F453933

General Info

Members Datasets Scaffolds Average Seq Length
490 226 980 604

Family's Representative Sequence

Representative Sequence 3300010375|Ga0105239_10180185|Ga0105239_101801851
Length 651
Sequence MCADAKPGGWVPPGFVEDVPAASDAVCDDDVFARVRIMQTARIVSWIGALALGCAGAATSAQTAPAARTYANPVDVDYRYNFEQLNEKISYRTGADPVIVRHDDAYYLFMTLADGYWRSTNLLDWSFVTPNRWPFDGMVAPAAVSDGQRLLLMRATMTPEPILVTTDPAHGQLDFLTRLTPKLPDAVPPGWDRELPAWHNGDPTPDRIAPGPWDPTLFKDDDGRWYLYWGSFERFPLYGIEVDLSHGFAYLGKPHALFTLDPKQHGWERFGRDHLEENHPSYIEGAWMTKHDGRYYLQYGAPGTEYNVYATGVYVSDSPLGPFEYAAYNPVGYKPGGFVEGAGHGNTFQDKFGNWWNTGSPWIGNNWPFERRIGLWPAAFAMDGQMRVDTRFGDFPHYMPEEKVADPDALFTGWMLLSYRKQATASSTLQNFSADNVSDENPRTFWVAAKNAAGQTLTLDLDAPKTLRAVQVNFADYESQRYGDAPDVYTEFKLEFSLDGKKWSPLAQTEPPRRDRPNAYFQLPAPVRARYVRYVHGHVGAAHLAISDLRVFGDAGGEAPAAPTRVKAQRLDPRALRVSWQPVRGAVGYNVRWGVQPDRLNLCYQVFADRGTTLDLRALNAGVAYDAAVEAFNENGVSKLSEVVHVPDKLH

Samples

Sample ID Description Type Environment
1 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
6 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
7 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
8 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
11 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
12 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
13 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
14 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
17 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
68 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
71 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
72 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
73 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
74 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
75 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300015684 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 Metagenome Unclassified
84 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
85 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
86 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
87 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
88 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
89 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
90 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
91 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
93 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
94 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
95 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
147 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
148 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
149 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
150 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
151 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
152 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
153 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
154 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
155 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
156 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
157 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
158 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
159 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
160 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
