F453871

General Info

Members Datasets Scaffolds Average Seq Length
489 256 979 302

Family's Representative Sequence

Representative Sequence 3300053087|Ga0500643_003967|Ga0500643_003967_3436_4422
Length 328
Sequence MSVKQRTAGIEPKGDGVTGFPFNAAREGSWKISLPCNKAEAEQLADDIPAIALLDPQPTLMTSEPDPAKPDSWQLDVYVEAEPDEHLLAIVRGLVPSAAAYAPLIEHIAEEDWVTLSQSGLEPIRAGRFFVHTPVNAIGAPAGMIGFVIDAGRAFGTGHHETTTGCLEMLDRLKSGGRRFTDIADVGTGTGLLAFAARALWPAAKVIASDIDPVSIDVTAENAAVNRIPVGRGRGQVELVVAAGLSHRRLRNRAPYDLVIANILAGPLIEMAPVFADAVLPGGSLILAGLLDHQAEAVARAYRRNGMWLAERRDLGDWPTLRMVKKRR

Samples

Sample ID Description Type Environment
1 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
8 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
9 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
10 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
11 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
12 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
13 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
14 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
15 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
16 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
17 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
18 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
19 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
20 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
21 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
22 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
61 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
75 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
79 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
80 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
81 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
82 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
93 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
94 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
95 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
97 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
144 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
145 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
146 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
147 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
148 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
149 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
150 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
151 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
152 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
153 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
154 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
155 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
156 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
157 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
158 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
159 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
160 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
161 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
162 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
163 3300044659 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E Metagenome Unclassified
164 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
165 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
166 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
167 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
168 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
169 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
170 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
171 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
172 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
173 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
174 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
175 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
176 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
177 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
178 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
179 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
180 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
181 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
182 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
183 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
184 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
185 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
186 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
187 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
188 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
189 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
190 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
191 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
192 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
193 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
194 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
195 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
196 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
197 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
198 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
199 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
200 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
201 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
202 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
203 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
204 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
205 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
206 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
207 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
208 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
209 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
214 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
215 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
216 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
217 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
218 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
219 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
220 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
221 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
222 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
223 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
224 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
225 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
226 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
227 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
229 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
230 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
231 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
232 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
233 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
234 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
235 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
236 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
237 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
238 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
239 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
240 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
241 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
242 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
243 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
244 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
245 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
246 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
247 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
248 2582581305 Rhizorhabdus wittichii YR128 Isolate Rhizosphere
249 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
250 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
251 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
252 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
253 2643221629 Devosia sp. Root105 Isolate Unclassified
254 2643221662 Devosia sp. Root413D1 Isolate Unclassified
255 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
256 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.16
Metatranscriptomes 0
Isolates 1.84

