941 Bacteria 2385
203 Ga0207711_10197546 3300025941 Bacteria 1835
204 Ga0207711_10203115 3300025941 Bacteria 1809
205 Ga0207711_10253796 3300025941 Bacteria 1615
206 Ga0207689_10173822 3300025942 Bacteria 1776
207 Ga0207661_10014924 3300025944 Bacteria 5703
208 Ga0207661_10033320 3300025944 Bacteria 3997
209 Ga0207661_10118563 3300025944 Bacteria 2250
210 Ga0207661_10176612 3300025944 Bacteria 1862
211 Ga0207667_10147410 3300025949 Bacteria 2422
212 Ga0207667_10147906 3300025949 Bacteria 2418
213 Ga0207667_10170976 3300025949 Bacteria 2233
214 Ga0207651_10312577 3300025960 Bacteria 1311
215 Ga0207712_10000639 3300025961 Bacteria 27522
216 Ga0207712_10001014 3300025961 Bacteria 19999
217 Ga0207668_10000238 3300025972 Bacteria 36931
218 Ga0207668_10000307 3300025972 Bacteria 32051
219 Ga0207668_10000349 3300025972 Bacteria 30027
220 Ga0207658_10000167 3300025986 Bacteria 70202
221 Ga0207658_10000541 3300025986 Bacteria 34227
222 Ga0207658_10001695 3300025986 Bacteria 16735
223 Ga0207658_10002307 3300025986 Bacteria 14075
224 Ga0207677_10192393 3300026023 Bacteria 1615
225 Ga0207703_10004051 3300026035 Bacteria 12102
226 Ga0207703_10007835 3300026035 Bacteria 8449
227 Ga0207703_10019719 3300026035 Bacteria 5272
228 Ga0207703_10022783 3300026035 Bacteria 4919
229 Ga0207703_10036985 3300026035 Bacteria 3888
230 Ga0207703_10044467 3300026035 Bacteria 3569
231 Ga0207678_10182865 3300026067 Bacteria 1790
232 Ga0207708_10081740 3300026075 Bacteria 2483
233 Ga0207702_10060779 3300026078 Bacteria 3221
234 Ga0207641_10000759 3300026088 Bacteria 34711
235 Ga0207641_10000768 3300026088 Bacteria 34388
236 Ga0207641_10001186 3300026088 Bacteria 26142
237 Ga0207676_10000164 3300026095 Bacteria 57910
238 Ga0207676_10000302 3300026095 Bacteria 42408
239 Ga0207676_10001375 3300026095 Bacteria 18086
240 Ga0207676_10119879 3300026095 Bacteria 2216
241 Ga0207674_10011985 3300026116 Bacteria 9716
242 Ga0207675_100258058 3300026118 Bacteria 1688
243 Ga0207675_100316423 3300026118 Bacteria 1523
244 Ga0207428_10005378 3300027907 Bacteria 11949
245 Ga0268266_10003199 3300028379 Bacteria 16571
246 Ga0268266_10004832 3300028379 Bacteria 12793
247 Ga0268266_10008713 3300028379 Bacteria 8989
248 Ga0268266_10012987 3300028379 Bacteria 7181
249 Ga0268266_10126214 3300028379 Bacteria 2284
250 Ga0268265_10000677 3300028380 Bacteria 33608
251 Ga0268265_10000959 3300028380 Bacteria 26502
252 Ga0268264_10000118 3300028381 Bacteria 193487
253 Ga0268264_10000139 3300028381 Bacteria 171848
254 Ga0268264_10000396 3300028381 Bacteria 62748
255 Ga0268264_10000477 3300028381 Bacteria 53721
256 Ga0268264_10065289 3300028381 Bacteria 3066
257 Ga0265337_1006614 3300028556 Bacteria 4446
258 Ga0265336_10002526 3300028666 Bacteria 7489
259 Ga0265338_10001804 3300028800 Bacteria 33690
260 Ga0265338_10003697 3300028800 Bacteria 21293
261 Ga0265332_10024342 3300031238 Bacteria 2664
262 Ga0265314_10092417 3300031711 Bacteria 1967
263 Ga0307407_10123075 3300031903 Bacteria 1648
264 Ga0373934_0004348 3300035086 Bacteria 5233
265 Ga0373923_0078317 3300035111 Bacteria 1430
266 Ga0373936_0000767 3300035113 Bacteria 11287
267 Ga0373953_0044364 3300035117 Bacteria 1777
268 Ga0373954_0051704 3300035118 Bacteria 1930
269 Ga0373956_0000197 3300035119 Bacteria 23300
270 Ga0373956_0014593 3300035119 Bacteria 3284
271 Ga0373957_0000205 3300035120 Bacteria 15014
