metagRoot

F453877

General Info

Members	Datasets	Scaffolds	Average Seq Length
489	282	436	305

Family's Representative Sequence

Representative Sequence	iso_pu_bacteria\|2643221692\|2644517314
Length	360
Sequence	RDEAAPAAVPGGFSMTDRLEATPAPVEPAAVLPDDLEPAQPVVLADDAELPVGAEPADITTDTGPTARIIAVVVTHKRRELLAESLKVLASQSRPVDHLIVVDNANEDAVAELVAQQPIEATYLGSRHNLGGAGGFALGMLHALTQGADWVWLADDDGRPDGPEVLAKLIDCARRHNLVEVSPVVCDIDEPDRLAFPLRRGVVWRRLRSELGDEDFLPGIASLFNGALISAKAVDLIGVPDLRLFVRGDEVEVHRRLVRSGLPFGTCLQTAYLHPNGAEEFKPILGGRMHTQYPDDPVKRYFTYRNRGYLMSQPGMRKLLPQEWIRFSWFFLVTRRDPAGLKEWFRLRSLGRNEHFGKPD

Samples

	Sample ID	Description	Type	Environment
1	2523231044	Gordonia rhizosphera NBRC 16068	Isolate	Rhizosphere
2	2547132424	Nocardia nova SH22a	Isolate	Unclassified
3	2558860112	Pseudonocardia acaciae DSM 45401	Isolate	Unclassified
4	2565956761	Rhodococcus qingshengii BKS 20-40	Isolate	Rhizosphere
5	2582580736	Prauserella sp. Am3	Isolate	Unclassified
6	2585427649	Amycolatopsis japonica MG417-CF17, DSM 44213	Isolate	Unclassified
7	2643221567	Phycicoccus sp. Root563	Isolate	Unclassified
8	2643221624	Phycicoccus sp. Root101	Isolate	Unclassified
9	2643221692	Nocardia sp. Root136	Isolate	Unclassified
10	2643221715	Mycobacterium sp. Root265	Isolate	Unclassified
11	2738541264	Mycobacterium sp. OK889	Isolate	Unclassified
12	2738541274	Mycobacterium sp. YR708	Isolate	Unclassified
13	2738541308	Rhodococcus sp. OK551	Isolate	Unclassified
14	2738541356	Mycobacterium sp. OK887	Isolate	Unclassified
15	2738543005	Rhodococcus sp. OK519	Isolate	Unclassified
16	2738543011	Rhodococcus sp. OK611	Isolate	Unclassified
17	2738543028	Mycobacterium sp. YR782	Isolate	Unclassified
18	2738543034	Rhodococcus sp. OK269	Isolate	Unclassified
19	2744054611	Aldersonia kunmingensis DSM 45001	Isolate	Rhizosphere
20	2751185725	Microbispora sp. NRRL B-24597	Isolate	Unclassified
21	2751185792	Kitasatospora arboriphila NRRL B-24581	Isolate	Unclassified
22	2808606365	Phycicoccus sp. SLBN-51	Isolate	Unclassified
23	2808606522	Amycolatopsis sp. BJA-103	Isolate	Unclassified
24	2842134933	Mycolicibacterium obuense SEMIA 442	Isolate	Nodule
25	2842888712	Tsukamurella sp. R-71941	Isolate	Unclassified
26	2866612099	Amycolatopsis suaedae 8-3EHSu	Isolate	Unclassified
27	2889300758	Rhodococcus sp. PvR099	Isolate	Rhizosphere
28	2899370129	Amycolatopsis alkalitolerans SYSUP0005	Isolate	Stem Tuber
29	2902792274	Mycolicibacterium sp. P9-64	Isolate	Unclassified
30	2902799365	Mycolicibacterium sp. P1-5	Isolate	Unclassified
31	2902810491	Mycolicibacterium sp. P9-22	Isolate	Unclassified
32	2902837492	Mycolicibacterium sp. P1-18	Isolate	Unclassified
33	2904535858	Rhodococcus erythropolis 2017	Isolate	Unclassified
34	2904765812	Rhodococcus fascians 1590	Isolate	Rhizosphere
35	2904770941	Rhodococcus fascians 1339	Isolate	Rhizosphere
36	2908811453	Rhodococcus sp. 1R11	Isolate	Unclassified
37	2915768154	Amycolatopsis pittospori PIP199	Isolate	Unclassified
38	2917736166	Amycolatopsis dendrobii DR6-1	Isolate	Unclassified
39	2919420072	Rhodococcus fascians 3241	Isolate	Rhizosphere
40	2919432681	Rhodococcus sp. 3258	Isolate	Rhizosphere
41	2919446982	Phycicoccus sp. 3266	Isolate	Rhizosphere
42	2919713450	Nocardia kruczakiae 4272	Isolate	Rhizosphere
43	2922554459	Rhodococcus sp. 66b	Isolate	Unclassified
44	2928142448	Prescottella equi DPS 2018	Isolate	Unclassified
45	2929212328	Mycolicibacterium sp. R-73050 Hybrid assembly	Isolate	Unclassified
46	2932398195	Dietzia sp. 2505	Isolate	Rhizosphere
47	2939582691	Mycolicibacterium sp. 624	Isolate	Rhizosphere
48	2939743619	Rhodococcus sp. PvR044	Isolate	Rhizosphere
49	2956939328	Lolliginicoccus suaedae LNNU 331112	Isolate	Rhizosphere
50	2974315732	Rhodococcus sp. SORGH_AS 301	Isolate	Unclassified
51	2984523437	Rhodococcus sp. SORGH_AS303	Isolate	Aerial Root
52	3001119090	Lolliginicoccus lacisalsi G463	Isolate	Rhizosphere
53	3300002073	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4	Metagenome	Rhizosphere
54	3300002244	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1	Metagenome	Rhizosphere
55	3300003792	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2	Metagenome	Endosphere
56	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
57	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
58	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
59	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
60	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
61	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
62	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
63	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
64	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
65	3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Metagenome	Rhizosphere
66	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
67	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
68	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
69	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
70	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
71	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
72	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
73	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
74	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
75	3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Metagenome	Rhizosphere
76	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
77	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
78	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
79	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
80	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
81	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
82	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
83	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
84	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
85	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
86	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
87	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
88	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
89	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
90	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
91	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
92	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
93	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
94	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
95	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
96	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
97	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
98	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
99	3300006177	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Metagenome	Endosphere
100	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
101	3300006186	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4	Metagenome	Endosphere
102	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
103	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
104	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
105	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
106	3300007788	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2	Metagenome	Rhizosphere
107	3300009092	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG	Metagenome	Rhizosphere
108	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
109	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
110	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
111	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
112	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
113	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
114	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
115	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
116	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
117	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
118	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
119	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
120	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
121	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
122	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
123	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
124	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
125	3300021384	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9	Metagenome	Unclassified
126	3300021388	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8	Metagenome	Unclassified
127	3300025303	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
128	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
129	3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
130	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
131	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
132	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
133	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
134	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
135	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
136	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
137	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
138	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
139	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
140	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
141	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
142	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
143	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
144	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
145	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
146	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
147	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
148	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
149	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
150	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
151	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
152	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
153	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
154	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
155	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
156	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
157	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
158	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
159	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
160	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
161	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
162	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
163	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
164	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
165	3300027866	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2)	Metagenome	Endosphere
166	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
167	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
168	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
169	3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Metagenome	Unclassified
170	3300031251	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG	Metagenome	Rhizosphere
171	3300031456	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM	Metagenome	Unclassified
172	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
173	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
174	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
175	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
176	3300033179	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM	Metagenome	Unclassified
177	3300035119	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4	Metagenome	Rhizosphere
178	3300036712	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA	Metagenome	Rhizosphere
179	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
180	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
181	3300037853	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2	Metagenome	Unclassified
182	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
183	3300041411	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708	Metagenome	Rhizosphere
184	3300041413	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839	Metagenome	Rhizosphere
185	3300041460	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG	Metagenome	Rhizoplane
186	3300042004	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619	Metagenome	Rhizosphere
187	3300044658	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R	Metagenome	Rhizosphere
188	3300044683	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R	Metagenome	Rhizosphere
189	3300044684	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R	Metagenome	Rhizosphere
190	3300044693	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R	Metagenome	Rhizosphere
191	3300044694	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R	Metagenome	Rhizosphere
192	3300044706	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R	Metagenome	Rhizosphere
193	3300044765	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R	Metagenome	Rhizosphere
194	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
195	3300044901	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R	Metagenome	Rhizosphere
196	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
197	3300045836	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R	Metagenome	Rhizosphere
198	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
199	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
200	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
201	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
202	3300046473	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere	Metagenome	Rhizosphere
203	3300046475	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere	Metagenome	Rhizosphere
204	3300046501	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere	Metagenome	Rhizosphere
205	3300046524	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere	Metagenome	Rhizosphere
206	3300046531	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere	Metagenome	Rhizosphere
207	3300046615	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere	Metagenome	Rhizosphere
208	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
209	3300046648	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere	Metagenome	Rhizosphere
210	3300046690	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere	Metagenome	Rhizosphere
211	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
212	3300047320	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere	Metagenome	Rhizosphere
213	3300047323	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere	Metagenome	Rhizosphere
214	3300047469	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere	Metagenome	Rhizosphere
215	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
216	3300047673	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere	Metagenome	Rhizosphere
217	3300048089	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere	Metagenome	Rhizosphere
218	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
219	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
220	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
221	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
222	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
223	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
224	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
225	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
226	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
227	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
228	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
229	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
230	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
231	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
232	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
233	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
234	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
235	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
236	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
237	3300048923	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15	Metagenome	Unclassified
238	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
239	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
240	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
241	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
242	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
243	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
244	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
245	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
246	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
247	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
248	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
249	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
250	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
251	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
252	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
253	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
254	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
255	3300049583	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01	Metagenome	Rhizosphere
256	3300049585	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03	Metagenome	Rhizosphere
257	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
258	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
259	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
260	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
261	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
262	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
263	3300050489	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation	Metagenome	Endosphere
264	3300050490	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation	Metagenome	Endosphere
265	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
266	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
267	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
268	3300050495	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation	Metagenome	Endosphere
269	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
270	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
271	3300050516	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation	Metagenome	Endosphere
272	3300053080	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere	Metagenome	Endosphere
273	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
274	3300053087	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere	Metagenome	Endosphere
275	3300053096	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere	Metagenome	Endosphere
276	3300053108	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere	Metagenome	Endosphere
277	3300053131	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere	Metagenome	Endosphere
278	3300053136	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere	Metagenome	Endosphere
279	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
280	3300053730	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere	Metagenome	Endosphere
281	3300061719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1	Metagenome	Rhizosphere
282	8003314358	Amycolatopsis sp. MtRt-6	Isolate	Unclassified