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.95
Nodule 0
Rhizoplane 2.04
Rhizosphere 83.84
Stem 0
Stem Tuber 0
Unclassified 0.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500643_003967 3300053087 Bacteria 6846
2 JGI24752J21851_1000968 3300001976 Bacteria 3914
3 JGI24739J22299_10000976 3300001989 Bacteria 10647
4 JGI24739J22299_10001027 3300001989 Bacteria 10334
5 JGI24739J22299_10011990 3300001989 Bacteria 3186
6 JGI24739J22299_10016691 3300001989 Bacteria 2654
7 JGI24737J22298_10002363 3300001990 Bacteria 6724
8 JGI24737J22298_10007292 3300001990 Bacteria 3737
9 JGI24737J22298_10015290 3300001990 Bacteria 2485
10 JGI24737J22298_10017943 3300001990 Bacteria 2276
11 JGI24737J22298_10055864 3300001990 Bacteria 1193
12 JGI24743J22301_10013101 3300001991 Bacteria 1517
13 JGI24735J21928_10003553 3300002067 Bacteria 5303
14 JGI24735J21928_10004200 3300002067 Bacteria 4860
15 JGI24735J21928_10007485 3300002067 Bacteria 3561
16 JGI24735J21928_10022989 3300002067 Bacteria 1893
17 JGI24750J21931_1000036 3300002070 Bacteria 18006
18 JGI24748J21848_1000103 3300002074 Bacteria 18872
19 JGI24738J21930_10000084 3300002075 Bacteria 20870
20 JGI24738J21930_10002654 3300002075 Bacteria 4614
21 JGI24738J21930_10006908 3300002075 Bacteria 2636
22 JGI24738J21930_10007705 3300002075 Bacteria 2474
23 JGI24749J21850_1002443 3300002076 Bacteria 2612
24 JGI24034J26672_10000057 3300002239 Bacteria 42515
25 JGI24034J26672_10009231 3300002239 Bacteria 1452
26 JGI24751J29686_10000069 3300002459 Bacteria 59733
27 JGI24751J29686_10006772 3300002459 Bacteria 2334
28 JGI25165J46597_1000039 3300003214 Bacteria 281327
29 JGI25165J46597_1000100 3300003214 Bacteria 157712
30 rootH1_10026091 3300003316 Bacteria 1701
31 rootH1_10164930 3300003316 Bacteria 1728
32 rootH1_10164930 3300003323 Bacteria 1286
33 rootH2_10240939 3300003320 Bacteria 1410
34 Ga0065707_10081805 3300005295 Bacteria 38502
35 Ga0070658_10000201 3300005327 Bacteria 52606
36 Ga0070658_10000240 3300005327 Bacteria 48689
37 Ga0070658_10014927 3300005327 Bacteria 6221
38 Ga0070658_10108559 3300005327 Bacteria 2297
39 Ga0070658_10117233 3300005327 Bacteria 2210
40 Ga0070676_10001521 3300005328 Bacteria 11720
41 Ga0070683_100438233 3300005329 Bacteria 1247
42 Ga0070690_100000011 3300005330 Bacteria 95472
43 Ga0070670_100000005 3300005331 Bacteria 351569
44 Ga0070670_100001203 3300005331 Bacteria 20550
45 Ga0070670_100050304 3300005331 Bacteria 3581
46 Ga0070670_100133795 3300005331 Bacteria 2142
47 Ga0068869_100000304 3300005334 Bacteria 26244
48 Ga0068868_100000003 3300005338 Bacteria 155611
49 Ga0070660_100000024 3300005339 Bacteria 94300
50 Ga0070660_100000125 3300005339 Bacteria 48665
51 Ga0070660_100007241 3300005339 Bacteria 7721
52 Ga0070660_100079575 3300005339 Bacteria 2571
53 Ga0070660_100118277 3300005339 Bacteria 2113
54 Ga0070689_100002742 3300005340 Bacteria 11551
55 Ga0070661_100162020 3300005344 Bacteria 1694
56 Ga0070668_100000803 3300005347 Bacteria 21639
57 Ga0070668_100001180 3300005347 Bacteria 18492
58 Ga0070668_100008100 3300005347 Bacteria 7806
59 Ga0070668_100029213 3300005347 Bacteria 4186
60 Ga0070669_100000060 3300005353 Bacteria 108287
61 Ga0070669_100000712 3300005353 Bacteria 24397
62 Ga0070669_100032777 3300005353 Bacteria 3753
63 Ga0070669_100099561 3300005353 Bacteria 2191
64 Ga0070675_100002541 3300005354 Bacteria 13648
65 Ga0070671_100000426 3300005355 Bacteria 29399
66 Ga0070671_100019126 3300005355 Bacteria 5571
67 Ga0070671_100153919 3300005355 Bacteria 1942
68 Ga0070671_100232516 3300005355 Bacteria 1564
69 Ga0070674_100017975 3300005356 Bacteria 4460
70 Ga0070673_100000008 3300005364 Bacteria 166844
71 Ga0070688_100001328 3300005365 Bacteria 12256
72 Ga0070659_100006922 3300005366 Bacteria 8212
73 Ga0070659_100148163 3300005366 Bacteria 1913
74 Ga0070667_100000113 3300005367 Bacteria 104015
75 Ga0070667_100000166 3300005367 Bacteria 82268
76 Ga0070667_100000672 3300005367 Bacteria 33160
77 Ga0070667_100006081 3300005367 Bacteria 10021
78 Ga0070667_100216417 3300005367 Bacteria 1704
79 Ga0070663_100005676 3300005455 Bacteria 7434
80 Ga0070663_100022589 3300005455 Bacteria 4208
81 Ga0070678_100001457 3300005456 Bacteria 12596
82 Ga0070662_100006839 3300005457 Bacteria 7374
83 Ga0070662_100027226 3300005457 Bacteria 3965
84 Ga0070662_100052369 3300005457 Bacteria 2950
85 Ga0070662_100308213 3300005457 Bacteria 1288
86 Ga0068867_100000003 3300005459 Bacteria 217886
87 Ga0070685_10000168 3300005466 Bacteria 43369
88 Ga0070679_100351670 3300005530 Bacteria 1421
89 Ga0068853_100006432 3300005539 Bacteria 9335
90 Ga0068853_100048291 3300005539 Bacteria 3656
91 Ga0068853_100056503 3300005539 Bacteria 3384
92 Ga0068853_100281193 3300005539 Bacteria 1534
93 Ga0070672_100191295 3300005543 Bacteria 1709
94 Ga0070686_100001324 3300005544 Bacteria 14003
95 Ga0070693_100067906 3300005547 Bacteria 2091
96 Ga0070665_100000161 3300005548 Bacteria 122088
97 Ga0070665_100110753 3300005548 Bacteria 2748
98 Ga0068855_100000699 3300005563 Bacteria 41017
99 Ga0068855_100074402 3300005563 Bacteria 3946
100 Ga0068855_100115710 3300005563 Bacteria 3074
101 Ga0068855_100182759 3300005563 Bacteria 2370
102 Ga0068857_100020630 3300005577 Bacteria 5798
103 Ga0068857_100030956 3300005577 Bacteria 4728
104 Ga0068857_100105820 3300005577 Bacteria 2526
105 Ga0068857_100201543 3300005577 Bacteria 1814
106 Ga0068857_100236332 3300005577 Bacteria 1672
107 Ga0068854_100001374 3300005578 Bacteria 14643
108 Ga0068854_100002105 3300005578 Bacteria 12194
109 Ga0068854_100361936 3300005578 Bacteria 1190
110 Ga0068856_100009911 3300005614 Bacteria 9255
111 Ga0068852_100002539 3300005616 Bacteria 12568
112 Ga0068852_100157308 3300005616 Bacteria 2118
113 Ga0068852_100164727 3300005616 Bacteria 2073
114 Ga0068852_100573622 3300005616 Bacteria 1130
115 Ga0068859_100011466 3300005617 Bacteria 8911