272 Ga0373957_0008995 3300035120 Bacteria 3256
273 Ga0373943_0034381 3300035170 Bacteria 2418
274 Ga0373955_0000009 3300035172 Bacteria 81129
275 Ga0373955_0019260 3300035172 Bacteria 3407
276 Ga0373924_0007172 3300035410 Bacteria 4017
277 Ga0373924_0011343 3300035410 Bacteria 3308
278 Ga0373935_0028126 3300035692 Bacteria 3474
279 Ga0373935_0066359 3300035692 Bacteria 2318
280 Ga0373933_0000006 3300035724 Bacteria 125141
281 Ga0373933_0023649 3300035724 Bacteria 3512
282 Ga0373937_0000137 3300036401 Bacteria 70670
283 Ga0373937_0157580 3300036401 Bacteria 2128
284 Ga0395899_0143448 3300037312 Bacteria 1698
285 Ga0395900_0042836 3300037418 Bacteria 4664
286 Ga0395898_0009582 3300037466 Bacteria 10171
287 Ga0395898_0140874 3300037466 Bacteria 2309
288 Ga0395905_0048943 3300037471 Bacteria 3961
289 Ga0436364_0072848 3300037853 Bacteria 133330
290 Ga0436364_0163932 3300037853 Bacteria 4227
291 Ga0436364_0928095 3300037853 Bacteria 1744
292 Ga0436364_1249363 3300037853 Bacteria 26499
293 Ga0395901_0006124 3300038443 Bacteria 12189
294 Ga0395901_0261877 3300038443 Bacteria 1800
295 Ga0436365_1114817 3300039437 Bacteria 7487
296 Ga0436360_1034821 3300039438 Bacteria 1386
297 Ga0439448_0009279 3300042005 Bacteria 2898
298 Ga0466961_0146511 3300044693 Bacteria 1476
299 Ga0466963_0041337 3300044694 Bacteria 3024
300 Ga0466963_0183708 3300044694 Bacteria 1460
301 Ga0451576_0250522 3300045051 Bacteria 1851
302 Ga0466958_0086807 3300045836 Bacteria 1931
303 Ga0466958_0181662 3300045836 Bacteria 1335
304 Ga0466967_0095029 3300045976 Bacteria 2716
305 Ga0495592_0000426 3300046454 Bacteria 31916
306 Ga0495629_0001026 3300046459 Bacteria 22402
307 Ga0495651_0000082 3300046462 Bacteria 69575
308 Ga0495653_0007724 3300046463 Bacteria 8798
309 Ga0495580_0090112 3300046472 Bacteria 2135
310 Ga0495582_0015546 3300046473 Bacteria 4180
311 Ga0495662_0025771 3300046476 Bacteria 2840
312 Ga0495664_0005192 3300046477 Bacteria 7145
313 Ga0495608_0000328 3300046511 Bacteria 33529
314 Ga0495628_0000542 3300046516 Bacteria 34709
315 Ga0495628_0183455 3300046516 Bacteria 1582
316 Ga0495630_0126283 3300046517 Bacteria 1941
317 Ga0495652_0000273 3300046529 Bacteria 61215
318 Ga0495665_0004517 3300046531 Bacteria 7509
319 Ga0495586_0006891 3300046535 Bacteria 6056
320 Ga0495587_0000070 3300046536 Bacteria 85402
321 Ga0495587_0127786 3300046536 Bacteria 1453
322 Ga0495645_0071718 3300046543 Bacteria 2497
323 Ga0495645_0119848 3300046543 Bacteria 1853
324 Ga0495667_0000048 3300046559 Bacteria 117509
325 Ga0495667_0093623 3300046559 Bacteria 1945
326 Ga0495634_0018529 3300046642 Bacteria 4956
327 Ga0495635_0068647 3300046663 Bacteria 2431
328 Ga0495657_0000046 3300046675 Bacteria 106064
329 Ga0495599_0000023 3300046678 Bacteria 125139
330 Ga0495599_0088421 3300046678 Bacteria 1934
331 Ga0495623_0000306 3300046679 Bacteria 31838
332 Ga0495646_0015170 3300046680 Bacteria 4893
333 Ga0495658_0007664 3300046683 Bacteria 5352
334 Ga0495658_0168027 3300046683 Bacteria 1356
335 Ga0495669_0000004 3300046684 Bacteria 208878
336 Ga0495669_0012547 3300046684 Bacteria 3608
337 Ga0495613_0009017 3300046689 Bacteria 7399
338 Ga0495624_0003586 3300046690 Bacteria 11491
339 Ga0495600_0005149 3300046809 Bacteria 7862
340 Ga0495600_0223908 3300046809 Bacteria 1203
341 Ga0495581_0015109 3300047315 Bacteria 4482