161 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
162 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
163 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
164 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
165 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
166 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
167 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
168 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
169 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
170 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
171 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
172 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
173 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
174 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
175 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
176 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
177 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
178 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
179 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
180 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
181 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
182 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
183 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
184 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
185 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
186 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
187 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
188 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
189 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
190 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
191 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
192 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
193 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
194 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
195 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
196 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
197 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
198 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
199 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
200 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
201 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
202 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
203 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
204 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
205 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
207 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
208 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
209 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
210 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
211 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
212 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
213 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
214 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
215 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
216 2643221579 Pseudoxanthomonas sp. Root630 Isolate Unclassified
217 2643221622 Sphingomonas sp. Root241 Isolate Unclassified
218 2830075706 Sphingomonas jinjuensis DSM 21457 Isolate Rhizosphere
219 2896429255 Sphingomonas rhizophila KACC 19189 Isolate Rhizosphere
220 2928027323 Sphingomonas sp. 1185 Isolate Unclassified
221 2984555340 Sphingomonas sp. SORGH_AS789 Isolate Aerial Root
222 2984564862 Sphingomonas sp. SORGH_AS870 Isolate Aerial Root
223 2990265787 Sphingomonas sp. SORGH_AS802 Isolate Aerial Root
224 2993356040 Sphingomonas sp. SORGH_AS742 Isolate Aerial Root
225 2993693658 Sphingomonas sp. SORGH_AS438 Isolate Aerial Root
226 8002869464 Pseudoxanthomonas helianthi 110414 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.76
Metatranscriptomes 0
Isolates 2.24

Biome Distribution

Category Percentage (%)
Aerial Root 1.02
Bulb 0
Endosphere 7.14
Nodule 0
Rhizoplane 2.24
Rhizosphere 86.94
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105239_10180185 3300010375 Bacteria 2364
2 JGI24740J21852_10003447 3300001979 Bacteria 6950
3 JGI24740J21852_10003981 3300001979 Bacteria 6412
4 JGI24739J22299_10020872 3300001989 Bacteria 2337
5 JGI24737J22298_10000083 3300001990 Bacteria 27631
6 JGI24737J22298_10000973 3300001990 Bacteria 10166
7 JGI24737J22298_10002423 3300001990 Bacteria 6648
8 JGI24738J21930_10001027 3300002075 Bacteria 7959
9 JGI25150J39212_1000341 3300002774 Bacteria 23001
10 JGI25151J46595_10015017 3300003187 Bacteria 3434
11 JGI25153J46596_10000108 3300003215 Bacteria 94715
12 rootL2_10080482 3300003322 Bacteria 7861
13 Ga0055536_1001929 3300003781 Bacteria 11997
14 Ga0055530_10000074 3300003791 Bacteria 85116
15 Ga0055530_10008168 3300003791 Bacteria 4242
16 Ga0055540_1002019 3300003792 Bacteria 11292
17 Ga0055531_10000253 3300003794 Bacteria 57396
18 Ga0065165_1004225 3300005262 Bacteria 9136
19 Ga0070658_10007767 3300005327 Bacteria 8644
20 Ga0070658_10056325 3300005327 Bacteria 3194
21 Ga0070658_10095313 3300005327 Bacteria 2456
22 Ga0070676_10046362 3300005328 Bacteria 2535
23 Ga0070690_100000372 3300005330 Bacteria 22887
24 Ga0070670_100009770 3300005331 Bacteria 8193
25 Ga0070670_100014726 3300005331 Bacteria 6716
26 Ga0070670_100027978 3300005331 Bacteria 4851
27 Ga0070677_10002874 3300005333 Bacteria 5531
28 Ga0070677_10005290 3300005333 Bacteria 4248
29 Ga0068869_100000138 3300005334 Bacteria 35512
30 Ga0070666_10001322 3300005335 Bacteria 15028
31 Ga0070666_10001551 3300005335 Bacteria 13948
32 Ga0070666_10002244 3300005335 Bacteria 11680
33 Ga0068868_100000103 3300005338 Bacteria 52264
34 Ga0068868_100002446 3300005338 Bacteria 12879
35 Ga0068868_100006105 3300005338 Bacteria 8511
36 Ga0070660_100000716 3300005339 Bacteria 21968
37 Ga0070661_100013420 3300005344 Bacteria 5750
38 Ga0070692_10003378 3300005345 Bacteria 6464
39 Ga0070668_100003039 3300005347 Bacteria 12415
40 Ga0070669_100001573 3300005353 Bacteria 16548
41 Ga0070669_100066373 3300005353 Bacteria 2659
42 Ga0070675_100029777 3300005354 Bacteria 4405
43 Ga0070675_100032553 3300005354 Bacteria 4220
44 Ga0070675_100033981 3300005354 Bacteria 4136
45 Ga0070671_100000133 3300005355 Bacteria 47555
46 Ga0070671_100006840 3300005355 Bacteria 9128
47 Ga0070671_100006845 3300005355 Bacteria 9122
48 Ga0070674_100007575 3300005356 Bacteria 6410
49 Ga0070673_100000336 3300005364 Bacteria 24639
50 Ga0070673_100006690 3300005364 Bacteria 7513
51 Ga0070673_100011495 3300005364 Bacteria 6043
52 Ga0070673_100013139 3300005364 Bacteria 5716
53 Ga0070673_100050650 3300005364 Bacteria 3248