116 Ga0068859_100031227 3300005617 Bacteria 5347
117 Ga0068859_100106466 3300005617 Bacteria 2863
118 Ga0068859_100135515 3300005617 Bacteria 2535
119 Ga0068859_100217472 3300005617 Bacteria 1998
120 Ga0068859_100365409 3300005617 Bacteria 1538
121 Ga0068864_100000011 3300005618 Bacteria 350056
122 Ga0068864_100283166 3300005618 Bacteria 1548
123 Ga0068861_100008206 3300005719 Bacteria 7184
124 Ga0068861_100010184 3300005719 Bacteria 6524
125 Ga0068851_10009639 3300005834 Bacteria 4495
126 Ga0068851_10031563 3300005834 Bacteria 2632
127 Ga0068863_100000040 3300005841 Bacteria 158465
128 Ga0068863_100000060 3300005841 Bacteria 122123
129 Ga0068863_100005315 3300005841 Bacteria 12711
130 Ga0068863_100007807 3300005841 Bacteria 10463
131 Ga0068863_100008743 3300005841 Bacteria 9890
132 Ga0068863_100028455 3300005841 Bacteria 5336
133 Ga0068858_100000174 3300005842 Bacteria 68247
134 Ga0068858_100000291 3300005842 Bacteria 54242
135 Ga0068858_100009909 3300005842 Bacteria 9052
136 Ga0068860_100000126 3300005843 Bacteria 122923
137 Ga0068860_100000215 3300005843 Bacteria 90561
138 Ga0068860_100000245 3300005843 Bacteria 82268
139 Ga0068862_100000597 3300005844 Bacteria 37578
140 Ga0068862_100000667 3300005844 Bacteria 35210
141 Ga0068862_100009511 3300005844 Bacteria 8043
142 Ga0068862_100033932 3300005844 Bacteria 4317
143 Ga0068862_100258509 3300005844 Bacteria 1589
144 Ga0081455_10000131 3300005937 Bacteria 87553
145 Ga0075364_10215520 3300006051 Bacteria 1302
146 Ga0097621_100050955 3300006237 Bacteria 3368
147 Ga0075370_10051764 3300006353 Bacteria 2329
148 Ga0075370_10067860 3300006353 Bacteria 2036
149 Ga0068871_100011689 3300006358 Bacteria 6447
150 Ga0068865_100000002 3300006881 Bacteria 285745
151 Ga0068865_100236230 3300006881 Bacteria 1436
152 Ga0097620_100011466 3300006931 Bacteria 8911
153 Ga0097620_100022162 3300006931 Bacteria 6369
154 Ga0097620_100031225 3300006931 Bacteria 5347
155 Ga0097620_100106464 3300006931 Bacteria 2863
156 Ga0097620_100135512 3300006931 Bacteria 2535
157 Ga0097620_100217479 3300006931 Bacteria 1998
158 Ga0105240_10216457 3300009093 Bacteria 2235
159 Ga0105245_10000060 3300009098 Bacteria 119425
160 Ga0105245_10000617 3300009098 Bacteria 32256
161 Ga0114129_10657087 3300009147 Bacteria 1352
162 Ga0105243_10000031 3300009148 Bacteria 185825
163 Ga0105243_10571883 3300009148 Bacteria 1083
164 Ga0105241_10074335 3300009174 Bacteria 2646
165 Ga0105242_10000751 3300009176 Bacteria 25260
166 Ga0105242_10051414 3300009176 Bacteria 3358
167 Ga0105248_10000765 3300009177 Bacteria 36076
168 Ga0105248_10004497 3300009177 Bacteria 15425
169 Ga0105248_10007869 3300009177 Bacteria 11707
170 Ga0105248_10250364 3300009177 Bacteria 1994
171 Ga0105237_10054702 3300009545 Bacteria 3999
172 Ga0105237_10157618 3300009545 Bacteria 2267
173 Ga0105238_10002932 3300009551 Bacteria 17020
174 Ga0105238_10030570 3300009551 Bacteria 5483
175 Ga0105238_10263808 3300009551 Bacteria 1702
176 Ga0105238_10312979 3300009551 Bacteria 1555
177 Ga0105249_10000094 3300009553 Bacteria 122611
178 Ga0105239_10093672 3300010375 Bacteria 3317
179 Ga0105239_10413463 3300010375 Bacteria 1527
180 Ga0105246_10012946 3300011119 Bacteria 5218
181 Ga0157373_10010752 3300013100 Bacteria 6735
182 Ga0157373_10016421 3300013100 Bacteria 5400
183 Ga0157373_10103241 3300013100 Bacteria 2005
184 Ga0157371_10027546 3300013102 Bacteria 4121
185 Ga0157371_10107494 3300013102 Bacteria 1980
186 Ga0157370_10000157 3300013104 Bacteria 84292
187 Ga0157369_10098096 3300013105 Bacteria 3126
188 Ga0157374_10000105 3300013296 Bacteria 78376
189 Ga0157378_10001613 3300013297 Bacteria 20403
190 Ga0157378_10034142 3300013297 Bacteria 4499
191 Ga0157378_10108163 3300013297 Bacteria 2546
192 Ga0163162_10303303 3300013306 Bacteria 1729
193 Ga0157372_10043304 3300013307 Bacteria 4983
194 Ga0157372_10082656 3300013307 Bacteria 3637
195 Ga0157372_10093253 3300013307 Bacteria 3426
196 Ga0157372_10139136 3300013307 Bacteria 2796
197 Ga0157375_10004611 3300013308 Bacteria 11977
198 Ga0163163_10266027 3300014325 Bacteria 1766
199 Ga0157380_10000606 3300014326 Bacteria 22069
200 Ga0157380_10005506 3300014326 Bacteria 8850
201 Ga0157379_10004525 3300014968 Bacteria 11922
202 Ga0157379_10485316 3300014968 Bacteria 1144
203 Ga0157376_10000107 3300014969 Bacteria 59840
204 Ga0163161_10055959 3300017792 Bacteria 2864
205 Ga0163161_10056043 3300017792 Bacteria 2862
206 Ga0207427_103052 3300025231 Bacteria 3815
207 Ga0209026_1002041 3300025250 Bacteria 7979
208 Ga0209148_1000112 3300025254 Bacteria 197101
209 Ga0209148_1001690 3300025254 Bacteria 9824
210 Ga0209233_1000052 3300025261 Bacteria 445813
211 Ga0209233_1000143 3300025261 Bacteria 191568
212 Ga0209455_1000347 3300025272 Bacteria 43550
213 Ga0207656_10005070 3300025321 Bacteria 4631
214 Ga0207680_10000007 3300025903 Bacteria 623574
215 Ga0207647_10000203 3300025904 Bacteria 48448
216 Ga0207647_10004623 3300025904 Bacteria 10194
217 Ga0207647_10013926 3300025904 Bacteria 5566
218 Ga0207647_10063259 3300025904 Bacteria 2251
219 Ga0207647_10071336 3300025904 Bacteria 2096
220 Ga0207647_10176155 3300025904 Bacteria 1244
221 Ga0207645_10013061 3300025907 Bacteria 5611
222 Ga0207705_10000014 3300025909 Bacteria 434286
223 Ga0207705_10000117 3300025909 Bacteria 88666
224 Ga0207705_10017155 3300025909 Bacteria 5186
225 Ga0207705_10025091 3300025909 Bacteria 4255
226 Ga0207705_10079736 3300025909 Bacteria 2385
227 Ga0207654_10021171 3300025911 Bacteria 3455
228 Ga0207695_10020530 3300025913 Bacteria 7563
229 Ga0207695_10095830 3300025913 Bacteria 2970
230 Ga0207671_10011491 3300025914 Bacteria 7197
231 Ga0207671_10224421 3300025914 Bacteria 1472
232 Ga0207657_10000145 3300025919 Bacteria 72001
233 Ga0207657_10001648 3300025919 Bacteria 24067
234 Ga0207657_10007947 3300025919 Bacteria 10816
235 Ga0207657_10039072 3300025919 Bacteria 4220