Type Distribution

Type	Percentage (%)
Metagenomes	89.16
Metatranscriptomes	0
Isolates	10.84

Biome Distribution

Category	Percentage (%)
Aerial Root	0.2
Bulb	0
Endosphere	13.09
Nodule	0.2
Rhizoplane	10.43
Rhizosphere	58.08
Stem	0
Stem Tuber	0.2
Unclassified	17.79

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI24745J21846_1005464	3300002073	Bacteria	1387
2	JGI24742J22300_10002583	3300002244	Bacteria	2896
3	Ga0055540_1000127	3300003792	Bacteria	77764
4	Ga0055540_1000638	3300003792	Bacteria	24867
5	Ga0055540_1004693	3300003792	Bacteria	6056
6	Ga0070676_10146116	3300005328	Bacteria	1509
7	Ga0070683_100131080	3300005329	Bacteria	2372
8	Ga0070683_100404471	3300005329	Bacteria	1302
9	Ga0070683_100432280	3300005329	Bacteria	1256
10	Ga0070670_100072505	3300005331	Bacteria	2957
11	Ga0068869_100018890	3300005334	Bacteria	4700
12	Ga0070666_10108311	3300005335	Bacteria	1920
13	Ga0070682_100006294	3300005337	Bacteria	6659
14	Ga0070682_100114359	3300005337	Bacteria	1803
15	Ga0068868_100220550	3300005338	Bacteria	1587
16	Ga0068868_100229031	3300005338	Bacteria	1558
17	Ga0068868_100391342	3300005338	Bacteria	1198
18	Ga0070660_100305608	3300005339	Bacteria	1304
19	Ga0070689_100098088	3300005340	Bacteria	2317
20	Ga0070687_100012990	3300005343	Bacteria	3696
21	Ga0070661_100311803	3300005344	Bacteria	1227
22	Ga0070668_100005619	3300005347	Bacteria	9295
23	Ga0070668_100140839	3300005347	Bacteria	1943
24	Ga0070669_100010575	3300005353	Bacteria	6552
25	Ga0070669_100153024	3300005353	Bacteria	1787
26	Ga0070671_100308760	3300005355	Bacteria	1347
27	Ga0070674_100051270	3300005356	Bacteria	2843
28	Ga0070659_100026431	3300005366	Bacteria	4467
29	Ga0070667_100000364	3300005367	Bacteria	49361
30	Ga0070667_100104707	3300005367	Bacteria	2448
31	Ga0070667_100170421	3300005367	Bacteria	1921
32	Ga0070667_100184425	3300005367	Bacteria	1846
33	Ga0070667_100225445	3300005367	Bacteria	1669
34	Ga0070709_10083953	3300005434	Bacteria	2085
35	Ga0070714_100041829	3300005435	Bacteria	3869
36	Ga0070714_100148170	3300005435	Bacteria	2112
37	Ga0070714_100322966	3300005435	Bacteria	1444
38	Ga0070710_10038237	3300005437	Bacteria	2634
39	Ga0070700_100189349	3300005441	Bacteria	1437
40	Ga0070663_100003658	3300005455	Bacteria	8906
41	Ga0070663_100037154	3300005455	Bacteria	3389
42	Ga0070663_100249099	3300005455	Bacteria	1405
43	Ga0070678_100121891	3300005456	Bacteria	2057
44	Ga0068867_100325029	3300005459	Bacteria	1276
45	Ga0070685_10008844	3300005466	Bacteria	5191
46	Ga0068853_100018651	3300005539	Bacteria	5744
47	Ga0070686_100051087	3300005544	Bacteria	2630
48	Ga0070665_100060873	3300005548	Bacteria	3785
49	Ga0070665_100321213	3300005548	Bacteria	1552
50	Ga0070664_100164241	3300005564	Bacteria	1966
51	Ga0070664_100203262	3300005564	Bacteria	1768
52	Ga0068857_100063822	3300005577	Bacteria	3274
53	Ga0068854_100015435	3300005578	Bacteria	5059
54	Ga0068854_100247884	3300005578	Bacteria	1421
55	Ga0068852_100070058	3300005616	Bacteria	3075
56	Ga0068852_100521597	3300005616	Bacteria	1185
57	Ga0068859_100023413	3300005617	Bacteria	6197
58	Ga0068864_100070380	3300005618	Bacteria	3044
59	Ga0068866_10183431	3300005718	Bacteria	1238
60	Ga0068861_100058263	3300005719	Bacteria	2953
61	Ga0068863_100001544	3300005841	Bacteria	22729
62	Ga0068863_100027470	3300005841	Bacteria	5428
63	Ga0068858_100156673	3300005842	Bacteria	2143
64	Ga0068858_100268462	3300005842	Bacteria	1623
65	Ga0068860_100000480	3300005843	Bacteria	49553
66	Ga0068860_100086371	3300005843	Bacteria	2985
67	Ga0068860_100477764	3300005843	Bacteria	1242
68	Ga0068862_100003092	3300005844	Bacteria	14511
69	Ga0075365_10006226	3300006038	Bacteria	6542
70	Ga0075365_10011534	3300006038	Bacteria	5199
71	Ga0075365_10024436	3300006038	Bacteria	3812
72	Ga0075365_10062177	3300006038	Bacteria	2496
73	Ga0075365_10083344	3300006038	Bacteria	2169
74	Ga0075365_10093252	3300006038	Bacteria	2054
75	Ga0075365_10264812	3300006038	Bacteria	1209
76	Ga0075363_100008942	3300006048	Bacteria	4689
77	Ga0075363_100027186	3300006048	Bacteria	2932
78	Ga0075363_100029747	3300006048	Bacteria	2822
79	Ga0075363_100055855	3300006048	Bacteria	2116
80	Ga0075364_10026686	3300006051	Bacteria	3686
81	Ga0075364_10055171	3300006051	Bacteria	2599
82	Ga0075364_10083584	3300006051	Bacteria	2113
83	Ga0075364_10084502	3300006051	Bacteria	2102
84	Ga0075364_10149918	3300006051	Bacteria	1571
85	Ga0075362_10034695	3300006177	Bacteria	2200
86	Ga0075367_10018764	3300006178	Bacteria	3822
87	Ga0075369_10002483	3300006186	Bacteria	6586
88	Ga0075369_10004574	3300006186	Bacteria	5128
89	Ga0075366_10046351	3300006195	Bacteria	2576
90	Ga0075370_10015997	3300006353	Bacteria	4030
91	Ga0075370_10065506	3300006353	Bacteria	2072
92	Ga0075370_10072210	3300006353	Bacteria	1975
93	Ga0075370_10099684	3300006353	Bacteria	1680
94	Ga0075428_100221909	3300006844	Bacteria	2041
95	Ga0075428_100663412	3300006844	Bacteria	1112
96	Ga0097620_100023416	3300006931	Bacteria	6197
97	Ga0099795_10003398	3300007788	Bacteria	3934
98	Ga0105250_10086292	3300009092	Bacteria	1274
99	Ga0111539_10300497	3300009094	Bacteria	1868
100	Ga0105247_10000089	3300009101	Bacteria	98925
101	Ga0105247_10038607	3300009101	Bacteria	2916
102	Ga0105247_10172792	3300009101	Bacteria	1438
103	Ga0105243_10332524	3300009148	Bacteria	1388
104	Ga0105242_10032662	3300009176	Bacteria	4163
105	Ga0105248_10001655	3300009177	Bacteria	24793
106	Ga0105237_10011932	3300009545	Bacteria	9184
107	Ga0105237_10072477	3300009545	Bacteria	3438
108	Ga0105238_10205436	3300009551	Bacteria	1946
109	Ga0105238_10588498	3300009551	Bacteria	1120
110	Ga0105249_10004181	3300009553	Bacteria	12462
111	Ga0105249_10135779	3300009553	Bacteria	2353
112	Ga0105239_10003567	3300010375	Bacteria	19027
113	Ga0105239_10049723	3300010375	Bacteria	4597
114	Ga0105239_10055107	3300010375	Bacteria	4361
115	Ga0157370_10250893	3300013104	Bacteria	1637
116	Ga0163162_10437033	3300013306	Bacteria	1441
117	Ga0157372_10189279	3300013307	Bacteria	2383
118	Ga0157375_10215000	3300013308	Bacteria	2080
119	Ga0163163_10077182	3300014325	Bacteria	3327
120	Ga0157380_10058071	3300014326	Bacteria	3084
121	Ga0157379_10030774	3300014968	Bacteria	4780
122	Ga0157379_10064720	3300014968	Bacteria	3267
123	Ga0163161_10155029	3300017792	Bacteria	1743
124	Ga0213876_10005150	3300021384	Bacteria	7208
125	Ga0213876_10062902	3300021384	Bacteria	1959
126	Ga0213875_10002397	3300021388	Bacteria	11279
127	Ga0213875_10015473	3300021388	Bacteria	3712
128	Ga0213875_10127739	3300021388	Bacteria	1188
129	Ga0209051_1000014	3300025303	Bacteria	552732
130	Ga0209051_1000649	3300025303	Bacteria	39520
131	Ga0209051_1012804	3300025303	Bacteria	4036
132	Ga0209051_1012898	3300025303	Bacteria	4012
133	Ga0207642_10128858	3300025899	Bacteria	1317
134	Ga0207710_10000117	3300025900	Bacteria	98934
135	Ga0207699_10021941	3300025906	Bacteria	3451
136	Ga0207645_10027663	3300025907	Bacteria	3660
137	Ga0207654_10206581	3300025911	Bacteria	1296
138	Ga0207707_10502738	3300025912	Bacteria	1034
139	Ga0207671_10017648	3300025914	Bacteria	5497
140	Ga0207662_10003732	3300025918	Bacteria	7898
141	Ga0207657_10033309	3300025919	Bacteria	4646
142	Ga0207652_10379846	3300025921	Bacteria	1275
143	Ga0207681_10000981	3300025923	Bacteria	18645
144	Ga0207687_10051560	3300025927	Bacteria	2869
145	Ga0207664_10064267	3300025929	Bacteria	2934
146	Ga0207664_10160041	3300025929	Bacteria	1920
147	Ga0207664_10213658	3300025929	Bacteria	1670
148	Ga0207664_10218268	3300025929	Bacteria	1653
149	Ga0207664_10264034	3300025929	Bacteria	1506
150	Ga0207644_10010354	3300025931	Bacteria	6146
151	Ga0207690_10310706	3300025932	Bacteria	1236
152	Ga0207686_10078452	3300025934	Bacteria	2147
153	Ga0207709_10014345	3300025935	Bacteria	4374
154	Ga0207704_10250957	3300025938	Bacteria	1328
155	Ga0207691_10103703	3300025940	Bacteria	2536
156	Ga0207711_10000738	3300025941	Bacteria	32123
157	Ga0207689_10321100	3300025942	Bacteria	1285
158	Ga0207679_10423414	3300025945	Bacteria	1175
159	Ga0207712_10002271	3300025961	Bacteria	12472
160	Ga0207668_10141406	3300025972	Bacteria	1851
161	Ga0207668_10397565	3300025972	Bacteria	1164
162	Ga0207658_10000680	3300025986	Bacteria	29606
163	Ga0207658_10068275	3300025986	Bacteria	2681
164	Ga0207658_10201176	3300025986	Bacteria	1663
165	Ga0207658_10336222	3300025986	Bacteria	1311
166	Ga0207677_10197270	3300026023	Bacteria	1597
167	Ga0207677_10263034	3300026023	Bacteria	1407
168	Ga0207677_10502088	3300026023	Bacteria	1049
169	Ga0207703_10087618	3300026035	Bacteria	2611
170	Ga0207703_10178825	3300026035	Bacteria	1871
171	Ga0207639_10021723	3300026041	Bacteria	4613
172	Ga0207678_10000033	3300026067	Bacteria	105464
173	Ga0207678_10056196	3300026067	Bacteria	3388
174	Ga0207678_10217033	3300026067	Bacteria	1637
175	Ga0207678_10370509	3300026067	Bacteria	1237
176	Ga0207708_10040920	3300026075	Bacteria	3534
177	Ga0207702_10364167	3300026078	Bacteria	1386
178	Ga0207641_10001265	3300026088	Bacteria	25170
179	Ga0207641_10150602	3300026088	Bacteria	2107
180	Ga0207648_10117659	3300026089	Bacteria	2335
181	Ga0207676_10078327	3300026095	Bacteria	2677
182	Ga0207676_10259369	3300026095	Bacteria	1568
183	Ga0207674_10115800	3300026116	Bacteria	2652
184	Ga0207675_100088777	3300026118	Bacteria	2904
185	Ga0207683_10073901	3300026121	Bacteria	3016
186	Ga0209813_10004918	3300027866	Bacteria	3218
187	Ga0268266_10073226	3300028379	Bacteria	2972
188	Ga0268266_10108102	3300028379	Bacteria	2461
189	Ga0268266_10125070	3300028379	Bacteria	2293
190	Ga0268265_10002308	3300028380	Bacteria	14529
191	Ga0268264_10000503	3300028381	Bacteria	50726
192	Ga0268264_10491720	3300028381	Bacteria	1195
193	Ga0307515_10042606	3300028794	Bacteria	7093
194	Ga0265327_10000001	3300031251	Bacteria	894475
195	Ga0265327_10000113	3300031251	Bacteria	175267
196	Ga0265327_10001712	3300031251	Bacteria	26120
197	Ga0265327_10081875	3300031251	Bacteria	1593
198	Ga0307513_10150460	3300031456	Bacteria	2237
199	Ga0307410_10092837	3300031852	Bacteria	2147
200	Ga0307406_10070997	3300031901	Bacteria	2281
201	Ga0307406_10124536	3300031901	Bacteria	1798
202	Ga0307409_100000751	3300031995	Bacteria	14618
203	Ga0307416_100112242	3300032002	Bacteria	2405
204	Ga0307507_10042509	3300033179	Bacteria	4526
205	Ga0373956_0002622	3300035119	Bacteria	7291
206	Ga0316584_0129196	3300036712	Bacteria	1887
207	Ga0373925_0267331	3300037068	Bacteria	1375
208	Ga0395898_0043208	3300037466	Bacteria	4442
209	Ga0436364_0475075	3300037853	Bacteria	64774
210	Ga0436364_0636212	3300037853	Bacteria	4687
211	Ga0436364_1225776	3300037853	Bacteria	23812
212	Ga0436365_0204440	3300039437	Bacteria	69949
213	Ga0436365_0429891	3300039437	Bacteria	4987
214	Ga0436365_1091168	3300039437	Bacteria	34943
215	Ga0436365_1541644	3300039437	Bacteria	6062