54 Ga0070659_100000817 3300005366 Bacteria 22741
55 Ga0070659_100001395 3300005366 Bacteria 17434
56 Ga0070659_100002850 3300005366 Bacteria 12308
57 Ga0070659_100016088 3300005366 Bacteria 5612
58 Ga0070659_100018443 3300005366 Bacteria 5267
59 Ga0070659_100023508 3300005366 Bacteria 4717
60 Ga0070667_100002716 3300005367 Bacteria 15316
61 Ga0070667_100005718 3300005367 Bacteria 10387
62 Ga0070667_100012108 3300005367 Bacteria 7140
63 Ga0070667_100023262 3300005367 Bacteria 5140
64 Ga0070667_100031646 3300005367 Bacteria 4410
65 Ga0070714_100013317 3300005435 Bacteria 6589
66 Ga0070714_100081236 3300005435 Bacteria 2821
67 Ga0070700_100008160 3300005441 Bacteria 5697
68 Ga0070663_100003732 3300005455 Bacteria 8832
69 Ga0070663_100006966 3300005455 Bacteria 6844
70 Ga0070663_100012048 3300005455 Bacteria 5455
71 Ga0070663_100019224 3300005455 Bacteria 4497
72 Ga0070678_100002264 3300005456 Bacteria 10481
73 Ga0070678_100004532 3300005456 Bacteria 7888
74 Ga0070678_100007584 3300005456 Bacteria 6445
75 Ga0070678_100033690 3300005456 Bacteria 3560
76 Ga0070662_100000140 3300005457 Bacteria 40842
77 Ga0070662_100005556 3300005457 Bacteria 8058
78 Ga0070662_100016108 3300005457 Bacteria 5014
79 Ga0070662_100032714 3300005457 Bacteria 3656
80 Ga0068867_100000319 3300005459 Bacteria 31796
81 Ga0068867_100010238 3300005459 Bacteria 6615
82 Ga0068867_100017139 3300005459 Bacteria 5146
83 Ga0070685_10007070 3300005466 Bacteria 5731
84 Ga0070684_100076880 3300005535 Bacteria 2947
85 Ga0068853_100000360 3300005539 Bacteria 31342
86 Ga0068853_100071057 3300005539 Bacteria 3030
87 Ga0068853_100072503 3300005539 Bacteria 3001
88 Ga0070672_100000388 3300005543 Bacteria 25468
89 Ga0070672_100000508 3300005543 Bacteria 22754
90 Ga0070672_100004137 3300005543 Bacteria 9470
91 Ga0070686_100011597 3300005544 Bacteria 5003
92 Ga0070686_100058978 3300005544 Bacteria 2471
93 Ga0070665_100001570 3300005548 Bacteria 26346
94 Ga0070665_100007276 3300005548 Bacteria 11250
95 Ga0070665_100026046 3300005548 Bacteria 5890
96 Ga0068855_100000640 3300005563 Bacteria 42846
97 Ga0068855_100103386 3300005563 Bacteria 3277
98 Ga0070664_100091827 3300005564 Bacteria 2628
99 Ga0068857_100003472 3300005577 Bacteria 13163
100 Ga0068857_100012406 3300005577 Bacteria 7419
101 Ga0068857_100020716 3300005577 Bacteria 5786
102 Ga0068854_100000197 3300005578 Bacteria 40599
103 Ga0068854_100000554 3300005578 Bacteria 22552
104 Ga0068852_100000673 3300005616 Bacteria 22422
105 Ga0068852_100004368 3300005616 Bacteria 9987
106 Ga0068852_100010460 3300005616 Bacteria 6937
107 Ga0068859_100007797 3300005617 Bacteria 10866
108 Ga0068859_100008891 3300005617 Bacteria 10139
109 Ga0068859_100021403 3300005617 Bacteria 6489
110 Ga0068859_100028369 3300005617 Bacteria 5611
111 Ga0068864_100000787 3300005618 Bacteria 26629
112 Ga0068864_100024621 3300005618 Bacteria 5064
113 Ga0068851_10004880 3300005834 Bacteria 6073
114 Ga0068870_10001438 3300005840 Bacteria 9630
115 Ga0068863_100004250 3300005841 Bacteria 14143
116 Ga0068863_100005421 3300005841 Bacteria 12567
117 Ga0068863_100030647 3300005841 Bacteria 5135
118 Ga0068863_100059669 3300005841 Bacteria 3609
119 Ga0068858_100013619 3300005842 Bacteria 7675
120 Ga0068858_100016883 3300005842 Bacteria 6853
121 Ga0068858_100027749 3300005842 Bacteria 5260