236 Ga0207657_10222943 3300025919 Bacteria 1510
237 Ga0207657_10296759 3300025919 Bacteria 1281
238 Ga0207681_10000001 3300025923 Bacteria 1105841
239 Ga0207681_10000089 3300025923 Bacteria 79526
240 Ga0207681_10009999 3300025923 Bacteria 5807
241 Ga0207681_10042261 3300025923 Bacteria 3044
242 Ga0207694_10002065 3300025924 Bacteria 16591
243 Ga0207694_10058038 3300025924 Bacteria 3010
244 Ga0207694_10190182 3300025924 Bacteria 1667
245 Ga0207650_10000018 3300025925 Bacteria 352120
246 Ga0207650_10005768 3300025925 Bacteria 8448
247 Ga0207650_10038098 3300025925 Bacteria 3508
248 Ga0207650_10334706 3300025925 Bacteria 1242
249 Ga0207659_10005114 3300025926 Bacteria 7952
250 Ga0207687_10000394 3300025927 Bacteria 29568
251 Ga0207687_10002351 3300025927 Bacteria 12857
252 Ga0207644_10000595 3300025931 Bacteria 23038
253 Ga0207644_10003216 3300025931 Bacteria 10526
254 Ga0207644_10127910 3300025931 Bacteria 1941
255 Ga0207690_10006014 3300025932 Bacteria 7192
256 Ga0207690_10122788 3300025932 Bacteria 1889
257 Ga0207706_10012563 3300025933 Bacteria 7709
258 Ga0207706_10014680 3300025933 Bacteria 7095
259 Ga0207706_10028905 3300025933 Bacteria 4949
260 Ga0207706_10088341 3300025933 Bacteria 2725
261 Ga0207686_10000431 3300025934 Bacteria 28316
262 Ga0207709_10000122 3300025935 Bacteria 116068
263 Ga0207709_10163094 3300025935 Bacteria 1556
264 Ga0207670_10006073 3300025936 Bacteria 6673
265 Ga0207669_10006747 3300025937 Bacteria 5269
266 Ga0207704_10000003 3300025938 Bacteria 285808
267 Ga0207704_10187010 3300025938 Bacteria 1503
268 Ga0207711_10000556 3300025941 Bacteria 37964
269 Ga0207711_10001674 3300025941 Bacteria 20413
270 Ga0207711_10018596 3300025941 Bacteria 5777
271 Ga0207711_10133723 3300025941 Bacteria 2226
272 Ga0207711_10342085 3300025941 Bacteria 1385
273 Ga0207689_10000135 3300025942 Bacteria 62838
274 Ga0207667_10000007 3300025949 Bacteria 630590
275 Ga0207667_10008229 3300025949 Bacteria 12408
276 Ga0207667_10144633 3300025949 Bacteria 2448
277 Ga0207651_10000003 3300025960 Bacteria 308050
278 Ga0207712_10000004 3300025961 Bacteria 614655
279 Ga0207668_10000044 3300025972 Bacteria 103256
280 Ga0207668_10000213 3300025972 Bacteria 39220
281 Ga0207668_10010418 3300025972 Bacteria 5615
282 Ga0207668_10030093 3300025972 Bacteria 3564
283 Ga0207640_10000106 3300025981 Bacteria 63751
284 Ga0207640_10009720 3300025981 Bacteria 5391
285 Ga0207640_10091515 3300025981 Bacteria 2107
286 Ga0207640_10131839 3300025981 Bacteria 1808
287 Ga0207658_10000034 3300025986 Bacteria 155561
288 Ga0207658_10000128 3300025986 Bacteria 82259
289 Ga0207658_10000618 3300025986 Bacteria 31430
290 Ga0207658_10002894 3300025986 Bacteria 12306
291 Ga0207658_10195932 3300025986 Bacteria 1683
292 Ga0207677_10000364 3300026023 Bacteria 31713
293 Ga0207703_10000142 3300026035 Bacteria 84567
294 Ga0207703_10000918 3300026035 Bacteria 28700
295 Ga0207703_10004830 3300026035 Bacteria 10970
296 Ga0207639_10003651 3300026041 Bacteria 10345
297 Ga0207639_10023527 3300026041 Bacteria 4450
298 Ga0207639_10511756 3300026041 Unclassified 1098
299 Ga0207678_10001924 3300026067 Bacteria 18941
300 Ga0207678_10057292 3300026067 Bacteria 3353
301 Ga0207702_10011171 3300026078 Bacteria 7489
302 Ga0207702_10017552 3300026078 Bacteria 5920
303 Ga0207702_10039478 3300026078 Bacteria 3955
304 Ga0207702_10071817 3300026078 Bacteria 2981
305 Ga0207702_10296010 3300026078 Unclassified 1534
306 Ga0207641_10000039 3300026088 Bacteria 199453
307 Ga0207641_10000100 3300026088 Bacteria 122664
308 Ga0207641_10001750 3300026088 Bacteria 20940
309 Ga0207641_10011108 3300026088 Bacteria 7387
310 Ga0207641_10017461 3300026088 Bacteria 5875
311 Ga0207648_10000007 3300026089 Bacteria 217865
312 Ga0207676_10000004 3300026095 Bacteria 725417
313 Ga0207676_10002760 3300026095 Bacteria 12487
314 Ga0207676_10032823 3300026095 Bacteria 3916
315 Ga0207676_10178582 3300026095 Bacteria 1857
316 Ga0207674_10007684 3300026116 Bacteria 12551
317 Ga0207674_10028499 3300026116 Bacteria 5894
318 Ga0207674_10029882 3300026116 Bacteria 5734
319 Ga0207674_10261337 3300026116 Bacteria 1678
320 Ga0207675_100000018 3300026118 Bacteria 124200
321 Ga0207675_100003757 3300026118 Bacteria 14793
322 Ga0207675_100007601 3300026118 Bacteria 10238
323 Ga0207683_10007230 3300026121 Bacteria 9518
324 Ga0207698_10000552 3300026142 Bacteria 21782
325 Ga0207698_10088771 3300026142 Bacteria 2522
326 Ga0207698_10099690 3300026142 Bacteria 2404
327 Ga0207698_10211515 3300026142 Bacteria 1745
328 Ga0268266_10000040 3300028379 Bacteria 323843
329 Ga0268265_10000002 3300028380 Bacteria 1035381
330 Ga0268265_10000521 3300028380 Bacteria 39162
331 Ga0268265_10002795 3300028380 Bacteria 12867
332 Ga0268265_10011053 3300028380 Bacteria 6098
333 Ga0268265_10037964 3300028380 Bacteria 3539
334 Ga0268264_10000003 3300028381 Bacteria 1141976
335 Ga0268264_10000075 3300028381 Bacteria 256011
336 Ga0268264_10000296 3300028381 Bacteria 82267
337 Ga0268264_10008192 3300028381 Bacteria 8678
338 Ga0307513_10158339 3300031456 Bacteria 2161
339 Ga0307508_10000202 3300031616 Bacteria 71789
340 Ga0307405_10074986 3300031731 Bacteria 2189
341 Ga0307412_10005585 3300031911 Bacteria 7059
342 Ga0307412_10089244 3300031911 Bacteria 2152
343 Ga0307412_10142606 3300031911 Bacteria 1757
344 Ga0373923_0090947 3300035111 Bacteria 1335
345 Ga0373947_0085602 3300035725 Bacteria 1958
346 Ga0395899_0004635 3300037312 Bacteria 10720
347 Ga0395900_0404070 3300037418 Bacteria 1329
348 Ga0395900_0412780 3300037418 Bacteria 1312
349 Ga0395898_0165415 3300037466 Bacteria 2116
350 Ga0395905_0054905 3300037471 Bacteria 3728
351 Ga0395905_0202012 3300037471 Bacteria 1863
352 Ga0395901_0129693 3300038443 Bacteria 2649
353 Ga0395901_0321888 3300038443 Bacteria 1600
354 Ga0439461_0022622 3300041410 Bacteria 1261
355 Ga0451806_108972 3300041462 Bacteria 5708
356 Ga0451807_2679904 3300041486 Bacteria 2010