342 Ga0495604_0000037 3300047317 Bacteria 125140
343 Ga0495674_0018991 3300047319 Bacteria 6391
344 Ga0495674_0169023 3300047319 Bacteria 1825
345 Ga0495674_0377152 3300047319 Bacteria 1148
346 Ga0495680_0000240 3300047322 Bacteria 60299
347 Ga0495680_0043975 3300047322 Bacteria 3533
348 Ga0495680_0073523 3300047322 Bacteria 2598
349 Ga0495680_0107648 3300047322 Bacteria 2070
350 Ga0495675_0004564 3300047444 Bacteria 8399
351 Ga0495675_0113918 3300047444 Bacteria 1686
352 Ga0495677_0100591 3300047445 Bacteria 1094
353 Ga0495593_0011933 3300047673 Bacteria 4981
354 Ga0495602_0000127 3300048088 Bacteria 71692
355 Ga0495614_0049009 3300048089 Bacteria 1811
356 Ga0496101_0014491 3300048904 Bacteria 5300
357 Ga0496102_0107608 3300048905 Bacteria 2596
358 Ga0496102_0228816 3300048905 Bacteria 1753
359 Ga0496103_0041058 3300048906 Bacteria 2844
360 Ga0496103_0075809 3300048906 Bacteria 2110
361 Ga0496103_0106082 3300048906 Bacteria 1782
362 Ga0496104_0000353 3300048907 Bacteria 41013
363 Ga0496105_0001922 3300048908 Bacteria 14934
364 Ga0496105_0003836 3300048908 Bacteria 11216
365 Ga0496105_0120650 3300048908 Bacteria 2162
366 Ga0496105_0303117 3300048908 Bacteria 1284
367 Ga0496106_0039428 3300048909 Bacteria 3537
368 Ga0496106_0112771 3300048909 Bacteria 2119
369 Ga0496108_0010589 3300048911 Bacteria 7484
370 Ga0496108_0025365 3300048911 Bacteria 4884
371 Ga0496109_0032754 3300048912 Bacteria 4674
372 Ga0496109_0039949 3300048912 Bacteria 4248
373 Ga0496110_0083693 3300048913 Bacteria 2846
374 Ga0496110_0356926 3300048913 Bacteria 1332
375 Ga0496112_0001676 3300048915 Bacteria 17233
376 Ga0496112_0282575 3300048915 Bacteria 1606
377 Ga0496112_0361952 3300048915 Bacteria 1392
378 Ga0496112_0492213 3300048915 Unclassified 1162
379 Ga0496114_0100537 3300048917 Bacteria 2468
380 Ga0496115_0000470 3300048918 Bacteria 32145
381 Ga0496115_0190542 3300048918 Bacteria 1694
382 Ga0496121_0018567 3300048924 Bacteria 7005
383 Ga0496121_0086763 3300048924 Bacteria 2459
384 Ga0496126_0263382 3300048929 Bacteria 1433
385 Ga0501031_0002463 3300049568 Bacteria 11812
386 Ga0501031_0044166 3300049568 Bacteria 2908
387 Ga0501031_0082685 3300049568 Bacteria 2093
388 Ga0501032_0009575 3300049569 Bacteria 7024
389 Ga0501032_0036749 3300049569 Bacteria 3342
390 Ga0501033_0005497 3300049570 Bacteria 10033
391 Ga0501033_0024656 3300049570 Bacteria 4535
392 Ga0501033_0049844 3300049570 Bacteria 3108
393 Ga0501033_0083089 3300049570 Bacteria 2348
394 Ga0501033_0112152 3300049570 Bacteria 1984
395 Ga0501034_0000584 3300049571 Bacteria 57652
396 Ga0501034_0010959 3300049571 Bacteria 9416
397 Ga0501034_0026329 3300049571 Bacteria 5924
398 Ga0501034_0039210 3300049571 Bacteria 4798
399 Ga0501034_0262901 3300049571 Bacteria 1668
400 Ga0501036_0003309 3300049572 Bacteria 12861
401 Ga0501036_0070382 3300049572 Bacteria 2958
402 Ga0501036_0087007 3300049572 Bacteria 2641
403 Ga0501036_0114536 3300049572 Bacteria 2279
404 Ga0501036_0530427 3300049572 Bacteria 979
405 Ga0501037_0000337 3300049573 Bacteria 39757
406 Ga0501037_0003832 3300049573 Bacteria 10915
407 Ga0501037_0004261 3300049573 Bacteria 10367
408 Ga0501037_0070261 3300049573 Bacteria 2548
409 Ga0501038_0000574 3300049574 Bacteria 32515
410 Ga0501038_0014636 3300049574 Bacteria 7148
411 Ga0501038_0054944 3300049574 Bacteria 3423
412 Ga0501038_0067425 3300049574 Bacteria 3044