216	Ga0436365_1771144	3300039437	Bacteria	2801
217	Ga0439466_0002141	3300041411	Bacteria	7745
218	Ga0439465_0000056	3300041413	Bacteria	24000
219	Ga0439465_0006460	3300041413	Bacteria	3725
220	Ga0451802_1948664	3300041460	Bacteria	1404
221	Ga0439445_0001364	3300042004	Bacteria	5292
222	Ga0466972_0001846	3300044658	Bacteria	10374
223	Ga0466972_0003037	3300044658	Bacteria	8322
224	Ga0466972_0007899	3300044658	Bacteria	5334
225	Ga0466972_0027837	3300044658	Bacteria	2794
226	Ga0466972_0058266	3300044658	Bacteria	1855
227	Ga0466965_0000276	3300044683	Bacteria	16929
228	Ga0466965_0002495	3300044683	Bacteria	7832
229	Ga0466965_0025371	3300044683	Bacteria	2869
230	Ga0466966_0026107	3300044684	Bacteria	3814
231	Ga0466966_0143757	3300044684	Bacteria	1457
232	Ga0466961_0133438	3300044693	Bacteria	1556
233	Ga0466961_0190910	3300044693	Bacteria	1270
234	Ga0466963_0017831	3300044694	Bacteria	4430
235	Ga0466963_0082250	3300044694	Bacteria	2182
236	Ga0466963_0176706	3300044694	Bacteria	1490
237	Ga0466963_0184434	3300044694	Bacteria	1457
238	Ga0466963_0238800	3300044694	Bacteria	1274
239	Ga0466963_0252100	3300044694	Bacteria	1239
240	Ga0466964_0115848	3300044706	Bacteria	1201
241	Ga0466970_0083718	3300044765	Bacteria	1726
242	Ga0466970_0119355	3300044765	Bacteria	1444
243	Ga0466957_0032762	3300044842	Bacteria	3113
244	Ga0466957_0042217	3300044842	Bacteria	2758
245	Ga0466957_0043863	3300044842	Bacteria	2709
246	Ga0466957_0222617	3300044842	Bacteria	1246
247	Ga0466960_0001321	3300044901	Bacteria	8987
248	Ga0466960_0001779	3300044901	Bacteria	7909
249	Ga0466960_0014246	3300044901	Bacteria	3399
250	Ga0466960_0027743	3300044901	Bacteria	2586
251	Ga0466959_0011700	3300045049	Bacteria	6311
252	Ga0466959_0067287	3300045049	Bacteria	2597
253	Ga0466959_0192377	3300045049	Bacteria	1423
254	Ga0466958_0074994	3300045836	Bacteria	2074
255	Ga0466967_0003446	3300045976	Bacteria	10325
256	Ga0466967_0087182	3300045976	Bacteria	2829
257	Ga0466967_0122589	3300045976	Bacteria	2404
258	Ga0466967_0129033	3300045976	Bacteria	2345
259	Ga0466967_0153179	3300045976	Bacteria	2157
260	Ga0466967_0360230	3300045976	Bacteria	1409
261	Ga0466967_0504695	3300045976	Bacteria	1187
262	Ga0495603_0054531	3300046455	Bacteria	2369
263	Ga0495629_0068765	3300046459	Bacteria	2471
264	Ga0495638_0000355	3300046460	Bacteria	57159
265	Ga0495638_0019179	3300046460	Bacteria	4527
266	Ga0495582_0038059	3300046473	Bacteria	2646
267	Ga0495639_0098432	3300046475	Bacteria	1379
268	Ga0495607_0014955	3300046501	Bacteria	5045
269	Ga0495648_0001604	3300046524	Bacteria	22021
270	Ga0495665_0035750	3300046531	Bacteria	2653
271	Ga0495665_0042666	3300046531	Bacteria	2414
272	Ga0495656_0136584	3300046615	Bacteria	1172
273	Ga0495668_0000167	3300046616	Bacteria	97427
274	Ga0495611_0070952	3300046648	Bacteria	1592
275	Ga0495624_0090884	3300046690	Bacteria	1884
276	Ga0495581_0012231	3300047315	Bacteria	4970
277	Ga0495581_0157485	3300047315	Bacteria	1327
278	Ga0495672_0001082	3300047320	Bacteria	27689
279	Ga0495683_0001255	3300047323	Bacteria	17202
280	Ga0495673_0001541	3300047469	Bacteria	18121
281	Ga0495686_0032509	3300047472	Bacteria	3377
282	Ga0495593_0002187	3300047673	Bacteria	11696
283	Ga0495614_0043016	3300048089	Bacteria	1937
284	Ga0496100_0000043	3300048903	Bacteria	89692
285	Ga0496100_0014806	3300048903	Bacteria	4538
286	Ga0496100_0017673	3300048903	Bacteria	4216
287	Ga0496101_0000050	3300048904	Bacteria	144545
288	Ga0496101_0000149	3300048904	Bacteria	60550
289	Ga0496101_0001052	3300048904	Bacteria	16316
290	Ga0496101_0003555	3300048904	Bacteria	9721
291	Ga0496101_0008233	3300048904	Bacteria	6807
292	Ga0496101_0076612	3300048904	Bacteria	2464
293	Ga0496101_0077428	3300048904	Bacteria	2451
294	Ga0496102_0000001	3300048905	Bacteria	873433
295	Ga0496102_0000399	3300048905	Bacteria	50723
296	Ga0496102_0002651	3300048905	Bacteria	15211
297	Ga0496102_0048536	3300048905	Bacteria	3860
298	Ga0496102_0407213	3300048905	Bacteria	1278
299	Ga0496103_0000007	3300048906	Bacteria	354915
300	Ga0496103_0000152	3300048906	Bacteria	72428
301	Ga0496103_0000861	3300048906	Bacteria	22084
302	Ga0496103_0095082	3300048906	Bacteria	1883
303	Ga0496105_0042005	3300048908	Bacteria	3769
304	Ga0496105_0127937	3300048908	Bacteria	2094
305	Ga0496106_0000354	3300048909	Bacteria	32433
306	Ga0496106_0020168	3300048909	Bacteria	4945
307	Ga0496106_0086345	3300048909	Bacteria	2416
308	Ga0496107_0000154	3300048910	Bacteria	34838
309	Ga0496107_0172275	3300048910	Bacteria	1606
310	Ga0496107_0483765	3300048910	Bacteria	918
311	Ga0496108_0001025	3300048911	Bacteria	21763
312	Ga0496108_0070881	3300048911	Bacteria	2941
313	Ga0496108_0089947	3300048911	Bacteria	2609
314	Ga0496108_0179961	3300048911	Bacteria	1831
315	Ga0496109_0000194	3300048912	Bacteria	60448
316	Ga0496109_0059283	3300048912	Bacteria	3497
317	Ga0496109_0095695	3300048912	Bacteria	2750
318	Ga0496109_0187502	3300048912	Bacteria	1943
319	Ga0496110_0125123	3300048913	Bacteria	2319
320	Ga0496110_0213083	3300048913	Bacteria	1756
321	Ga0496111_0185697	3300048914	Bacteria	1546
322	Ga0496112_0011240	3300048915	Bacteria	8166
323	Ga0496112_0016985	3300048915	Bacteria	6830
324	Ga0496112_0118019	3300048915	Bacteria	2623
325	Ga0496113_0048352	3300048916	Bacteria	3164
326	Ga0496113_0091044	3300048916	Bacteria	2350
327	Ga0496113_0376878	3300048916	Bacteria	1139
328	Ga0496114_0000565	3300048917	Bacteria	27454
329	Ga0496114_0116541	3300048917	Bacteria	2293
330	Ga0496114_0281892	3300048917	Bacteria	1465
331	Ga0496115_0003893	3300048918	Bacteria	10757
332	Ga0496115_0057795	3300048918	Bacteria	3120
333	Ga0496115_0147212	3300048918	Bacteria	1944
334	Ga0496116_0000018	3300048919	Bacteria	545877
335	Ga0496116_0006988	3300048919	Bacteria	10113
336	Ga0496117_0000015	3300048920	Bacteria	583316
337	Ga0496117_0007758	3300048920	Bacteria	10364
338	Ga0496117_0016646	3300048920	Bacteria	6187
339	Ga0496118_0000012	3300048921	Bacteria	583316
340	Ga0496118_0001082	3300048921	Bacteria	42392
341	Ga0496118_0001705	3300048921	Bacteria	32141
342	Ga0496118_0004854	3300048921	Bacteria	15656
343	Ga0496119_0000172	3300048922	Bacteria	91464
344	Ga0496119_0001151	3300048922	Bacteria	33191
345	Ga0496119_0003415	3300048922	Bacteria	16502
346	Ga0496120_0000155	3300048923	Bacteria	114046
347	Ga0496120_0022303	3300048923	Bacteria	3985
348	Ga0496120_0025799	3300048923	Bacteria	3643
349	Ga0496120_0035799	3300048923	Bacteria	2961
350	Ga0496121_0000048	3300048924	Bacteria	330242
351	Ga0496121_0001740	3300048924	Bacteria	35570
352	Ga0496121_0008039	3300048924	Bacteria	12574
353	Ga0496122_0000301	3300048925	Bacteria	109636
354	Ga0496122_0024943	3300048925	Bacteria	5217
355	Ga0496123_0003557	3300048926	Bacteria	17285
356	Ga0496123_0008036	3300048926	Bacteria	9767
357	Ga0496124_0000044	3300048927	Bacteria	289064
358	Ga0496124_0221861	3300048927	Bacteria	1421
359	Ga0496125_0000037	3300048928	Bacteria	330242
360	Ga0496125_0004133	3300048928	Bacteria	16948
361	Ga0496125_0073616	3300048928	Bacteria	2654
362	Ga0496125_0135588	3300048928	Bacteria	1723
363	Ga0496126_0000046	3300048929	Bacteria	330242
364	Ga0496126_0000920	3300048929	Bacteria	50943
365	Ga0496126_0001956	3300048929	Bacteria	29218
366	Ga0496126_0016321	3300048929	Bacteria	7430
367	Ga0496126_0042616	3300048929	Bacteria	4191
368	Ga0496126_0060055	3300048929	Bacteria	3421
369	Ga0496126_0310981	3300048929	Bacteria	1297
370	Ga0501031_0082887	3300049568	Bacteria	2090
371	Ga0501032_0004276	3300049569	Bacteria	10782
372	Ga0501032_0029022	3300049569	Bacteria	3799
373	Ga0501033_0054506	3300049570	Bacteria	2958
374	Ga0501033_0187712	3300049570	Bacteria	1480
375	Ga0501034_0012193	3300049571	Bacteria	8889
376	Ga0501034_0018645	3300049571	Bacteria	7113
377	Ga0501034_0023625	3300049571	Bacteria	6262
378	Ga0501036_0033055	3300049572	Bacteria	4374
379	Ga0501036_0310042	3300049572	Bacteria	1319
380	Ga0501037_0000709	3300049573	Bacteria	25325
381	Ga0501037_0090829	3300049573	Bacteria	2208
382	Ga0501038_0000030	3300049574	Bacteria	132455
383	Ga0501043_0001589	3300049579	Bacteria	19750
384	Ga0501046_0000628	3300049580	Bacteria	34641
385	Ga0501047_0007282	3300049581	Bacteria	10401
386	Ga0501047_0007604	3300049581	Bacteria	10198
387	Ga0501048_0004665	3300049582	Bacteria	10430
388	Ga0501067_0175913	3300049583	Bacteria	1192
389	Ga0501069_0051101	3300049585	Bacteria	2300
390	Ga0501070_0001530	3300049586	Bacteria	20572
391	Ga0501070_0005079	3300049586	Bacteria	11217
392	Ga0501070_0130369	3300049586	Bacteria	2077
393	Ga0501073_0108210	3300049589	Bacteria	1929
394	Ga0501080_0211805	3300049742	Bacteria	1776
395	Ga0501083_0037722	3300049744	Bacteria	3289
396	Ga0501035_0000229	3300049822	Bacteria	66514
397	Ga0501035_0001480	3300049822	Bacteria	24041
398	Ga0501044_0000880	3300049823	Bacteria	36201
399	Ga0501044_0006629	3300049823	Bacteria	12768
400	Ga0501044_0011895	3300049823	Bacteria	9431
401	Ga0501044_0014099	3300049823	Bacteria	8629
402	Ga0501044_0170246	3300049823	Bacteria	2150
403	nmdc:mga03683_28758_c1	3300050489	Bacteria	2212
404	nmdc:mga03n38_100657_c1	3300050490	Bacteria	1393
405	nmdc:mga03n38_8539_c1	3300050490	Bacteria	3683
406	nmdc:mga03n38_9350_c1	3300050490	Bacteria	3563
407	nmdc:mga00v17_32160_c1	3300050491	Bacteria	3100
408	nmdc:mga00v17_33477_c1	3300050491	Bacteria	3045
409	nmdc:mga00v17_43101_c1	3300050491	Bacteria	2716
410	nmdc:mga00v17_56873_c1	3300050491	Bacteria	2392
411	nmdc:mga00v17_57422_c1	3300050491	Bacteria	2381
412	nmdc:mga00v17_7765_c1	3300050491	Bacteria	5748
413	nmdc:mga0yw44_15634_c2	3300050492	Bacteria	3365
414	nmdc:mga0yw44_307413_c1	3300050492	Bacteria	1063
415	nmdc:mga0yw44_49093_c1	3300050492	Bacteria	2188
416	nmdc:mga0yw44_52061_c1	3300050492	Bacteria	2481
417	nmdc:mga0yw44_54274_c1	3300050492	Bacteria	2435
418	nmdc:mga0yw44_89454_c1	3300050492	Bacteria	1943
419	nmdc:mga0k408_61875_c1	3300050493	Bacteria	2176
420	nmdc:mga04h51_39021_c1	3300050495	Bacteria	1541
421	nmdc:mga07m45_100391_c1	3300050496	Bacteria	1662
422	nmdc:mga07m45_174308_c1	3300050496	Bacteria	1250
423	nmdc:mga07m45_17456_c1	3300050496	Bacteria	3855
424	nmdc:mga08y16_38030_c1	3300050511	Bacteria	5052
425	nmdc:mga0sz30_25434_c1	3300050516	Bacteria	2420
426	nmdc:mga0sz30_39135_c1	3300050516	Bacteria	1989
427	Ga0500635_0048782	3300053080	Bacteria	1443
428	Ga0495619_0165352	3300053085	Bacteria	1529
429	Ga0500643_015511	3300053087	Bacteria	2609
430	Ga0500641_0063774	3300053096	Bacteria	1538
431	Ga0500562_004842	3300053108	Bacteria	3391
432	Ga0500652_035522	3300053131	Bacteria	1980
433	Ga0500559_0019013	3300053136	Bacteria	2903
434	Ga0500616_0010632	3300053153	Bacteria	5492
435	Ga0500645_000004	3300053730	Bacteria	305014
436	Ga0466962_0016909	3300061719	Bacteria	3515