357 Ga0439448_0002693 3300042005 Bacteria 4849
358 Ga0439448_0013477 3300042005 Bacteria 2456
359 Ga0439450_007270 3300042008 Bacteria 2024
360 Ga0439455_0017734 3300042012 Bacteria 1662
361 Ga0450923_008546 3300042125 Bacteria 1766
362 Ga0439458_0000221 3300042157 Bacteria 13424
363 Ga0466972_0009798 3300044658 Bacteria 4811
364 Ga0466973_0245263 3300044659 Bacteria 1268
365 Ga0466966_0148731 3300044684 Bacteria 1429
366 Ga0466961_0012178 3300044693 Bacteria 5499
367 Ga0466963_0013670 3300044694 Bacteria 4991
368 Ga0466971_0002590 3300044719 Bacteria 7648
369 Ga0466968_0025382 3300044735 Bacteria 2427
370 Ga0466970_0002770 3300044765 Bacteria 8459
371 Ga0466957_0021287 3300044842 Bacteria 3821
372 Ga0466957_0038761 3300044842 Bacteria 2872
373 Ga0466960_0012095 3300044901 Bacteria 3633
374 Ga0466959_0002958 3300045049 Bacteria 10962
375 Ga0466958_0016320 3300045836 Bacteria 4274
376 Ga0466958_0028299 3300045836 Bacteria 3323
377 Ga0466967_0059908 3300045976 Bacteria 3371
378 Ga0466967_0201759 3300045976 Bacteria 1884
379 Ga0495607_0162571 3300046501 Bacteria 1133
380 Ga0495583_0000201 3300046506 Bacteria 100380
381 Ga0495606_0002022 3300046507 Bacteria 24909
382 Ga0495606_0056381 3300046507 Bacteria 2537
383 Ga0495643_0019740 3300046522 Bacteria 3896
384 Ga0495648_0023187 3300046524 Bacteria 4257
385 Ga0495648_0106305 3300046524 Bacteria 1537
386 Ga0495663_0026116 3300046525 Bacteria 1708
387 Ga0495666_0091749 3300046526 Bacteria 1433
388 Ga0495654_0003952 3300046530 Bacteria 8945
389 Ga0495654_0052286 3300046530 Bacteria 1990
390 Ga0495597_0009780 3300046542 Bacteria 4720
391 Ga0495633_0044487 3300046558 Bacteria 2104
392 Ga0495668_0002700 3300046616 Bacteria 14236
393 Ga0495668_0031879 3300046616 Bacteria 2968
394 Ga0495668_0045214 3300046616 Bacteria 2447
395 Ga0495668_0102907 3300046616 Bacteria 1562
396 Ga0495611_0017429 3300046648 Bacteria 3073
397 Ga0495661_0023764 3300046665 Bacteria 3974
398 Ga0495649_0195687 3300046694 Bacteria 1051
399 Ga0495686_0000368 3300047472 Bacteria 73088
400 Ga0495686_0003655 3300047472 Bacteria 13164
401 Ga0495686_0004636 3300047472 Bacteria 11175
402 Ga0495686_0027097 3300047472 Bacteria 3744
403 Ga0496100_0044648 3300048903 Bacteria 2840
404 Ga0496103_0077743 3300048906 Bacteria 2083
405 Ga0496104_0249057 3300048907 Bacteria 1689
406 Ga0496106_0170282 3300048909 Bacteria 1726
407 Ga0496111_0244148 3300048914 Bacteria 1333
408 Ga0496111_0293680 3300048914 Unclassified 1205
409 Ga0496115_0157713 3300048918 Bacteria 1875
410 Ga0496116_0039062 3300048919 Bacteria 3286
411 Ga0496117_0009263 3300048920 Bacteria 9200
412 Ga0496117_0009625 3300048920 Bacteria 8946
413 Ga0496117_0035488 3300048920 Bacteria 3742
414 Ga0496117_0083002 3300048920 Bacteria 2096
415 Ga0496117_0153842 3300048920 Bacteria 1357
416 Ga0496118_0000162 3300048921 Bacteria 119635
417 Ga0496118_0012659 3300048921 Bacteria 8071
418 Ga0496119_0027461 3300048922 Bacteria 3910
419 Ga0496121_0029284 3300048924 Bacteria 5098
420 Ga0496121_0076572 3300048924 Bacteria 2667
421 Ga0496122_0013676 3300048925 Bacteria 7921
422 Ga0496122_0015771 3300048925 Bacteria 7199
423 Ga0496123_0017015 3300048926 Bacteria 5870
424 Ga0496124_0007745 3300048927 Bacteria 11347
425 Ga0496124_0044452 3300048927 Bacteria 3811
426 Ga0496124_0048188 3300048927 Bacteria 3643
427 Ga0496124_0236397 3300048927 Bacteria 1362
428 Ga0496124_0249304 3300048927 Bacteria 1315
429 Ga0496125_0022447 3300048928 Bacteria 5862
430 Ga0496126_0020904 3300048929 Bacteria 6407
431 Ga0495682_0003671 3300049460 Bacteria 6767
432 Ga0501292_000020 3300049515 Bacteria 54099
433 Ga0501299_008390 3300049522 Bacteria 1680
434 Ga0501032_0134527 3300049569 Bacteria 1630
435 Ga0501043_0002355 3300049579 Bacteria 16021
436 Ga0501046_0083993 3300049580 Bacteria 2457
437 Ga0501047_0002303 3300049581 Bacteria 18248
438 Ga0501070_0222574 3300049586 Bacteria 1547
439 Ga0501070_0254782 3300049586 Bacteria 1435
440 Ga0501206_000474 3300049653 Bacteria 4847
441 Ga0501222_001002 3300049662 Bacteria 4023
442 Ga0501227_001011 3300049665 Bacteria 6232
443 Ga0501249_001472 3300049679 Bacteria 4840
444 Ga0501257_000044 3300049686 Bacteria 35002
445 Ga0501259_004193 3300049688 Bacteria 2292
446 Ga0501261_000065 3300049690 Bacteria 18537
447 Ga0501221_007525 3300049704 Bacteria 1871
448 Ga0501245_011712 3300049708 Bacteria 1279
449 Ga0501279_000022 3300049775 Bacteria 54370
450 Ga0501280_000035 3300049776 Bacteria 40433
451 Ga0501280_000663 3300049776 Bacteria 7643
452 Ga0501281_00191 3300049777 Bacteria 6995
453 Ga0501282_000374 3300049778 Bacteria 5382
454 Ga0501035_0164748 3300049822 Bacteria 1917
455 Ga0501044_0026512 3300049823 Bacteria 6134
456 Ga0501044_0039947 3300049823 Bacteria 4892
457 Ga0501044_0222296 3300049823 Bacteria 1839
458 nmdc:mga0k408_102603_c1 3300050493 Bacteria 1687
459 nmdc:mga0k408_340392_c1 3300050493 Bacteria 894
460 nmdc:mga07m45_66661_c1 3300050496 Bacteria 2045
461 nmdc:mga0qj67_111362_c1 3300050509 Bacteria 2210
462 Ga0500643_000066 3300053087 Bacteria 119317
463 Ga0500643_001124 3300053087 Bacteria 15971
464 Ga0500651_0006360 3300053093 Bacteria 6802
465 Ga0500555_000863 3300053103 Bacteria 10802
466 Ga0500594_0025012 3300053118 Bacteria 1526
467 Ga0500595_053680 3300053119 Bacteria 1240
468 Ga0500618_018367 3300053125 Bacteria 1730
469 Ga0500642_0106268 3300053130 Bacteria 1308
470 Ga0500655_000565 3300053133 Bacteria 7423
471 Ga0500577_0080267 3300053142 Bacteria 1299
472 Ga0500590_000082 3300053148 Bacteria 24241
473 Ga0500604_0001158 3300053151 Bacteria 7327
474 Ga0500604_0007936 3300053151 Bacteria 2816
475 Ga0500616_0009273 3300053153 Bacteria 5997
476 Ga0500622_0007490 3300053156 Bacteria 6197
477 Ga0500627_0000193 3300053158 Bacteria 17592
478 Ga0500627_0000431 3300053158 Bacteria 11350
479 Ga0500639_148332 3300053163 Bacteria 1085
480 Ga0500570_000324 3300053724 Bacteria 17169