413 Ga0501038_0099806 3300049574 Bacteria 2419
414 Ga0501038_0160560 3300049574 Bacteria 1827
415 Ga0501039_0079959 3300049575 Bacteria 2544
416 Ga0501039_0104126 3300049575 Bacteria 2215
417 Ga0501042_0003423 3300049578 Bacteria 9966
418 Ga0501042_0015263 3300049578 Bacteria 5258
419 Ga0501042_0015873 3300049578 Bacteria 5163
420 Ga0501042_0089747 3300049578 Bacteria 2205
421 Ga0501043_0026730 3300049579 Bacteria 4527
422 Ga0501043_0028775 3300049579 Bacteria 4362
423 Ga0501043_0056286 3300049579 Bacteria 3089
424 Ga0501046_0003519 3300049580 Bacteria 14346
425 Ga0501046_0010819 3300049580 Bacteria 7822
426 Ga0501047_0003789 3300049581 Bacteria 14231
427 Ga0501047_0056574 3300049581 Bacteria 3793
428 Ga0501047_0236743 3300049581 Bacteria 1677
429 Ga0501048_0002163 3300049582 Bacteria 14971
430 Ga0501048_0003021 3300049582 Bacteria 12841
431 Ga0501067_0006643 3300049583 Bacteria 6417
432 Ga0501070_0049496 3300049586 Bacteria 3490
433 Ga0501073_0003635 3300049589 Bacteria 11593
434 Ga0501073_0019234 3300049589 Bacteria 4934
435 Ga0501073_0281094 3300049589 Bacteria 1148
436 Ga0501080_0021316 3300049742 Bacteria 5998
437 Ga0501080_0396400 3300049742 Bacteria 1242
438 Ga0501080_0430542 3300049742 Bacteria 1184
439 Ga0501081_0046239 3300049743 Bacteria 2991
440 Ga0501035_0003758 3300049822 Bacteria 14467
441 Ga0501035_0010477 3300049822 Bacteria 8591
442 Ga0501035_0020019 3300049822 Bacteria 6147
443 Ga0501035_0022057 3300049822 Bacteria 5850
444 Ga0501035_0043807 3300049822 Bacteria 4032
445 Ga0501035_0124762 3300049822 Bacteria 2248
446 Ga0501035_0201913 3300049822 Bacteria 1704
447 Ga0501044_0017404 3300049823 Bacteria 7710
448 Ga0501044_0036074 3300049823 Bacteria 5175
449 Ga0501044_0048235 3300049823 Bacteria 4400
450 Ga0501044_0071110 3300049823 Bacteria 3538
451 Ga0501044_0212227 3300049823 Bacteria 1889
452 Ga0501044_0264926 3300049823 Bacteria 1656
453 Ga0501045_0009199 3300049824 Bacteria 6904
454 Ga0501045_0027648 3300049824 Bacteria 4090
455 nmdc:mga0yw44_80502_c1 3300050492 Bacteria 2040
456 nmdc:mga05p37_1977_c1 3300050507 Bacteria 23895
457 nmdc:mga05p37_250607_c1 3300050507 Bacteria 2124
458 nmdc:mga05p37_478707_c1 3300050507 Bacteria 1435
459 nmdc:mga09592_50_c1 3300050508 Bacteria 66313
460 nmdc:mga0qj67_120246_c1 3300050509 Bacteria 2124
461 nmdc:mga0qj67_74669_c1 3300050509 Bacteria 2709
462 nmdc:mga06r32_12_c1 3300050510 Bacteria 111318
463 nmdc:mga06r32_26377_c1 3300050510 Bacteria 5416
464 nmdc:mga08y16_2008_c1 3300050511 Bacteria 20813
465 nmdc:mga0n895_16241_c1 3300050512 Bacteria 6825
466 nmdc:mga0n895_3601_c1 3300050512 Bacteria 12521
467 nmdc:mga0rr50_10606_c1 3300050513 Bacteria 5857
468 nmdc:mga0rr50_22297_c1 3300050513 Bacteria 4344
469 nmdc:mga0a205_126965_c1 3300050515 Bacteria 2450
470 nmdc:mga0a205_43804_c1 3300050515 Bacteria 4314
471 Ga0495601_0044583 3300053077 Bacteria 2788
472 Ga0495601_0048356 3300053077 Bacteria 2678
473 Ga0495612_0015562 3300053078 Bacteria 3049
474 Ga0500635_0011607 3300053080 Bacteria 2509
475 Ga0495595_0052399 3300053084 Bacteria 1893
476 Ga0495619_0051037 3300053085 Bacteria 2732
477 Ga0500566_0014891 3300053094 Bacteria 4568
478 Ga0501084_0314467 3300054114 Bacteria 1323
479 Ga0590071_000099 3300059421 Bacteria 24341
480 Ga0590074_000331 3300059423 Bacteria 6565
481 Ga0590075_000144 3300059424 Bacteria 18953