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300048910	Ga0496107_0483765	Ga0496107_0483765_17_817	254
2	3300044765	Ga0466970_0083718	Ga0466970_0083718_97_909	268
3	3300044658	Ga0466972_0058266	Ga0466972_0058266_282_1184	279
4	3300048913	Ga0496110_0125123	Ga0496110_0125123_755_1666	280
5	3300037068	Ga0373925_0267331	Ga0373925_0267331_492_1364	282
6	3300031456	Ga0307513_10150460	Ga0307513_101504602	284
7	3300048904	Ga0496101_0008233	Ga0496101_0008233_2685_3686	287
8	3300048915	Ga0496112_0016985	Ga0496112_0016985_4285_5286	287
9	3300048916	Ga0496113_0091044	Ga0496113_0091044_849_1850	287
10	3300048918	Ga0496115_0147212	Ga0496115_0147212_436_1467	287
11	3300048923	Ga0496120_0022303	Ga0496120_0022303_2790_3791	287
12	3300048925	Ga0496122_0024943	Ga0496122_0024943_1225_2226	287
13	3300048926	Ga0496123_0008036	Ga0496123_0008036_6517_7518	287
14	3300048927	Ga0496124_0221861	Ga0496124_0221861_99_1130	287
15	3300048929	Ga0496126_0001956	Ga0496126_0001956_3744_4775	287
16	3300003792	Ga0055540_1004693	Ga0055540_10046934	288
17	3300025303	Ga0209051_1000649	Ga0209051_100064913	288
18	3300049571	Ga0501034_0023625	Ga0501034_0023625_2225_3124	288
19	3300049586	Ga0501070_0005079	Ga0501070_0005079_4911_5810	288
20	3300050495	nmdc:mga04h51_39021_c1	nmdc:mga04h51_39021_c1_655_1527	288
21	3300048911	Ga0496108_0179961	Ga0496108_0179961_498_1376	290
22	iso_pu_bacteria	2744054611	2744956096	290
23	iso_pu_bacteria	2902799365	2902800381	290
24	3300049586	Ga0501070_0130369	Ga0501070_0130369_678_1631	291
25	iso_pu_bacteria	2738543005	2739206417	291
26	iso_pu_bacteria	2738543011	2739239228	291
27	iso_pu_bacteria	2842134933	2842136190	291
28	iso_pu_bacteria	2889300758	2889304182	291
29	iso_pu_bacteria	2939743619	2939745424	291
30	iso_pu_bacteria	2956939328	2956940716	291
31	iso_pu_bacteria	3001119090	3001120396	291
32	3300006038	Ga0075365_10011534	Ga0075365_100115344	292
33	3300006186	Ga0075369_10004574	Ga0075369_100045747	292
34	3300050492	nmdc:mga0yw44_15634_c2	nmdc:mga0yw44_15634_c2_1937_2842	292
35	3300045976	Ga0466967_0129033	Ga0466967_0129033_1059_1970	293
36	iso_pu_bacteria	2565956761	2566994615	293
37	iso_pu_bacteria	2738541274	2738703217	293
38	iso_pu_bacteria	2738543028	2739329319	293
39	iso_pu_bacteria	2738543034	2739362984	293
40	iso_pu_bacteria	2808606365	2808874037	293
41	iso_pu_bacteria	2902792274	2902795286	293
42	iso_pu_bacteria	2904535858	2904536138	293
43	iso_pu_bacteria	2922554459	2922558068	293
44	3300044694	Ga0466963_0238800	Ga0466963_0238800_236_1168	294
45	3300048917	Ga0496114_0116541	Ga0496114_0116541_1128_2021	294
46	3300050492	nmdc:mga0yw44_89454_c1	nmdc:mga0yw44_89454_c1_920_1810	294
47	iso_pu_bacteria	2523231044	2523384182	294
48	iso_pu_bacteria	2582580736	2583148728	294
49	iso_pu_bacteria	2902810491	2902810919	294
50	iso_pu_bacteria	2902837492	2902842895	294
51	iso_pu_bacteria	2904765812	2904768351	294
52	iso_pu_bacteria	2904770941	2904775784	294
53	iso_pu_bacteria	2908811453	2908815676	294
54	3300006038	Ga0075365_10093252	Ga0075365_100932522	295
55	3300006051	Ga0075364_10084502	Ga0075364_100845023	295
56	3300009551	Ga0105238_10588498	Ga0105238_105884981	295
57	3300025935	Ga0207709_10014345	Ga0207709_100143452	295
58	3300049569	Ga0501032_0004276	Ga0501032_0004276_893_1792	295
59	3300049572	Ga0501036_0310042	Ga0501036_0310042_146_1045	295
60	3300049573	Ga0501037_0000709	Ga0501037_0000709_5120_6019	295
61	3300049574	Ga0501038_0000030	Ga0501038_0000030_13429_14328	295
62	3300049579	Ga0501043_0001589	Ga0501043_0001589_15541_16440	295
63	3300049583	Ga0501067_0175913	Ga0501067_0175913_13_912	295
64	3300049823	Ga0501044_0011895	Ga0501044_0011895_3889_4788	295
65	3300050491	nmdc:mga00v17_43101_c1	nmdc:mga00v17_43101_c1_1334_2221	295
66	3300050492	nmdc:mga0yw44_49093_c1	nmdc:mga0yw44_49093_c1_671_1558	295
67	iso_pu_bacteria	2643221567	2643853275	295
68	iso_pu_bacteria	2643221624	2644137237	295
69	iso_pu_bacteria	2643221715	2644639950	295
70	iso_pu_bacteria	2738541264	2738663873	295
71	iso_pu_bacteria	2738541356	2739143008	295
72	3300003792	Ga0055540_1000127	Ga0055540_100012777	296
73	3300006048	Ga0075363_100027186	Ga0075363_1000271863	296
74	3300009545	Ga0105237_10011932	Ga0105237_100119326	296
75	3300010375	Ga0105239_10003567	Ga0105239_1000356716	296
76	3300025303	Ga0209051_1000014	Ga0209051_1000014141	296
77	3300025914	Ga0207671_10017648	Ga0207671_100176484	296
78	3300031251	Ga0265327_10081875	Ga0265327_100818752	296
79	3300041413	Ga0439465_0000056	Ga0439465_0000056_2512_3444	296
80	3300044658	Ga0466972_0003037	Ga0466972_0003037_4109_5071	296
81	3300044683	Ga0466965_0000276	Ga0466965_0000276_6509_7471	296
82	3300044683	Ga0466965_0025371	Ga0466965_0025371_1033_1959	296
83	3300044694	Ga0466963_0017831	Ga0466963_0017831_3115_4035	296
84	3300044706	Ga0466964_0115848	Ga0466964_0115848_184_1104	296
85	3300044842	Ga0466957_0032762	Ga0466957_0032762_107_1027	296
86	3300045049	Ga0466959_0011700	Ga0466959_0011700_1128_2090	296
87	3300045049	Ga0466959_0067287	Ga0466959_0067287_1629_2549	296
88	3300045976	Ga0466967_0003446	Ga0466967_0003446_9194_10156	296
89	3300045976	Ga0466967_0153179	Ga0466967_0153179_109_1035	296
90	3300050490	nmdc:mga03n38_100657_c1	nmdc:mga03n38_100657_c1_259_1149	296
91	iso_pu_bacteria	2919713450	2919714766	296
92	3300005335	Ga0070666_10108311	Ga0070666_101083112	297
93	3300005367	Ga0070667_100104707	Ga0070667_1001047072	297
94	3300005367	Ga0070667_100184425	Ga0070667_1001844252	297
95	3300005435	Ga0070714_100148170	Ga0070714_1001481702	297
96	3300005841	Ga0068863_100027470	Ga0068863_1000274704	297
97	3300006048	Ga0075363_100055855	Ga0075363_1000558553	297
98	3300006177	Ga0075362_10034695	Ga0075362_100346952	297
99	3300006353	Ga0075370_10065506	Ga0075370_100655062	297
100	3300009092	Ga0105250_10086292	Ga0105250_100862922	297
101	3300025929	Ga0207664_10160041	Ga0207664_101600412	297
102	3300025931	Ga0207644_10010354	Ga0207644_100103545	297
103	3300025986	Ga0207658_10068275	Ga0207658_100682752	297
104	3300031251	Ga0265327_10001712	Ga0265327_1000171212	297
105	3300041460	Ga0451802_1948664	Ga0451802_1948664_92_988	297
106	3300044658	Ga0466972_0001846	Ga0466972_0001846_3169_4068	297
107	3300044683	Ga0466965_0002495	Ga0466965_0002495_1866_2765	297
108	3300044693	Ga0466961_0133438	Ga0466961_0133438_554_1447	297
109	3300044765	Ga0466970_0119355	Ga0466970_0119355_405_1298	297
110	3300044901	Ga0466960_0001779	Ga0466960_0001779_2929_3828	297
111	3300045976	Ga0466967_0360230	Ga0466967_0360230_31_930	297
112	3300046460	Ga0495638_0000355	Ga0495638_0000355_46087_46980	297
113	3300046460	Ga0495638_0019179	Ga0495638_0019179_1812_2705	297
114	3300046616	Ga0495668_0000167	Ga0495668_0000167_80442_81338	297
115	3300048903	Ga0496100_0000043	Ga0496100_0000043_47604_48542	297
116	3300048903	Ga0496100_0017673	Ga0496100_0017673_2715_3629	297
117	3300048904	Ga0496101_0000050	Ga0496101_0000050_65073_65987	297
118	3300048904	Ga0496101_0000149	Ga0496101_0000149_41116_42054	297
119	3300048904	Ga0496101_0077428	Ga0496101_0077428_195_1088	297
120	3300048905	Ga0496102_0000001	Ga0496102_0000001_334677_335591	297
121	3300048905	Ga0496102_0002651	Ga0496102_0002651_8883_9821	297
122	3300048906	Ga0496103_0000007	Ga0496103_0000007_20098_21012	297
123	3300048906	Ga0496103_0000152	Ga0496103_0000152_48455_49393	297
124	3300048908	Ga0496105_0127937	Ga0496105_0127937_732_1646	297
125	3300048909	Ga0496106_0000354	Ga0496106_0000354_9621_10559	297
126	3300048909	Ga0496106_0086345	Ga0496106_0086345_1006_1920	297