481 Ga0466962_0001380 3300061719 Bacteria 11257
482 2585262672 2582581305 Bacteria 4895574
483 2600202409 2599185354 Bacteria 4398675
484 2643728980 2643221541 Bacteria 5498788
485 2644038229 2643221605 Bacteria 4772303
486 2644044995 2643221606 Bacteria 5588032
487 2644166881 2643221629 Bacteria 5850260
488 2644349395 2643221662 Bacteria 5851492
489 2644391168 2643221671 Bacteria 5496681
490 2753765981 2751185897 Bacteria 5322941
491 Ga0500643_003967
492 JGI24752J21851_1000968
493 JGI24739J22299_10000976
494 JGI24739J22299_10001027
495 JGI24739J22299_10011990
496 JGI24739J22299_10016691
497 JGI24737J22298_10002363
498 JGI24737J22298_10007292
499 JGI24737J22298_10015290
500 JGI24737J22298_10017943
501 JGI24737J22298_10055864
502 JGI24743J22301_10013101
503 JGI24735J21928_10003553
504 JGI24735J21928_10004200
505 JGI24735J21928_10007485
506 JGI24735J21928_10022989
507 JGI24750J21931_1000036
508 JGI24748J21848_1000103
509 JGI24738J21930_10000084
510 JGI24738J21930_10002654
511 JGI24738J21930_10006908
512 JGI24738J21930_10007705
513 JGI24749J21850_1002443
514 JGI24034J26672_10000057
515 JGI24034J26672_10009231
516 JGI24751J29686_10000069
517 JGI24751J29686_10006772
518 JGI25165J46597_1000039
519 JGI25165J46597_1000100
520 rootH1_10026091
521 rootH1_10164930
522 rootH2_10240939
523 Ga0065707_10081805
524 Ga0070658_10000201
525 Ga0070658_10000240
526 Ga0070658_10014927
527 Ga0070658_10108559
528 Ga0070658_10117233
529 Ga0070676_10001521
530 Ga0070683_100438233
531 Ga0070690_100000011
532 Ga0070670_100000005
533 Ga0070670_100001203
534 Ga0070670_100050304
535 Ga0070670_100133795
536 Ga0068869_100000304
537 Ga0068868_100000003
538 Ga0070660_100000024
539 Ga0070660_100000125
540 Ga0070660_100007241
541 Ga0070660_100079575
542 Ga0070660_100118277
543 Ga0070689_100002742
544 Ga0070661_100162020
545 Ga0070668_100000803
546 Ga0070668_100001180
547 Ga0070668_100008100
548 Ga0070668_100029213
549 Ga0070669_100000060
550 Ga0070669_100000712
551 Ga0070669_100032777
552 Ga0070669_100099561
553 Ga0070675_100002541
554 Ga0070671_100000426
555 Ga0070671_100019126
556 Ga0070671_100153919
557 Ga0070671_100232516
558 Ga0070674_100017975
559 Ga0070673_100000008
560 Ga0070688_100001328
561 Ga0070659_100006922
562 Ga0070659_100148163
563 Ga0070667_100000113
564 Ga0070667_100000166
565 Ga0070667_100000672
566 Ga0070667_100006081
567 Ga0070667_100216417
568 Ga0070663_100005676
569 Ga0070663_100022589
570 Ga0070678_100001457
571 Ga0070662_100006839
572 Ga0070662_100027226
573 Ga0070662_100052369
574 Ga0070662_100308213
575 Ga0068867_100000003
576 Ga0070685_10000168
577 Ga0070679_100351670
578 Ga0068853_100006432
579 Ga0068853_100048291
580 Ga0068853_100056503
581 Ga0068853_100281193
582 Ga0070672_100191295
583 Ga0070686_100001324
584 Ga0070693_100067906
585 Ga0070665_100000161
586 Ga0070665_100110753
587 Ga0068855_100000699
588 Ga0068855_100074402
589 Ga0068855_100115710
590 Ga0068855_100182759
591 Ga0068857_100020630
592 Ga0068857_100030956
593 Ga0068857_100105820
594 Ga0068857_100201543
595 Ga0068857_100236332
596 Ga0068854_100001374
597 Ga0068854_100002105
598 Ga0068854_100361936
599 Ga0068856_100009911
600 Ga0068852_100002539
601 Ga0068852_100157308
602 Ga0068852_100164727
603 Ga0068852_100573622
604 Ga0068859_100011466
605 Ga0068859_100031227
606 Ga0068859_100106466
607 Ga0068859_100135515
608 Ga0068859_100217472
609 Ga0068859_100365409
610 Ga0068864_100000011
611 Ga0068864_100283166
612 Ga0068861_100008206
613 Ga0068861_100010184
614 Ga0068851_10009639
615 Ga0068851_10031563
616 Ga0068863_100000040
617 Ga0068863_100000060
618 Ga0068863_100005315
619 Ga0068863_100007807
620 Ga0068863_100008743
621 Ga0068863_100028455
622 Ga0068858_100000174
623 Ga0068858_100000291
624 Ga0068858_100009909
625 Ga0068860_100000126
626 Ga0068860_100000215
627 Ga0068860_100000245
628 Ga0068862_100000597
629 Ga0068862_100000667
630 Ga0068862_100009511
631 Ga0068862_100033932
632 Ga0068862_100258509
633 Ga0081455_10000131
634 Ga0075364_10215520
635 Ga0097621_100050955
636 Ga0075370_10051764
637 Ga0075370_10067860
638 Ga0068871_100011689
639 Ga0068865_100000002
640 Ga0068865_100236230
641 Ga0097620_100011466
642 Ga0097620_100022162
643 Ga0097620_100031225
644 Ga0097620_100106464
645 Ga0097620_100135512
646 Ga0097620_100217479
647 Ga0105240_10216457
648 Ga0105245_10000060
649 Ga0105245_10000617
650 Ga0114129_10657087
651 Ga0105243_10000031
652 Ga0105243_10571883
653 Ga0105241_10074335
654 Ga0105242_10000751
655 Ga0105242_10051414
656 Ga0105248_10000765
657 Ga0105248_10004497
658 Ga0105248_10007869
659 Ga0105248_10250364
660 Ga0105237_10054702
661 Ga0105237_10157618
662 Ga0105238_10002932
663 Ga0105238_10030570
664 Ga0105238_10263808
665 Ga0105238_10312979
666 Ga0105249_10000094
667 Ga0105239_10093672
668 Ga0105239_10413463
669 Ga0105246_10012946
670 Ga0157373_10010752
671 Ga0157373_10016421
672 Ga0157373_10103241
673 Ga0157371_10027546
674 Ga0157371_10107494
675 Ga0157370_10000157
676 Ga0157369_10098096
677 Ga0157374_10000105
678 Ga0157378_10001613
679 Ga0157378_10034142
680 Ga0157378_10108163
681 Ga0163162_10303303
682 Ga0157372_10043304
683 Ga0157372_10082656
684 Ga0157372_10093253
685 Ga0157372_10139136
686 Ga0157375_10004611
687 Ga0163163_10266027
688 Ga0157380_10000606
689 Ga0157380_10005506
690 Ga0157379_10004525
691 Ga0157379_10485316
692 Ga0157376_10000107
693 Ga0163161_10055959
694 Ga0163161_10056043
695 Ga0207427_103052
696 Ga0209026_1002041
697 Ga0209148_1000112
698 Ga0209148_1001690
699 Ga0209233_1000052
700 Ga0209233_1000143
701 Ga0209455_1000347
702 Ga0207656_10005070
703 Ga0207680_10000007
704 Ga0207647_10000203
705 Ga0207647_10004623
706 Ga0207647_10013926
707 Ga0207647_10063259
708 Ga0207647_10071336
709 Ga0207647_10176155
710 Ga0207645_10013061
711 Ga0207705_10000014
712 Ga0207705_10000117
713 Ga0207705_10017155
714 Ga0207705_10025091
715 Ga0207705_10079736