482 Ga0590077_002109 3300059426 Bacteria 4348
483 2644039535 2643221605 Bacteria 4772303
484 2676491028 2675903060 Bacteria 10051191
485 2808903057 2808606372 Bacteria 4649509
486 2884701028 2884693830 Bacteria 11273186
487 2884766778 2884763398 Bacteria 4091164
488 2895436027 2895427314 Bacteria 13147766
489 2895452250 2895442618 Bacteria 11027144
490 Ga0495618_0137209
491 JGI25162J39368_1008414
492 JGI25164J39214_1000445
493 JGI25406J46586_10030294
494 JGI25165J46597_1000107
495 Ga0058692_1000119
496 Ga0070658_10025597
497 Ga0070683_100002863
498 Ga0070683_100003716
499 Ga0070670_100000101
500 Ga0070670_100000770
501 Ga0070670_100003548
502 Ga0068869_100143417
503 Ga0070682_100012746
504 Ga0070660_100021295
505 Ga0070689_100058915
506 Ga0070692_10030529
507 Ga0070668_100000138
508 Ga0070668_100000294
509 Ga0070668_100000406
510 Ga0070668_100000416
511 Ga0070669_100147466
512 Ga0070671_100000425
513 Ga0070674_100195621
514 Ga0070667_100000146
515 Ga0070667_100000401
516 Ga0070667_100000926
517 Ga0070667_100002254
518 Ga0070667_100320873
519 Ga0070709_10000647
520 Ga0070714_100003363
521 Ga0070713_100001678
522 Ga0070713_100027213
523 Ga0070710_10003135
524 Ga0070701_10000007
525 Ga0070711_100002647
526 Ga0070700_100108593
527 Ga0070708_100165852
528 Ga0070708_100411798
529 Ga0070678_100148532
530 Ga0070685_10103269
531 Ga0070706_100188454
532 Ga0070707_100019509
533 Ga0070698_100001139
534 Ga0070698_100225030
535 Ga0070679_100232239
536 Ga0070684_100012029
537 Ga0070684_100019743
538 Ga0070684_100145334
539 Ga0070695_100004345
540 Ga0070665_100000915
541 Ga0070665_100002604
542 Ga0070665_100006821
543 Ga0070665_100013229
544 Ga0070665_100260719
545 Ga0068855_100163045
546 Ga0068855_100199552
547 Ga0068856_100020364
548 Ga0068856_100192274
549 Ga0070702_100125754
550 Ga0068859_100024211
551 Ga0068859_100443960
552 Ga0068864_100000137
553 Ga0068864_100000529
554 Ga0068864_100000658
555 Ga0068864_100008149
556 Ga0068866_10204582
557 Ga0068861_100306068
558 Ga0068863_100000165
559 Ga0068863_100000515
560 Ga0068863_100000736
561 Ga0068863_100001341
562 Ga0068858_100003996
563 Ga0068858_100010783
564 Ga0068858_100019174
565 Ga0068858_100027765
566 Ga0068858_100058691
567 Ga0068860_100000076
568 Ga0068860_100000501
569 Ga0068860_100000581
570 Ga0068860_100006101
571 Ga0068862_100000129
572 Ga0068862_100000874
573 Ga0068862_100006339
574 Ga0068862_100107249
575 Ga0081455_10019486
576 Ga0081538_10005567
577 Ga0081539_10032007
578 Ga0070717_10020848
579 Ga0070717_10084338
580 Ga0070717_10113220
581 Ga0075364_10012387
582 Ga0070712_100003938
583 Ga0070712_100051989
584 Ga0075428_100018339
585 Ga0075430_100096119
586 Ga0075431_100018921
587 Ga0075433_10026890
588 Ga0075433_10099037
589 Ga0075433_10191259
590 Ga0075434_100011898
591 Ga0075429_100004057
592 Ga0068865_100071701
593 Ga0075436_100319925
594 Ga0097620_100024213
595 Ga0097620_100443962
596 Ga0075435_100050305
597 Ga0075435_100213782
598 Ga0099794_10023869
599 Ga0105240_10002529
600 Ga0105245_10078948
601 Ga0105245_10294231
602 Ga0105247_10020928
603 Ga0114129_10131464
604 Ga0114129_10399506
605 Ga0114129_10818655
606 Ga0114129_10908068
607 Ga0105243_10147319
608 Ga0105243_10517956
609 Ga0105241_10036343
610 Ga0105241_10164005
611 Ga0105242_10084293
612 Ga0105248_10033767
613 Ga0105248_10122712
614 Ga0105248_10273570