127	3300048910	Ga0496107_0000154	Ga0496107_0000154_17825_18763	297
128	3300048910	Ga0496107_0172275	Ga0496107_0172275_570_1484	297
129	3300048911	Ga0496108_0001025	Ga0496108_0001025_3492_4430	297
130	3300048912	Ga0496109_0000194	Ga0496109_0000194_17963_18901	297
131	3300048916	Ga0496113_0376878	Ga0496113_0376878_172_1110	297
132	3300048917	Ga0496114_0000565	Ga0496114_0000565_13810_14748	297
133	3300048918	Ga0496115_0003893	Ga0496115_0003893_3126_4064	297
134	3300048919	Ga0496116_0000018	Ga0496116_0000018_297779_298693	297
135	3300048919	Ga0496116_0006988	Ga0496116_0006988_4795_5733	297
136	3300048920	Ga0496117_0000015	Ga0496117_0000015_247185_248099	297
137	3300048920	Ga0496117_0007758	Ga0496117_0007758_6628_7566	297
138	3300048921	Ga0496118_0000012	Ga0496118_0000012_247185_248099	297
139	3300048921	Ga0496118_0001705	Ga0496118_0001705_28405_29343	297
140	3300048922	Ga0496119_0000172	Ga0496119_0000172_56556_57470	297
141	3300048922	Ga0496119_0001151	Ga0496119_0001151_21112_22050	297
142	3300048923	Ga0496120_0000155	Ga0496120_0000155_6457_7371	297
143	3300048923	Ga0496120_0035799	Ga0496120_0035799_105_1043	297
144	3300048924	Ga0496121_0000048	Ga0496121_0000048_47604_48542	297
145	3300048924	Ga0496121_0001740	Ga0496121_0001740_6251_7165	297
146	3300048925	Ga0496122_0000301	Ga0496122_0000301_67084_68022	297
147	3300048926	Ga0496123_0003557	Ga0496123_0003557_75_1013	297
148	3300048927	Ga0496124_0000044	Ga0496124_0000044_281701_282639	297
149	3300048928	Ga0496125_0000037	Ga0496125_0000037_47604_48542	297
150	3300048928	Ga0496125_0004133	Ga0496125_0004133_1641_2537	297
151	3300048928	Ga0496125_0073616	Ga0496125_0073616_119_1015	297
152	3300048929	Ga0496126_0000046	Ga0496126_0000046_47604_48542	297
153	3300048929	Ga0496126_0000920	Ga0496126_0000920_7542_8456	297
154	3300048929	Ga0496126_0042616	Ga0496126_0042616_1422_2315	297
155	3300050489	nmdc:mga03683_28758_c1	nmdc:mga03683_28758_c1_518_1411	297
156	3300050491	nmdc:mga00v17_7765_c1	nmdc:mga00v17_7765_c1_2700_3599	297
157	3300053087	Ga0500643_015511	Ga0500643_015511_78_971	297
158	3300053096	Ga0500641_0063774	Ga0500641_0063774_88_981	297
159	3300053108	Ga0500562_004842	Ga0500562_004842_1893_2786	297
160	3300053131	Ga0500652_035522	Ga0500652_035522_377_1270	297
161	3300053730	Ga0500645_000004	Ga0500645_000004_207005_207898	297
162	iso_pu_bacteria	2738541308	2738891119	297
163	iso_pu_bacteria	2928142448	2928147080	297
164	iso_pu_bacteria	2929212328	2929218410	297
165	iso_pu_bacteria	2974315732	2974319675	297
166	iso_pu_bacteria	2984523437	2984523541	297
167	3300005367	Ga0070667_100170421	Ga0070667_1001704212	298
168	3300005435	Ga0070714_100322966	Ga0070714_1003229662	298
169	3300005842	Ga0068858_100268462	Ga0068858_1002684622	298
170	3300005843	Ga0068860_100477764	Ga0068860_1004777642	298
171	3300006038	Ga0075365_10006226	Ga0075365_100062264	298
172	3300006038	Ga0075365_10024436	Ga0075365_100244364	298
173	3300006038	Ga0075365_10062177	Ga0075365_100621772	298
174	3300006038	Ga0075365_10264812	Ga0075365_102648121	298
175	3300006048	Ga0075363_100008942	Ga0075363_1000089422	298
176	3300006048	Ga0075363_100029747	Ga0075363_1000297472	298
177	3300006051	Ga0075364_10026686	Ga0075364_100266864	298
178	3300006178	Ga0075367_10018764	Ga0075367_100187642	298
179	3300006195	Ga0075366_10046351	Ga0075366_100463512	298
180	3300006353	Ga0075370_10072210	Ga0075370_100722102	298
181	3300007788	Ga0099795_10003398	Ga0099795_100033985	298
182	3300009101	Ga0105247_10038607	Ga0105247_100386072	298
183	3300009148	Ga0105243_10332524	Ga0105243_103325242	298
184	3300009553	Ga0105249_10135779	Ga0105249_101357792	298
185	3300010375	Ga0105239_10055107	Ga0105239_100551074	298
186	3300013104	Ga0157370_10250893	Ga0157370_102508932	298
187	3300014325	Ga0163163_10077182	Ga0163163_100771821	298
188	3300021384	Ga0213876_10005150	Ga0213876_100051509	298
189	3300021384	Ga0213876_10062902	Ga0213876_100629022	298
190	3300021388	Ga0213875_10015473	Ga0213875_100154733	298
191	3300021388	Ga0213875_10127739	Ga0213875_101277392	298
192	3300025929	Ga0207664_10213658	Ga0207664_102136581	298
193	3300025986	Ga0207658_10201176	Ga0207658_102011762	298
194	3300027866	Ga0209813_10004918	Ga0209813_100049183	298
195	3300028381	Ga0268264_10491720	Ga0268264_104917202	298
196	3300031251	Ga0265327_10000001	Ga0265327_100000017	298
197	3300031251	Ga0265327_10000113	Ga0265327_1000011364	298
198	3300031852	Ga0307410_10092837	Ga0307410_100928371	298
199	3300031995	Ga0307409_100000751	Ga0307409_1000007512	298
200	3300032002	Ga0307416_100112242	Ga0307416_1001122422	298
201	3300037853	Ga0436364_0636212	Ga0436364_0636212_2393_3295	298
202	3300037853	Ga0436364_1225776	Ga0436364_1225776_19803_20723	298
203	3300039437	Ga0436365_0204440	Ga0436365_0204440_52943_53854	298
204	3300039437	Ga0436365_0429891	Ga0436365_0429891_1719_2645	298
205	3300039437	Ga0436365_1091168	Ga0436365_1091168_2126_3052	298
206	3300039437	Ga0436365_1541644	Ga0436365_1541644_5085_5993	298
207	3300039437	Ga0436365_1771144	Ga0436365_1771144_881_1801	298
208	3300044658	Ga0466972_0027837	Ga0466972_0027837_1487_2419	298
209	3300044684	Ga0466966_0026107	Ga0466966_0026107_2784_3692	298
210	3300044693	Ga0466961_0190910	Ga0466961_0190910_154_1068	298
211	3300044694	Ga0466963_0082250	Ga0466963_0082250_1202_2116	298
212	3300044694	Ga0466963_0184434	Ga0466963_0184434_336_1250	298
213	3300044842	Ga0466957_0043863	Ga0466957_0043863_358_1272	298
214	3300044842	Ga0466957_0222617	Ga0466957_0222617_73_978	298
215	3300044901	Ga0466960_0001321	Ga0466960_0001321_1225_2139	298
216	3300044901	Ga0466960_0014246	Ga0466960_0014246_1191_2099	298
217	3300044901	Ga0466960_0027743	Ga0466960_0027743_382_1314	298
218	3300045049	Ga0466959_0192377	Ga0466959_0192377_368_1276	298
219	3300045836	Ga0466958_0074994	Ga0466958_0074994_583_1497	298
220	3300045976	Ga0466967_0087182	Ga0466967_0087182_341_1255	298
221	3300045976	Ga0466967_0122589	Ga0466967_0122589_401_1306	298
222	3300045976	Ga0466967_0504695	Ga0466967_0504695_92_994	298
223	3300046524	Ga0495648_0001604	Ga0495648_0001604_1468_2442	298
224	3300046648	Ga0495611_0070952	Ga0495611_0070952_226_1200	298
225	3300047320	Ga0495672_0001082	Ga0495672_0001082_8341_9315	298
226	3300047469	Ga0495673_0001541	Ga0495673_0001541_590_1564	298
227	3300048903	Ga0496100_0014806	Ga0496100_0014806_1130_2053	298
228	3300048905	Ga0496102_0048536	Ga0496102_0048536_2470_3378	298
229	3300048905	Ga0496102_0407213	Ga0496102_0407213_136_1059	298
230	3300048906	Ga0496103_0095082	Ga0496103_0095082_290_1198	298
231	3300048911	Ga0496108_0070881	Ga0496108_0070881_19_921	298
232	3300048912	Ga0496109_0095695	Ga0496109_0095695_1380_2282	298
233	3300048914	Ga0496111_0185697	Ga0496111_0185697_475_1377	298
234	3300048915	Ga0496112_0118019	Ga0496112_0118019_1384_2286	298
235	3300048917	Ga0496114_0281892	Ga0496114_0281892_383_1297	298
236	3300048920	Ga0496117_0016646	Ga0496117_0016646_641_1549	298
237	3300048921	Ga0496118_0001082	Ga0496118_0001082_38465_39373	298
238	3300048929	Ga0496126_0016321	Ga0496126_0016321_5360_6274	298
239	3300048929	Ga0496126_0310981	Ga0496126_0310981_71_988	298
240	3300049568	Ga0501031_0082887	Ga0501031_0082887_112_1044	298
241	3300049569	Ga0501032_0029022	Ga0501032_0029022_1129_2061	298
242	3300049570	Ga0501033_0054506	Ga0501033_0054506_1618_2550	298
243	3300049570	Ga0501033_0187712	Ga0501033_0187712_348_1247	298
244	3300049571	Ga0501034_0012193	Ga0501034_0012193_1853_2785	298
245	3300049571	Ga0501034_0018645	Ga0501034_0018645_5836_6735	298