122 Ga0068860_100002940 3300005843 Bacteria 17612
123 Ga0068860_100007433 3300005843 Bacteria 10956
124 Ga0068860_100020269 3300005843 Bacteria 6441
125 Ga0068862_100001236 3300005844 Bacteria 24103
126 Ga0097621_100001066 3300006237 Bacteria 19201
127 Ga0068871_100013369 3300006358 Bacteria 6090
128 Ga0068871_100062010 3300006358 Bacteria 3055
129 Ga0075433_10005698 3300006852 Bacteria 9796
130 Ga0068865_100006603 3300006881 Bacteria 7095
131 Ga0068865_100009419 3300006881 Bacteria 6056
132 Ga0097620_100007797 3300006931 Bacteria 10866
133 Ga0097620_100008891 3300006931 Bacteria 10139
134 Ga0097620_100021403 3300006931 Bacteria 6489
135 Ga0097620_100028369 3300006931 Bacteria 5611
136 Ga0105240_10000906 3300009093 Bacteria 52979
137 Ga0105240_10027081 3300009093 Bacteria 7512
138 Ga0105240_10249644 3300009093 Bacteria 2053
139 Ga0105245_10000407 3300009098 Bacteria 39932
140 Ga0105245_10006189 3300009098 Bacteria 10534
141 Ga0105245_10043071 3300009098 Bacteria 4027
142 Ga0105248_10002536 3300009177 Bacteria 20335
143 Ga0105248_10007242 3300009177 Bacteria 12169
144 Ga0105248_10041825 3300009177 Bacteria 5139
145 Ga0105248_10099140 3300009177 Bacteria 3283
146 Ga0105248_10146645 3300009177 Bacteria 2663
147 Ga0105237_10009430 3300009545 Bacteria 10456
148 Ga0105238_10033126 3300009551 Bacteria 5258
149 Ga0105249_10059201 3300009553 Bacteria 3513
150 Ga0105028_101026 3300009993 Bacteria 2950
151 Ga0105239_10014625 3300010375 Bacteria 8705
152 Ga0105246_10008856 3300011119 Bacteria 6193
153 Ga0157373_10004157 3300013100 Bacteria 10916
154 Ga0157371_10001390 3300013102 Bacteria 25250
155 Ga0157371_10013291 3300013102 Bacteria 6260
156 Ga0157371_10018111 3300013102 Bacteria 5214
157 Ga0157370_10045194 3300013104 Bacteria 4227
158 Ga0157369_10009651 3300013105 Bacteria 11038
159 Ga0157369_10029230 3300013105 Bacteria 6092
160 Ga0157374_10014845 3300013296 Bacteria 6824
161 Ga0157374_10034435 3300013296 Bacteria 4626
162 Ga0157374_10045883 3300013296 Bacteria 4045
163 Ga0157378_10002885 3300013297 Bacteria 15303
164 Ga0163162_10000028 3300013306 Bacteria 175501
165 Ga0163162_10010671 3300013306 Bacteria 8933
166 Ga0163162_10026950 3300013306 Bacteria 5683
167 Ga0163162_10027173 3300013306 Bacteria 5658
168 Ga0163162_10083886 3300013306 Bacteria 3261
169 Ga0157372_10029161 3300013307 Bacteria 6023
170 Ga0157372_10068316 3300013307 Bacteria 3995
171 Ga0157375_10123727 3300013308 Bacteria 2699
172 Ga0163163_10028183 3300014325 Bacteria 5389
173 Ga0163163_10132193 3300014325 Bacteria 2536
174 Ga0157379_10015040 3300014968 Bacteria 6787
175 Ga0157379_10061076 3300014968 Bacteria 3370
176 Ga0183365_10003 3300015684 Bacteria 414944
177 Ga0183363_1006 3300015690 Bacteria 400466
178 Ga0163161_10042705 3300017792 Bacteria 3262
179 Ga0213875_10006046 3300021388 Bacteria 6410
180 Ga0207425_1000098 3300025245 Bacteria 83892
181 Ga0209233_1002221 3300025261 Bacteria 7280
182 Ga0209565_1000214 3300025263 Bacteria 66404
183 Ga0209673_1005929 3300025273 Bacteria 6031
184 Ga0209676_1000052 3300025292 Bacteria 371539
185 Ga0209676_1002804 3300025292 Bacteria 11537
186 Ga0209676_1004273 3300025292 Bacteria 8053
187 Ga0209025_1000413 3300025294 Bacteria 85984
188 Ga0209564_1000887 3300025295 Bacteria 39501
189 Ga0209564_1008362 3300025295 Bacteria 5117
190 Ga0209758_1000019 3300025297 Bacteria 743682