615 Ga0105237_10411305
616 Ga0105238_10304293
617 Ga0105249_10000337
618 Ga0105249_10000667
619 Ga0105249_10000697
620 Ga0105249_10004403
621 Ga0105249_10085579
622 Ga0105239_10005281
623 Ga0105239_10088395
624 Ga0105239_10135453
625 Ga0157370_10103165
626 Ga0157369_10023659
627 Ga0157369_10026527
628 Ga0163162_10002659
629 Ga0163162_10008536
630 Ga0163162_10136704
631 Ga0163162_10436849
632 Ga0157375_10017625
633 Ga0163163_10026238
634 Ga0163163_10040744
635 Ga0157380_10138715
636 Ga0157380_10237721
637 Ga0157380_10314756
638 Ga0157379_10007213
639 Ga0157379_10022513
640 Ga0157379_10025238
641 Ga0157379_10050493
642 Ga0213876_10007232
643 Ga0213875_10000126
644 Ga0213875_10001924
645 Ga0207427_100028
646 Ga0207427_101814
647 Ga0209437_100561
648 Ga0209233_1000001
649 Ga0209233_1003205
650 Ga0207697_10052241
651 Ga0207692_10000145
652 Ga0207680_10006816
653 Ga0207680_10009398
654 Ga0207647_10015991
655 Ga0207699_10043219
656 Ga0207643_10015181
657 Ga0207705_10067816
658 Ga0207654_10260163
659 Ga0207707_10359160
660 Ga0207695_10006572
661 Ga0207693_10014616
662 Ga0207693_10061497
663 Ga0207663_10000523
664 Ga0207663_10082378
665 Ga0207657_10009690
666 Ga0207657_10049555
667 Ga0207652_10016017
668 Ga0207646_10000105
669 Ga0207681_10127116
670 Ga0207694_10245561
671 Ga0207650_10000014
672 Ga0207650_10000064
673 Ga0207650_10000443
674 Ga0207650_10215887
675 Ga0207687_10078353
676 Ga0207687_10162798
677 Ga0207700_10001505
678 Ga0207700_10002742
679 Ga0207700_10037009
680 Ga0207700_10061879
681 Ga0207664_10001607
682 Ga0207664_10053134
683 Ga0207664_10055702
684 Ga0207664_10276218
685 Ga0207644_10002020
686 Ga0207690_10076735
687 Ga0207686_10045797
688 Ga0207704_10063227
689 Ga0207665_10002163
690 Ga0207665_10010853
691 Ga0207711_10116183
692 Ga0207711_10197546
693 Ga0207711_10203115
694 Ga0207711_10253796
695 Ga0207689_10173822
696 Ga0207661_10014924
697 Ga0207661_10033320
698 Ga0207661_10118563
699 Ga0207661_10176612
700 Ga0207667_10147410
701 Ga0207667_10147906
702 Ga0207667_10170976
703 Ga0207651_10312577
704 Ga0207712_10000639
705 Ga0207712_10001014
706 Ga0207668_10000238
707 Ga0207668_10000307
708 Ga0207668_10000349
709 Ga0207658_10000167
710 Ga0207658_10000541
711 Ga0207658_10001695
712 Ga0207658_10002307
713 Ga0207677_10192393
714 Ga0207703_10004051
715 Ga0207703_10007835
716 Ga0207703_10019719
717 Ga0207703_10022783
718 Ga0207703_10036985
719 Ga0207703_10044467
720 Ga0207678_10182865
721 Ga0207708_10081740
722 Ga0207702_10060779
723 Ga0207641_10000759
724 Ga0207641_10000768
725 Ga0207641_10001186
726 Ga0207676_10000164
727 Ga0207676_10000302
728 Ga0207676_10001375
729 Ga0207676_10119879
730 Ga0207674_10011985
731 Ga0207675_100258058
732 Ga0207675_100316423
733 Ga0207428_10005378
734 Ga0268266_10003199
735 Ga0268266_10004832
736 Ga0268266_10008713
737 Ga0268266_10012987
738 Ga0268266_10126214
739 Ga0268265_10000677
740 Ga0268265_10000959
741 Ga0268264_10000118
742 Ga0268264_10000139
743 Ga0268264_10000396
744 Ga0268264_10000477
745 Ga0268264_10065289
746 Ga0265337_1006614
747 Ga0265336_10002526
748 Ga0265338_10001804
749 Ga0265338_10003697
750 Ga0265332_10024342
751 Ga0265314_10092417
752 Ga0307407_10123075
753 Ga0373934_0004348
754 Ga0373923_0078317
755 Ga0373936_0000767
756 Ga0373953_0044364
757 Ga0373954_0051704
758 Ga0373956_0000197
759 Ga0373956_0014593
760 Ga0373957_0000205