246	3300049572	Ga0501036_0033055	Ga0501036_0033055_2420_3352	298
247	3300049573	Ga0501037_0090829	Ga0501037_0090829_738_1670	298
248	3300049580	Ga0501046_0000628	Ga0501046_0000628_15152_16084	298
249	3300049581	Ga0501047_0007282	Ga0501047_0007282_6782_7714	298
250	3300049581	Ga0501047_0007604	Ga0501047_0007604_6489_7388	298
251	3300049582	Ga0501048_0004665	Ga0501048_0004665_8078_9010	298
252	3300049585	Ga0501069_0051101	Ga0501069_0051101_1049_1981	298
253	3300049586	Ga0501070_0001530	Ga0501070_0001530_15024_15956	298
254	3300049589	Ga0501073_0108210	Ga0501073_0108210_381_1313	298
255	3300049742	Ga0501080_0211805	Ga0501080_0211805_143_1075	298
256	3300049744	Ga0501083_0037722	Ga0501083_0037722_2061_2993	298
257	3300049822	Ga0501035_0000229	Ga0501035_0000229_28698_29630	298
258	3300049822	Ga0501035_0001480	Ga0501035_0001480_6332_7231	298
259	3300049823	Ga0501044_0000880	Ga0501044_0000880_6451_7350	298
260	3300049823	Ga0501044_0006629	Ga0501044_0006629_1920_2852	298
261	3300049823	Ga0501044_0170246	Ga0501044_0170246_855_1784	298
262	3300050490	nmdc:mga03n38_8539_c1	nmdc:mga03n38_8539_c1_1752_2654	298
263	3300050491	nmdc:mga00v17_33477_c1	nmdc:mga00v17_33477_c1_1056_1958	298
264	3300050492	nmdc:mga0yw44_307413_c1	nmdc:mga0yw44_307413_c1_47_949	298
265	3300050492	nmdc:mga0yw44_52061_c1	nmdc:mga0yw44_52061_c1_824_1726	298
266	3300050492	nmdc:mga0yw44_54274_c1	nmdc:mga0yw44_54274_c1_1361_2263	298
267	3300050493	nmdc:mga0k408_61875_c1	nmdc:mga0k408_61875_c1_836_1738	298
268	3300050496	nmdc:mga07m45_100391_c1	nmdc:mga07m45_100391_c1_424_1326	298
269	3300050496	nmdc:mga07m45_174308_c1	nmdc:mga07m45_174308_c1_182_1087	298
270	3300053153	Ga0500616_0010632	Ga0500616_0010632_3569_4483	298
271	3300061719	Ga0466962_0016909	Ga0466962_0016909_2518_3426	298
272	iso_pu_bacteria	2547132424	2548692441	298
273	iso_pu_bacteria	2585427649	2586057611	298
274	iso_pu_bacteria	2808606522	2809585781	298
275	iso_pu_bacteria	2915768154	2915771476	298
276	iso_pu_bacteria	2917736166	2917745092	298
277	iso_pu_bacteria	2919420072	2919421722	298
278	iso_pu_bacteria	2919432681	2919434720	298
279	iso_pu_bacteria	8003314358	8003314472	298
280	3300002244	JGI24742J22300_10002583	JGI24742J22300_100025831	299
281	3300003792	Ga0055540_1000638	Ga0055540_10006387	299
282	3300005329	Ga0070683_100404471	Ga0070683_1004044712	299
283	3300005337	Ga0070682_100006294	Ga0070682_1000062942	299
284	3300005338	Ga0068868_100391342	Ga0068868_1003913422	299
285	3300005347	Ga0070668_100005619	Ga0070668_1000056198	299
286	3300005353	Ga0070669_100010575	Ga0070669_1000105752	299
287	3300005355	Ga0070671_100308760	Ga0070671_1003087601	299
288	3300005367	Ga0070667_100000364	Ga0070667_10000036458	299
289	3300005434	Ga0070709_10083953	Ga0070709_100839532	299
290	3300005435	Ga0070714_100041829	Ga0070714_1000418294	299
291	3300005437	Ga0070710_10038237	Ga0070710_100382373	299
292	3300005455	Ga0070663_100003658	Ga0070663_1000036583	299
293	3300005455	Ga0070663_100037154	Ga0070663_1000371544	299
294	3300005539	Ga0068853_100018651	Ga0068853_1000186513	299
295	3300005548	Ga0070665_100060873	Ga0070665_1000608734	299
296	3300005578	Ga0068854_100247884	Ga0068854_1002478842	299
297	3300005617	Ga0068859_100023413	Ga0068859_1000234132	299
298	3300005618	Ga0068864_100070380	Ga0068864_1000703804	299
299	3300005841	Ga0068863_100001544	Ga0068863_10000154414	299
300	3300005842	Ga0068858_100156673	Ga0068858_1001566732	299
301	3300005843	Ga0068860_100000480	Ga0068860_10000048061	299
302	3300005844	Ga0068862_100003092	Ga0068862_1000030926	299
303	3300006038	Ga0075365_10083344	Ga0075365_100833441	299
304	3300006051	Ga0075364_10055171	Ga0075364_100551713	299
305	3300006051	Ga0075364_10149918	Ga0075364_101499182	299
306	3300006353	Ga0075370_10015997	Ga0075370_100159974	299
307	3300006931	Ga0097620_100023416	Ga0097620_1000234162	299
308	3300009101	Ga0105247_10000089	Ga0105247_1000008933	299
309	3300009177	Ga0105248_10001655	Ga0105248_100016557	299
310	3300009545	Ga0105237_10072477	Ga0105237_100724772	299
311	3300009553	Ga0105249_10004181	Ga0105249_1000418110	299
312	3300010375	Ga0105239_10049723	Ga0105239_100497234	299
313	3300014968	Ga0157379_10030774	Ga0157379_100307742	299
314	3300021388	Ga0213875_10002397	Ga0213875_100023977	299
315	3300025303	Ga0209051_1012804	Ga0209051_10128044	299
316	3300025303	Ga0209051_1012898	Ga0209051_10128984	299
317	3300025900	Ga0207710_10000117	Ga0207710_1000011765	299
318	3300025906	Ga0207699_10021941	Ga0207699_100219414	299
319	3300025923	Ga0207681_10000981	Ga0207681_100009817	299
320	3300025929	Ga0207664_10064267	Ga0207664_100642672	299
321	3300025929	Ga0207664_10218268	Ga0207664_102182682	299
322	3300025941	Ga0207711_10000738	Ga0207711_1000073826	299
323	3300025961	Ga0207712_10002271	Ga0207712_1000227110	299
324	3300025972	Ga0207668_10397565	Ga0207668_103975652	299
325	3300025986	Ga0207658_10000680	Ga0207658_100006807	299
326	3300026023	Ga0207677_10197270	Ga0207677_101972701	299
327	3300026023	Ga0207677_10502088	Ga0207677_105020881	299
328	3300026035	Ga0207703_10087618	Ga0207703_100876182	299
329	3300026041	Ga0207639_10021723	Ga0207639_100217234	299
330	3300026067	Ga0207678_10000033	Ga0207678_1000003341	299
331	3300026067	Ga0207678_10056196	Ga0207678_100561964	299
332	3300026088	Ga0207641_10001265	Ga0207641_1000126515	299
333	3300026095	Ga0207676_10078327	Ga0207676_100783273	299
334	3300028379	Ga0268266_10108102	Ga0268266_101081023	299
335	3300028379	Ga0268266_10125070	Ga0268266_101250703	299
336	3300028380	Ga0268265_10002308	Ga0268265_1000230811	299
337	3300028381	Ga0268264_10000503	Ga0268264_1000050357	299
338	3300028794	Ga0307515_10042606	Ga0307515_100426064	299
339	3300033179	Ga0307507_10042509	Ga0307507_100425092	299
340	3300035119	Ga0373956_0002622	Ga0373956_0002622_1731_2654	299
341	3300036712	Ga0316584_0129196	Ga0316584_0129196_835_1770	299
342	3300037853	Ga0436364_0475075	Ga0436364_0475075_55718_56617	299
343	3300044658	Ga0466972_0007899	Ga0466972_0007899_3468_4376	299
344	3300046455	Ga0495603_0054531	Ga0495603_0054531_1278_2201	299
345	3300046459	Ga0495629_0068765	Ga0495629_0068765_332_1255	299
346	3300046473	Ga0495582_0038059	Ga0495582_0038059_1201_2124	299
347	3300046475	Ga0495639_0098432	Ga0495639_0098432_260_1183	299
348	3300046531	Ga0495665_0035750	Ga0495665_0035750_207_1130	299
349	3300046690	Ga0495624_0090884	Ga0495624_0090884_645_1568	299
350	3300047315	Ga0495581_0157485	Ga0495581_0157485_93_1016	299
351	3300047673	Ga0495593_0002187	Ga0495593_0002187_68_991	299
352	3300048089	Ga0495614_0043016	Ga0495614_0043016_949_1872	299
353	3300048904	Ga0496101_0001052	Ga0496101_0001052_3646_4581	299
354	3300048905	Ga0496102_0000399	Ga0496102_0000399_45340_46275	299
355	3300048906	Ga0496103_0000861	Ga0496103_0000861_20288_21223	299
356	3300048915	Ga0496112_0011240	Ga0496112_0011240_5973_6872	299
357	3300048916	Ga0496113_0048352	Ga0496113_0048352_628_1527	299
358	3300048921	Ga0496118_0004854	Ga0496118_0004854_4449_5384	299
359	3300048922	Ga0496119_0003415	Ga0496119_0003415_13074_14009	299
360	3300048923	Ga0496120_0025799	Ga0496120_0025799_308_1243	299
361	3300048924	Ga0496121_0008039	Ga0496121_0008039_11348_12283	299
362	3300048928	Ga0496125_0135588	Ga0496125_0135588_637_1563	299
363	3300048929	Ga0496126_0060055	Ga0496126_0060055_1663_2598	299
364	3300049823	Ga0501044_0014099	Ga0501044_0014099_4845_5768	299
365	3300053080	Ga0500635_0048782	Ga0500635_0048782_301_1239	299