191 Ga0209758_1032406 3300025297 Bacteria 2122
192 Ga0209050_1000005 3300025298 Bacteria 1557793
193 Ga0209050_1000039 3300025298 Bacteria 410069
194 Ga0209050_1005026 3300025298 Bacteria 8583
195 Ga0209050_1011314 3300025298 Bacteria 4251
196 Ga0209051_1000739 3300025303 Bacteria 35266
197 Ga0209257_1000051 3300025304 Bacteria 434166
198 Ga0209257_1001016 3300025304 Bacteria 37745
199 Ga0209257_1001081 3300025304 Bacteria 35775
200 Ga0207697_10000221 3300025315 Bacteria 30788
201 Ga0207656_10001724 3300025321 Bacteria 7270
202 Ga0207656_10002175 3300025321 Bacteria 6555
203 Ga0207682_10000432 3300025893 Bacteria 19371
204 Ga0207682_10005440 3300025893 Bacteria 5182
205 Ga0207688_10002840 3300025901 Bacteria 9411
206 Ga0207680_10004188 3300025903 Bacteria 6825
207 Ga0207680_10006011 3300025903 Bacteria 5839
208 Ga0207680_10006324 3300025903 Bacteria 5718
209 Ga0207647_10000024 3300025904 Bacteria 115153
210 Ga0207647_10000679 3300025904 Bacteria 26722
211 Ga0207647_10002216 3300025904 Bacteria 14813
212 Ga0207645_10005288 3300025907 Bacteria 9398
213 Ga0207705_10014671 3300025909 Bacteria 5637
214 Ga0207705_10064920 3300025909 Bacteria 2638
215 Ga0207654_10058396 3300025911 Bacteria 2246
216 Ga0207695_10000040 3300025913 Bacteria 452787
217 Ga0207695_10016274 3300025913 Bacteria 8712
218 Ga0207695_10022021 3300025913 Bacteria 7252
219 Ga0207671_10009442 3300025914 Bacteria 8155
220 Ga0207671_10020377 3300025914 Bacteria 5047
221 Ga0207657_10002144 3300025919 Bacteria 21379
222 Ga0207657_10003427 3300025919 Bacteria 16932
223 Ga0207657_10005216 3300025919 Bacteria 13609
224 Ga0207657_10009627 3300025919 Bacteria 9695
225 Ga0207657_10016365 3300025919 Bacteria 7154
226 Ga0207649_10020855 3300025920 Bacteria 3763
227 Ga0207652_10061352 3300025921 Bacteria 3246
228 Ga0207681_10002062 3300025923 Bacteria 12886
229 Ga0207681_10010847 3300025923 Bacteria 5598
230 Ga0207681_10021582 3300025923 Bacteria 4096
231 Ga0207694_10001319 3300025924 Bacteria 21340
232 Ga0207694_10002489 3300025924 Bacteria 14990
233 Ga0207694_10010865 3300025924 Bacteria 6874
234 Ga0207650_10003597 3300025925 Bacteria 10636
235 Ga0207650_10009053 3300025925 Bacteria 6805
236 Ga0207650_10031621 3300025925 Bacteria 3823
237 Ga0207650_10038228 3300025925 Bacteria 3503
238 Ga0207659_10021109 3300025926 Bacteria 4316
239 Ga0207659_10065071 3300025926 Bacteria 2641
240 Ga0207687_10006558 3300025927 Bacteria 7681
241 Ga0207664_10012343 3300025929 Bacteria 6104
242 Ga0207664_10062164 3300025929 Bacteria 2981
243 Ga0207644_10000256 3300025931 Bacteria 35858
244 Ga0207644_10000612 3300025931 Bacteria 22729
245 Ga0207644_10002528 3300025931 Bacteria 11763
246 Ga0207690_10001622 3300025932 Bacteria 13977
247 Ga0207690_10002638 3300025932 Bacteria 10798
248 Ga0207690_10007713 3300025932 Bacteria 6388
249 Ga0207690_10014923 3300025932 Bacteria 4703
250 Ga0207706_10000346 3300025933 Bacteria 50165
251 Ga0207706_10002508 3300025933 Bacteria 17894
252 Ga0207706_10004341 3300025933 Bacteria 13312
253 Ga0207706_10006925 3300025933 Bacteria 10484
254 Ga0207706_10008611 3300025933 Bacteria 9401
255 Ga0207706_10043090 3300025933 Bacteria 4000
256 Ga0207706_10074519 3300025933 Bacteria 2985
257 Ga0207706_10079579 3300025933 Bacteria 2882
258 Ga0207706_10107611 3300025933 Bacteria 2453