716 Ga0207654_10021171
717 Ga0207695_10020530
718 Ga0207695_10095830
719 Ga0207671_10011491
720 Ga0207671_10224421
721 Ga0207657_10000145
722 Ga0207657_10001648
723 Ga0207657_10007947
724 Ga0207657_10039072
725 Ga0207657_10222943
726 Ga0207657_10296759
727 Ga0207681_10000001
728 Ga0207681_10000089
729 Ga0207681_10009999
730 Ga0207681_10042261
731 Ga0207694_10002065
732 Ga0207694_10058038
733 Ga0207694_10190182
734 Ga0207650_10000018
735 Ga0207650_10005768
736 Ga0207650_10038098
737 Ga0207650_10334706
738 Ga0207659_10005114
739 Ga0207687_10000394
740 Ga0207687_10002351
741 Ga0207644_10000595
742 Ga0207644_10003216
743 Ga0207644_10127910
744 Ga0207690_10006014
745 Ga0207690_10122788
746 Ga0207706_10012563
747 Ga0207706_10014680
748 Ga0207706_10028905
749 Ga0207706_10088341
750 Ga0207686_10000431
751 Ga0207709_10000122
752 Ga0207709_10163094
753 Ga0207670_10006073
754 Ga0207669_10006747
755 Ga0207704_10000003
756 Ga0207704_10187010
757 Ga0207711_10000556
758 Ga0207711_10001674
759 Ga0207711_10018596
760 Ga0207711_10133723
761 Ga0207711_10342085
762 Ga0207689_10000135
763 Ga0207667_10000007
764 Ga0207667_10008229
765 Ga0207667_10144633
766 Ga0207651_10000003
767 Ga0207712_10000004
768 Ga0207668_10000044
769 Ga0207668_10000213
770 Ga0207668_10010418
771 Ga0207668_10030093
772 Ga0207640_10000106
773 Ga0207640_10009720
774 Ga0207640_10091515
775 Ga0207640_10131839
776 Ga0207658_10000034
777 Ga0207658_10000128
778 Ga0207658_10000618
779 Ga0207658_10002894
780 Ga0207658_10195932
781 Ga0207677_10000364
782 Ga0207703_10000142
783 Ga0207703_10000918
784 Ga0207703_10004830
785 Ga0207639_10003651
786 Ga0207639_10023527
787 Ga0207639_10511756
788 Ga0207678_10001924
789 Ga0207678_10057292
790 Ga0207702_10011171
791 Ga0207702_10017552
792 Ga0207702_10039478
793 Ga0207702_10071817
794 Ga0207702_10296010
795 Ga0207641_10000039
796 Ga0207641_10000100
797 Ga0207641_10001750
798 Ga0207641_10011108
799 Ga0207641_10017461
800 Ga0207648_10000007
801 Ga0207676_10000004
802 Ga0207676_10002760
803 Ga0207676_10032823
804 Ga0207676_10178582
805 Ga0207674_10007684
806 Ga0207674_10028499
807 Ga0207674_10029882
808 Ga0207674_10261337
809 Ga0207675_100000018
810 Ga0207675_100003757
811 Ga0207675_100007601
812 Ga0207683_10007230
813 Ga0207698_10000552
814 Ga0207698_10088771
815 Ga0207698_10099690
816 Ga0207698_10211515
817 Ga0268266_10000040
818 Ga0268265_10000002
819 Ga0268265_10000521
820 Ga0268265_10002795
821 Ga0268265_10011053
822 Ga0268265_10037964
823 Ga0268264_10000003
824 Ga0268264_10000075
825 Ga0268264_10000296
826 Ga0268264_10008192
827 Ga0307513_10158339
828 Ga0307508_10000202
829 Ga0307405_10074986
830 Ga0307412_10005585
831 Ga0307412_10089244
832 Ga0307412_10142606
833 Ga0373923_0090947
834 Ga0373947_0085602
835 Ga0395899_0004635
836 Ga0395900_0404070
837 Ga0395900_0412780
838 Ga0395898_0165415
839 Ga0395905_0054905
840 Ga0395905_0202012
841 Ga0395901_0129693
842 Ga0395901_0321888
843 Ga0439461_0022622
844 Ga0451806_108972
845 Ga0451807_2679904
846 Ga0439448_0002693
847 Ga0439448_0013477
848 Ga0439450_007270
849 Ga0439455_0017734
850 Ga0450923_008546
851 Ga0439458_0000221
852 Ga0466972_0009798
853 Ga0466973_0245263
854 Ga0466966_0148731
855 Ga0466961_0012178
856 Ga0466963_0013670
857 Ga0466971_0002590
858 Ga0466968_0025382
859 Ga0466970_0002770
860 Ga0466957_0021287
861 Ga0466957_0038761
862 Ga0466960_0012095
863 Ga0466959_0002958
864 Ga0466958_0016320
865 Ga0466958_0028299
866 Ga0466967_0059908
867 Ga0466967_0201759
868 Ga0495607_0162571
869 Ga0495583_0000201
870 Ga0495606_0002022
871 Ga0495606_0056381
872 Ga0495643_0019740
873 Ga0495648_0023187
874 Ga0495648_0106305
875 Ga0495663_0026116
876 Ga0495666_0091749
877 Ga0495654_0003952
878 Ga0495654_0052286
879 Ga0495597_0009780
880 Ga0495633_0044487
881 Ga0495668_0002700
882 Ga0495668_0031879
883 Ga0495668_0045214
884 Ga0495668_0102907
885 Ga0495611_0017429
886 Ga0495661_0023764
887 Ga0495649_0195687
888 Ga0495686_0000368
889 Ga0495686_0003655
890 Ga0495686_0004636
891 Ga0495686_0027097
892 Ga0496100_0044648
893 Ga0496103_0077743
894 Ga0496104_0249057
895 Ga0496106_0170282
896 Ga0496111_0244148
897 Ga0496111_0293680
898 Ga0496115_0157713
899 Ga0496116_0039062
900 Ga0496117_0009263
901 Ga0496117_0009625
902 Ga0496117_0035488
903 Ga0496117_0083002
904 Ga0496117_0153842
905 Ga0496118_0000162
906 Ga0496118_0012659
907 Ga0496119_0027461
908 Ga0496121_0029284
909 Ga0496121_0076572
910 Ga0496122_0013676
911 Ga0496122_0015771
912 Ga0496123_0017015
913 Ga0496124_0007745
914 Ga0496124_0044452
915 Ga0496124_0048188
916 Ga0496124_0236397
917 Ga0496124_0249304
918 Ga0496125_0022447
919 Ga0496126_0020904
920 Ga0495682_0003671
921 Ga0501292_000020
922 Ga0501299_008390
923 Ga0501032_0134527
924 Ga0501043_0002355
925 Ga0501046_0083993
926 Ga0501047_0002303
927 Ga0501070_0222574
928 Ga0501070_0254782
929 Ga0501206_000474
930 Ga0501222_001002
931 Ga0501227_001011
932 Ga0501249_001472
933 Ga0501257_000044
934 Ga0501259_004193
935 Ga0501261_000065
936 Ga0501221_007525
937 Ga0501245_011712
938 Ga0501279_000022
939 Ga0501280_000035
940 Ga0501280_000663
941 Ga0501281_00191
942 Ga0501282_000374
943 Ga0501035_0164748
944 Ga0501044_0026512
945 Ga0501044_0039947
946 Ga0501044_0222296
947 nmdc:mga0k408_102603_c1
948 nmdc:mga0k408_340392_c1
949 nmdc:mga07m45_66661_c1
950 nmdc:mga0qj67_111362_c1
951 Ga0500643_000066
952 Ga0500643_001124
953 Ga0500651_0006360
954 Ga0500555_000863
955 Ga0500594_0025012
956 Ga0500595_053680
957 Ga0500618_018367
958 Ga0500642_0106268
959 Ga0500655_000565
960 Ga0500577_0080267
961 Ga0500590_000082
962 Ga0500604_0001158
963 Ga0500604_0007936
964 Ga0500616_0009273
965 Ga0500622_0007490
966 Ga0500627_0000193
967 Ga0500627_0000431
968 Ga0500639_148332
969 Ga0500570_000324
970 Ga0466962_0001380
971 2585262672
972 2600202409
973 2643728980
974 2644038229
975 2644044995
976 2644166881
977 2644349395
978 2644391168
979 2753765981