366	3300053085	Ga0495619_0165352	Ga0495619_0165352_28_951	299
367	3300053136	Ga0500559_0019013	Ga0500559_0019013_448_1353	299
368	iso_pu_bacteria	2751185725	2753036805	299
369	iso_pu_bacteria	2751185792	2753324676	299
370	iso_pu_bacteria	2866612099	2866612266	299
371	iso_pu_bacteria	2899370129	2899376279	299
372	iso_pu_bacteria	2919446982	2919446994	299
373	iso_pu_bacteria	2939582691	2939583614	299
374	3300005718	Ga0068866_10183431	Ga0068866_101834312	300
375	3300006186	Ga0075369_10002483	Ga0075369_100024834	300
376	3300009176	Ga0105242_10032662	Ga0105242_100326624	300
377	3300025934	Ga0207686_10078452	Ga0207686_100784522	300
378	3300026088	Ga0207641_10150602	Ga0207641_101506022	300
379	3300031901	Ga0307406_10070997	Ga0307406_100709972	300
380	3300031901	Ga0307406_10124536	Ga0307406_101245362	300
381	3300037466	Ga0395898_0043208	Ga0395898_0043208_2986_3900	300
382	3300041411	Ga0439466_0002141	Ga0439466_0002141_2449_3375	300
383	3300041413	Ga0439465_0006460	Ga0439465_0006460_1803_2729	300
384	3300042004	Ga0439445_0001364	Ga0439445_0001364_2648_3574	300
385	3300044684	Ga0466966_0143757	Ga0466966_0143757_173_1087	300
386	3300044694	Ga0466963_0252100	Ga0466963_0252100_202_1116	300
387	3300046501	Ga0495607_0014955	Ga0495607_0014955_2392_3303	300
388	3300047323	Ga0495683_0001255	Ga0495683_0001255_5978_6889	300
389	3300047472	Ga0495686_0032509	Ga0495686_0032509_1169_2128	300
390	3300048904	Ga0496101_0003555	Ga0496101_0003555_1335_2270	300
391	3300048908	Ga0496105_0042005	Ga0496105_0042005_1421_2356	300
392	3300048909	Ga0496106_0020168	Ga0496106_0020168_1116_2051	300
393	3300048918	Ga0496115_0057795	Ga0496115_0057795_1159_2094	300
394	3300050491	nmdc:mga00v17_56873_c1	nmdc:mga00v17_56873_c1_1388_2302	300
395	3300050516	nmdc:mga0sz30_25434_c1	nmdc:mga0sz30_25434_c1_921_1847	300
396	3300050516	nmdc:mga0sz30_39135_c1	nmdc:mga0sz30_39135_c1_487_1458	300
397	iso_pu_bacteria	2643221692	2644517314	300
398	3300005329	Ga0070683_100432280	Ga0070683_1004322802	301
399	3300005367	Ga0070667_100225445	Ga0070667_1002254452	301
400	3300006051	Ga0075364_10083584	Ga0075364_100835842	301
401	3300006353	Ga0075370_10099684	Ga0075370_100996842	301
402	3300025986	Ga0207658_10336222	Ga0207658_103362222	301
403	3300044694	Ga0466963_0176706	Ga0466963_0176706_165_1109	301
404	3300046531	Ga0495665_0042666	Ga0495665_0042666_551_1462	301
405	3300046615	Ga0495656_0136584	Ga0495656_0136584_124_1035	301
406	3300047315	Ga0495581_0012231	Ga0495581_0012231_3810_4721	301
407	3300048912	Ga0496109_0059283	Ga0496109_0059283_1478_2389	301
408	3300050490	nmdc:mga03n38_9350_c1	nmdc:mga03n38_9350_c1_1505_2440	301
409	3300050491	nmdc:mga00v17_32160_c1	nmdc:mga00v17_32160_c1_367_1302	301
410	3300050491	nmdc:mga00v17_57422_c1	nmdc:mga00v17_57422_c1_1084_2019	301
411	3300050496	nmdc:mga07m45_17456_c1	nmdc:mga07m45_17456_c1_1229_2164	301
412	iso_pu_bacteria	2558860112	2558910363	301
413	3300044842	Ga0466957_0042217	Ga0466957_0042217_1565_2548	302
414	iso_pu_bacteria	2842888712	2842892244	303
415	iso_pu_bacteria	2932398195	2932400059	305
416	3300005331	Ga0070670_100072505	Ga0070670_1000725053	306
417	3300005337	Ga0070682_100114359	Ga0070682_1001143592	306
418	3300005338	Ga0068868_100229031	Ga0068868_1002290312	306
419	3300005344	Ga0070661_100311803	Ga0070661_1003118031	306
420	3300005353	Ga0070669_100153024	Ga0070669_1001530243	306
421	3300005459	Ga0068867_100325029	Ga0068867_1003250291	306
422	3300005564	Ga0070664_100203262	Ga0070664_1002032622	306
423	3300005577	Ga0068857_100063822	Ga0068857_1000638224	306
424	3300005616	Ga0068852_100521597	Ga0068852_1005215972	306
425	3300009101	Ga0105247_10172792	Ga0105247_101727922	306
426	3300009551	Ga0105238_10205436	Ga0105238_102054361	306
427	3300025911	Ga0207654_10206581	Ga0207654_102065812	306
428	3300025912	Ga0207707_10502738	Ga0207707_105027381	306
429	3300025919	Ga0207657_10033309	Ga0207657_100333092	306
430	3300025921	Ga0207652_10379846	Ga0207652_103798461	306
431	3300025945	Ga0207679_10423414	Ga0207679_104234142	306
432	3300026067	Ga0207678_10217033	Ga0207678_102170333	306
433	3300026095	Ga0207676_10259369	Ga0207676_102593692	306
434	3300048904	Ga0496101_0076612	Ga0496101_0076612_73_993	306
435	3300048911	Ga0496108_0089947	Ga0496108_0089947_665_1585	306
436	3300002073	JGI24745J21846_1005464	JGI24745J21846_10054642	307
437	3300005328	Ga0070676_10146116	Ga0070676_101461162	307
438	3300005329	Ga0070683_100131080	Ga0070683_1001310803	307
439	3300005334	Ga0068869_100018890	Ga0068869_1000188904	307
440	3300005338	Ga0068868_100220550	Ga0068868_1002205502	307
441	3300005339	Ga0070660_100305608	Ga0070660_1003056082	307
442	3300005340	Ga0070689_100098088	Ga0070689_1000980882	307
443	3300005343	Ga0070687_100012990	Ga0070687_1000129902	307
444	3300005347	Ga0070668_100140839	Ga0070668_1001408393	307
445	3300005356	Ga0070674_100051270	Ga0070674_1000512703	307
446	3300005366	Ga0070659_100026431	Ga0070659_1000264313	307
447	3300005441	Ga0070700_100189349	Ga0070700_1001893492	307
448	3300005455	Ga0070663_100249099	Ga0070663_1002490992	307
449	3300005456	Ga0070678_100121891	Ga0070678_1001218911	307
450	3300005466	Ga0070685_10008844	Ga0070685_100088442	307
451	3300005544	Ga0070686_100051087	Ga0070686_1000510872	307
452	3300005548	Ga0070665_100321213	Ga0070665_1003212132	307
453	3300005564	Ga0070664_100164241	Ga0070664_1001642413	307
454	3300005578	Ga0068854_100015435	Ga0068854_1000154355	307
455	3300005616	Ga0068852_100070058	Ga0068852_1000700583	307
456	3300005719	Ga0068861_100058263	Ga0068861_1000582634	307
457	3300005843	Ga0068860_100086371	Ga0068860_1000863712	307
458	3300006844	Ga0075428_100221909	Ga0075428_1002219093	307
459	3300006844	Ga0075428_100663412	Ga0075428_1006634121	307
460	3300009094	Ga0111539_10300497	Ga0111539_103004973	307
461	3300013306	Ga0163162_10437033	Ga0163162_104370331	307
462	3300013307	Ga0157372_10189279	Ga0157372_101892792	307
463	3300013308	Ga0157375_10215000	Ga0157375_102150003	307
464	3300014326	Ga0157380_10058071	Ga0157380_100580712	307
465	3300014968	Ga0157379_10064720	Ga0157379_100647202	307
466	3300017792	Ga0163161_10155029	Ga0163161_101550292	307
467	3300025899	Ga0207642_10128858	Ga0207642_101288582	307
468	3300025907	Ga0207645_10027663	Ga0207645_100276634	307
469	3300025918	Ga0207662_10003732	Ga0207662_100037326	307
470	3300025927	Ga0207687_10051560	Ga0207687_100515601	307
471	3300025929	Ga0207664_10264034	Ga0207664_102640342	307
472	3300025932	Ga0207690_10310706	Ga0207690_103107062	307
473	3300025938	Ga0207704_10250957	Ga0207704_102509572	307
474	3300025940	Ga0207691_10103703	Ga0207691_101037033	307
475	3300025942	Ga0207689_10321100	Ga0207689_103211002	307
476	3300025972	Ga0207668_10141406	Ga0207668_101414063	307
477	3300026023	Ga0207677_10263034	Ga0207677_102630342	307
478	3300026035	Ga0207703_10178825	Ga0207703_101788252	307
479	3300026067	Ga0207678_10370509	Ga0207678_103705091	307
480	3300026075	Ga0207708_10040920	Ga0207708_100409203	307
481	3300026078	Ga0207702_10364167	Ga0207702_103641672	307
482	3300026089	Ga0207648_10117659	Ga0207648_101176592	307
483	3300026116	Ga0207674_10115800	Ga0207674_101158002	307
484	3300026118	Ga0207675_100088777	Ga0207675_1000887773	307
485	3300026121	Ga0207683_10073901	Ga0207683_100739014	307
486	3300028379	Ga0268266_10073226	Ga0268266_100732264	307
487	3300048912	Ga0496109_0187502	Ga0496109_0187502_91_1014	307
488	3300048913	Ga0496110_0213083	Ga0496110_0213083_606_1529	307
489	3300050511	nmdc:mga08y16_38030_c1	nmdc:mga08y16_38030_c1_1975_2898	307