259 Ga0207704_10012560 3300025938 Bacteria 4207
260 Ga0207704_10040263 3300025938 Bacteria 2729
261 Ga0207691_10000592 3300025940 Bacteria 36163
262 Ga0207691_10007872 3300025940 Bacteria 10265
263 Ga0207691_10010277 3300025940 Bacteria 8977
264 Ga0207691_10015900 3300025940 Bacteria 7148
265 Ga0207691_10057649 3300025940 Bacteria 3534
266 Ga0207691_10066442 3300025940 Bacteria 3262
267 Ga0207711_10001385 3300025941 Bacteria 22824
268 Ga0207711_10002016 3300025941 Bacteria 18373
269 Ga0207711_10006833 3300025941 Bacteria 9590
270 Ga0207689_10000033 3300025942 Bacteria 95815
271 Ga0207679_10005553 3300025945 Bacteria 7902
272 Ga0207667_10005076 3300025949 Bacteria 16084
273 Ga0207667_10005349 3300025949 Bacteria 15646
274 Ga0207651_10000139 3300025960 Bacteria 31720
275 Ga0207651_10006461 3300025960 Bacteria 6139
276 Ga0207651_10014755 3300025960 Bacteria 4521
277 Ga0207712_10001041 3300025961 Bacteria 19563
278 Ga0207712_10039339 3300025961 Bacteria 3240
279 Ga0207668_10000150 3300025972 Bacteria 48022
280 Ga0207640_10001090 3300025981 Bacteria 15014
281 Ga0207640_10003205 3300025981 Bacteria 8813
282 Ga0207658_10005003 3300025986 Bacteria 9132
283 Ga0207658_10009569 3300025986 Bacteria 6577
284 Ga0207658_10010086 3300025986 Bacteria 6416
285 Ga0207658_10011118 3300025986 Bacteria 6130
286 Ga0207658_10020827 3300025986 Bacteria 4543
287 Ga0207677_10002457 3300026023 Bacteria 9741
288 Ga0207677_10005504 3300026023 Bacteria 6879
289 Ga0207677_10005908 3300026023 Bacteria 6662
290 Ga0207677_10007047 3300026023 Bacteria 6185
291 Ga0207703_10000472 3300026035 Bacteria 42034
292 Ga0207703_10004952 3300026035 Bacteria 10812
293 Ga0207703_10008173 3300026035 Bacteria 8267
294 Ga0207639_10000116 3300026041 Bacteria 61688
295 Ga0207639_10029492 3300026041 Bacteria 4017
296 Ga0207639_10066387 3300026041 Bacteria 2804
297 Ga0207678_10000357 3300026067 Bacteria 41546
298 Ga0207678_10005235 3300026067 Bacteria 11617
299 Ga0207678_10005905 3300026067 Bacteria 10906
300 Ga0207678_10033423 3300026067 Bacteria 4481
301 Ga0207641_10004168 3300026088 Bacteria 12598
302 Ga0207641_10024248 3300026088 Bacteria 5001
303 Ga0207648_10000554 3300026089 Bacteria 41815
304 Ga0207648_10001898 3300026089 Bacteria 22839
305 Ga0207648_10004044 3300026089 Bacteria 15225
306 Ga0207648_10012040 3300026089 Bacteria 8114
307 Ga0207648_10023172 3300026089 Bacteria 5569
308 Ga0207676_10000439 3300026095 Bacteria 35156
309 Ga0207676_10001863 3300026095 Bacteria 15429
310 Ga0207674_10000104 3300026116 Bacteria 96273
311 Ga0207674_10006838 3300026116 Bacteria 13376
312 Ga0207674_10034394 3300026116 Bacteria 5298
313 Ga0207674_10036502 3300026116 Bacteria 5118
314 Ga0207675_100047415 3300026118 Bacteria 4011
315 Ga0207683_10003703 3300026121 Bacteria 13269
316 Ga0207683_10005306 3300026121 Bacteria 11052
317 Ga0207683_10005874 3300026121 Bacteria 10527
318 Ga0207683_10084000 3300026121 Bacteria 2830
319 Ga0207698_10000908 3300026142 Bacteria 17209
320 Ga0207698_10006257 3300026142 Bacteria 7407
321 Ga0207698_10012811 3300026142 Bacteria 5507
322 Ga0207698_10084143 3300026142 Bacteria 2578
323 Ga0268266_10000008 3300028379 Bacteria 1161875
324 Ga0268266_10002617 3300028379 Bacteria 19055
325 Ga0268266_10006044 3300028379 Bacteria 11158
326 Ga0268266_10011239 3300028379 Bacteria 7791
327 Ga0268265_10001717 3300028380 Bacteria 17736