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05175

MTS

Methyltransferase small domain

154

262

0.82

PF06325

PrmA

Ribosomal protein L11 methyltransferase (PrmA)

29

326

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
3grz-assembly1.cif.gz_B crystal structure of ribosomal protein l11 methylase from lactobacillus delbrueckii subsp. bulgaricus 0.8948 85 290
3grz-assembly1.cif.gz_B crystal structure of ribosomal protein l11 methylase from lactobacillus delbrueckii subsp. bulgaricus 0.886 85 290
3grz-assembly1.cif.gz_A crystal structure of ribosomal protein l11 methylase from lactobacillus delbrueckii subsp. bulgaricus 0.8806 85 290
3grz-assembly1.cif.gz_A crystal structure of ribosomal protein l11 methylase from lactobacillus delbrueckii subsp. bulgaricus 0.8634 85 290
4o29-assembly1.cif.gz_A protein-l-isoaspartate o-methyltransferase from pyrobaculum aerophilum in complex with s-adenosyl-l-homocysteine 0.8559 131 252
ID Description Score Start End Superfamily
3grzA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8999 122 290 3.40.50.150
3grzB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8948 85 290 3.40.50.150
3cjtC02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8929 83 289 3.40.50.150
3grzB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.886 85 290 3.40.50.150
3grzA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8836 122 290 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A357G0R1-F1-model_v4 50S ribosomal protein L11 methyltransferase 0.9908 230 291 GO:0005840
GO:0008168
GO:0032259
AF-A0A7Y2SRP8-F1-model_v4 50S ribosomal protein L11 methyltransferase 0.9856 218 289 GO:0005840
GO:0008168
GO:0032259
AF-A0A381WA52-F1-model_v4 50S ribosomal protein L11 methyltransferase 0.9793 218 292
AF-A0A4V1VKX9-F1-model_v4 50S ribosomal protein L11 methyltransferase 0.9791 218 291 GO:0005840
GO:0008168
GO:0032259
AF-A0A349QEK2-F1-model_v4 deleted 0.9789 202 288

Map