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00535

Glycos_transf_2

Glycosyl transferase family 2

70

234

0.83 PF13641

Glyco_tranf_2_3

Glycosyltransferase like family 2

65

309

0.8 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
6p61-assembly2.cif.gz_B	structure of a glycosyltransferase from leptospira borgpetersenii serovar hardjo-bovis (strain jb197)	0.7839	6	224
6p61-assembly3.cif.gz_C	structure of a glycosyltransferase from leptospira borgpetersenii serovar hardjo-bovis (strain jb197)	0.7831	6	224
6p61-assembly2.cif.gz_B	structure of a glycosyltransferase from leptospira borgpetersenii serovar hardjo-bovis (strain jb197)	0.7802	6	224
6p61-assembly3.cif.gz_C	structure of a glycosyltransferase from leptospira borgpetersenii serovar hardjo-bovis (strain jb197)	0.7757	6	224
5fv9-assembly1.cif.gz_D	crystal structure of galnac-t2 in complex with compound 16d	0.7529	5	223

ID	Description	Score	Start	End	Superfamily
af_P9WMX3_2_220_3.90.550.10	Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A	0.9643	8	225	3.90.550.10
af_P9WMX3_2_220_3.90.550.10	Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A	0.947	8	225	3.90.550.10
af_P9WMX7_1_219_3.90.550.10	Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A	0.7995	5	225	3.90.550.10
af_P9WMY3_4_248_3.90.550.10	Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A	0.7559	9	230	3.90.550.10
af_P9WMX1_74_289_3.90.550.10	Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A	0.7553	6	223	3.90.550.10

ID	Description	Score	Start	End	GO Terms
AF-A0A7K3SW07-F1-model_v4	Glycosyltransferase	0.9595	4	144	GO:0016740
AF-A0A655DWI7-F1-model_v4	deleted	0.9571	82	300
AF-A0A838DKL6-F1-model_v4	Glycosyltransferase family 2 protein	0.9477	100	307	GO:0016740
AF-F8E3D5-F1-model_v4	Glycosyl transferase	0.9465	36	300	GO:0016740
AF-A0A838DKL6-F1-model_v4	Glycosyltransferase family 2 protein	0.9431	100	307	GO:0016740

Feature Viewer

pLDDT	pTM	Quality
90.3	0.87	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F453877

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF00535

Glycos_transf_2

Glycosyl transferase family 2

70

234

0.83

PF13641

Glyco_tranf_2_3

Glycosyltransferase like family 2

65

309

0.8

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map