761 Ga0373957_0008995
762 Ga0373943_0034381
763 Ga0373955_0000009
764 Ga0373955_0019260
765 Ga0373924_0007172
766 Ga0373924_0011343
767 Ga0373935_0028126
768 Ga0373935_0066359
769 Ga0373933_0000006
770 Ga0373933_0023649
771 Ga0373937_0000137
772 Ga0373937_0157580
773 Ga0395899_0143448
774 Ga0395900_0042836
775 Ga0395898_0009582
776 Ga0395898_0140874
777 Ga0395905_0048943
778 Ga0436364_0072848
779 Ga0436364_0163932
780 Ga0436364_0928095
781 Ga0436364_1249363
782 Ga0395901_0006124
783 Ga0395901_0261877
784 Ga0436365_1114817
785 Ga0436360_1034821
786 Ga0439448_0009279
787 Ga0466961_0146511
788 Ga0466963_0041337
789 Ga0466963_0183708
790 Ga0451576_0250522
791 Ga0466958_0086807
792 Ga0466958_0181662
793 Ga0466967_0095029
794 Ga0495592_0000426
795 Ga0495629_0001026
796 Ga0495651_0000082
797 Ga0495653_0007724
798 Ga0495580_0090112
799 Ga0495582_0015546
800 Ga0495662_0025771
801 Ga0495664_0005192
802 Ga0495608_0000328
803 Ga0495628_0000542
804 Ga0495628_0183455
805 Ga0495630_0126283
806 Ga0495652_0000273
807 Ga0495665_0004517
808 Ga0495586_0006891
809 Ga0495587_0000070
810 Ga0495587_0127786
811 Ga0495645_0071718
812 Ga0495645_0119848
813 Ga0495667_0000048
814 Ga0495667_0093623
815 Ga0495634_0018529
816 Ga0495635_0068647
817 Ga0495657_0000046
818 Ga0495599_0000023
819 Ga0495599_0088421
820 Ga0495623_0000306
821 Ga0495646_0015170
822 Ga0495658_0007664
823 Ga0495658_0168027
824 Ga0495669_0000004
825 Ga0495669_0012547
826 Ga0495613_0009017
827 Ga0495624_0003586
828 Ga0495600_0005149
829 Ga0495600_0223908
830 Ga0495581_0015109
831 Ga0495604_0000037
832 Ga0495674_0018991
833 Ga0495674_0169023
834 Ga0495674_0377152
835 Ga0495680_0000240
836 Ga0495680_0043975
837 Ga0495680_0073523
838 Ga0495680_0107648
839 Ga0495675_0004564
840 Ga0495675_0113918
841 Ga0495677_0100591
842 Ga0495593_0011933
843 Ga0495602_0000127
844 Ga0495614_0049009
845 Ga0496101_0014491
846 Ga0496102_0107608
847 Ga0496102_0228816
848 Ga0496103_0041058
849 Ga0496103_0075809
850 Ga0496103_0106082
851 Ga0496104_0000353
852 Ga0496105_0001922
853 Ga0496105_0003836
854 Ga0496105_0120650
855 Ga0496105_0303117
856 Ga0496106_0039428
857 Ga0496106_0112771
858 Ga0496108_0010589
859 Ga0496108_0025365
860 Ga0496109_0032754
861 Ga0496109_0039949
862 Ga0496110_0083693
863 Ga0496110_0356926
864 Ga0496112_0001676
865 Ga0496112_0282575
866 Ga0496112_0361952
867 Ga0496112_0492213
868 Ga0496114_0100537
869 Ga0496115_0000470
870 Ga0496115_0190542
871 Ga0496121_0018567
872 Ga0496121_0086763
873 Ga0496126_0263382
874 Ga0501031_0002463
875 Ga0501031_0044166
876 Ga0501031_0082685
877 Ga0501032_0009575
878 Ga0501032_0036749
879 Ga0501033_0005497
880 Ga0501033_0024656
881 Ga0501033_0049844
882 Ga0501033_0083089
883 Ga0501033_0112152
884 Ga0501034_0000584
885 Ga0501034_0010959
886 Ga0501034_0026329
887 Ga0501034_0039210
888 Ga0501034_0262901
889 Ga0501036_0003309
890 Ga0501036_0070382
891 Ga0501036_0087007
892 Ga0501036_0114536
893 Ga0501036_0530427
894 Ga0501037_0000337
895 Ga0501037_0003832
896 Ga0501037_0004261
897 Ga0501037_0070261
898 Ga0501038_0000574
899 Ga0501038_0014636
900 Ga0501038_0054944
901 Ga0501038_0067425
902 Ga0501038_0099806
903 Ga0501038_0160560
904 Ga0501039_0079959
905 Ga0501039_0104126
906 Ga0501042_0003423
907 Ga0501042_0015263
908 Ga0501042_0015873
909 Ga0501042_0089747
910 Ga0501043_0026730
911 Ga0501043_0028775
912 Ga0501043_0056286
913 Ga0501046_0003519
914 Ga0501046_0010819
915 Ga0501047_0003789
916 Ga0501047_0056574
917 Ga0501047_0236743
918 Ga0501048_0002163
919 Ga0501048_0003021
920 Ga0501067_0006643
921 Ga0501070_0049496
922 Ga0501073_0003635
923 Ga0501073_0019234
924 Ga0501073_0281094
925 Ga0501080_0021316
926 Ga0501080_0396400
927 Ga0501080_0430542
928 Ga0501081_0046239
929 Ga0501035_0003758
930 Ga0501035_0010477
931 Ga0501035_0020019
932 Ga0501035_0022057
933 Ga0501035_0043807
934 Ga0501035_0124762
935 Ga0501035_0201913
936 Ga0501044_0017404
937 Ga0501044_0036074
938 Ga0501044_0048235
939 Ga0501044_0071110
940 Ga0501044_0212227
941 Ga0501044_0264926
942 Ga0501045_0009199
943 Ga0501045_0027648
944 nmdc:mga0yw44_80502_c1
945 nmdc:mga05p37_1977_c1
946 nmdc:mga05p37_250607_c1
947 nmdc:mga05p37_478707_c1
948 nmdc:mga09592_50_c1
949 nmdc:mga0qj67_120246_c1
950 nmdc:mga0qj67_74669_c1
951 nmdc:mga06r32_12_c1
952 nmdc:mga06r32_26377_c1
953 nmdc:mga08y16_2008_c1
954 nmdc:mga0n895_16241_c1
955 nmdc:mga0n895_3601_c1
956 nmdc:mga0rr50_10606_c1
957 nmdc:mga0rr50_22297_c1
958 nmdc:mga0a205_126965_c1
959 nmdc:mga0a205_43804_c1
960 Ga0495601_0044583
961 Ga0495601_0048356
962 Ga0495612_0015562
963 Ga0500635_0011607
964 Ga0495595_0052399
965 Ga0495619_0051037
966 Ga0500566_0014891
967 Ga0501084_0314467
968 Ga0590071_000099
969 Ga0590074_000331
970 Ga0590075_000144
971 Ga0590077_002109
972 2644039535
973 2676491028
974 2808903057
975 2884701028
976 2884766778
977 2895436027
978 2895452250

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00248

Aldo_ket_red

Aldo/keto reductase family

51

353

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
7utf-assembly2.cif.gz_D structure-function characterization of an aldo-keto reductase involved in detoxification of the mycotoxin, deoxynivalenol 0.957 1 321
7utf-assembly2.cif.gz_B structure-function characterization of an aldo-keto reductase involved in detoxification of the mycotoxin, deoxynivalenol 0.9439 1 321
7utf-assembly1.cif.gz_A structure-function characterization of an aldo-keto reductase involved in detoxification of the mycotoxin, deoxynivalenol 0.9432 1 321
4xk2-assembly2.cif.gz_B crystal structure of aldo-keto reductase from polaromonas sp. js666 0.9413 1 322
7utf-assembly1.cif.gz_C structure-function characterization of an aldo-keto reductase involved in detoxification of the mycotoxin, deoxynivalenol 0.9411 1 321
ID Description Score Start End Superfamily
af_P77735_1_322_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.99 1 324 3.20.20.100
af_P77735_1_322_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.987 1 324 3.20.20.100
af_Q02895_4_341_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9511 1 321 3.20.20.100
af_Q02895_4_341_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9367 1 321 3.20.20.100
4xk2A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9172 1 322 3.20.20.100
ID Description Score Start End GO Terms
AF-A0A3M1Z231-F1-model_v4 Aldo/keto reductase 0.9967 1 212 GO:0005829
GO:0016491
AF-A0A257RV75-F1-model_v4 Alcohol dehydrogenase 0.9949 1 132 GO:0005829
AF-A0A2M8P5I0-F1-model_v4 Aldo/keto reductase 0.9944 113 213 GO:0005829
GO:0016491
AF-A0A817MNW5-F1-model_v4 NADP-dependent oxidoreductase domain-containing protein 0.993 1 156 GO:0005829
AF-A0A3M1Z231-F1-model_v4 Aldo/keto reductase 0.992 1 212 GO:0005829
GO:0016491

Map