328 Ga0268265_10001931 3300028380 Bacteria 16450
329 Ga0268265_10008167 3300028380 Bacteria 7070
330 Ga0268264_10001663 3300028381 Bacteria 20498
331 Ga0268264_10020009 3300028381 Bacteria 5468
332 Ga0307513_10009145 3300031456 Bacteria 12551
333 Ga0307513_10078401 3300031456 Bacteria 3417
334 Ga0307509_10010714 3300031507 Bacteria 11187
335 Ga0307408_100030105 3300031548 Bacteria 3767
336 Ga0307408_100071366 3300031548 Bacteria 2567
337 Ga0307405_10010976 3300031731 Bacteria 4722
338 Ga0307413_10001063 3300031824 Bacteria 9988
339 Ga0307413_10001820 3300031824 Bacteria 8377
340 Ga0307413_10002980 3300031824 Bacteria 7013
341 Ga0307413_10004513 3300031824 Bacteria 6069
342 Ga0307410_10000301 3300031852 Bacteria 19232
343 Ga0307410_10011895 3300031852 Bacteria 5002
344 Ga0307410_10054053 3300031852 Bacteria 2720
345 Ga0307406_10015103 3300031901 Bacteria 4461
346 Ga0307407_10001009 3300031903 Bacteria 9677
347 Ga0307407_10018510 3300031903 Bacteria 3524
348 Ga0307409_100001143 3300031995 Bacteria 12618
349 Ga0307409_100020360 3300031995 Bacteria 4518
350 Ga0307409_100056368 3300031995 Bacteria 3039
351 Ga0307414_10010376 3300032004 Bacteria 5401
352 Ga0307414_10023921 3300032004 Bacteria 3884
353 Ga0307414_10048393 3300032004 Bacteria 2932
354 Ga0307411_10001187 3300032005 Bacteria 10293
355 Ga0307411_10010937 3300032005 Bacteria 4867
356 Ga0307411_10015144 3300032005 Bacteria 4320
357 Ga0307411_10018508 3300032005 Bacteria 3998
358 Ga0307411_10033505 3300032005 Bacteria 3186
359 Ga0307411_10065542 3300032005 Bacteria 2436
360 Ga0307411_10079262 3300032005 Bacteria 2254
361 Ga0307415_100000452 3300032126 Bacteria 17624
362 Ga0307415_100111182 3300032126 Bacteria 2033
363 Ga0395899_0017627 3300037312 Bacteria 5438
364 Ga0395899_0027161 3300037312 Bacteria 4317
365 Ga0395899_0035283 3300037312 Bacteria 3754
366 Ga0395899_0038016 3300037312 Bacteria 3607
367 Ga0395899_0049653 3300037312 Bacteria 3118
368 Ga0395899_0059298 3300037312 Bacteria 2821
369 Ga0395900_0012282 3300037418 Bacteria 8758
370 Ga0395900_0018035 3300037418 Bacteria 7206
371 Ga0395900_0030696 3300037418 Bacteria 5519
372 Ga0395900_0038763 3300037418 Bacteria 4912
373 Ga0395900_0039605 3300037418 Bacteria 4855
374 Ga0395900_0048587 3300037418 Bacteria 4371
375 Ga0395900_0069699 3300037418 Bacteria 3614
376 Ga0395898_0002665 3300037466 Bacteria 20700
377 Ga0395898_0022272 3300037466 Bacteria 6418
378 Ga0395905_0001093 3300037471 Bacteria 34106
379 Ga0395905_0005271 3300037471 Bacteria 13220
380 Ga0395905_0014032 3300037471 Bacteria 7660
381 Ga0395905_0017553 3300037471 Bacteria 6793
382 Ga0395905_0018553 3300037471 Bacteria 6602
383 Ga0395905_0018844 3300037471 Bacteria 6546
384 Ga0395905_0024038 3300037471 Bacteria 5751
385 Ga0395905_0025511 3300037471 Bacteria 5574
386 Ga0395905_0031892 3300037471 Bacteria 4957
387 Ga0395905_0032336 3300037471 Bacteria 4921
388 Ga0395905_0037161 3300037471 Bacteria 4573
389 Ga0395905_0061134 3300037471 Bacteria 3523
390 Ga0395905_0073075 3300037471 Bacteria 3214
391 Ga0395905_0107848 3300037471 Bacteria 2614
392 Ga0395905_0123896 3300037471 Bacteria 2430
393 Ga0395905_0153034 3300037471 Bacteria 2169
394 Ga0436364_0828660 3300037853 Bacteria 6879
395 Ga0395901_0000329 3300038443 Bacteria 58460
396 Ga0395901_0009570 3300038443 Bacteria 9832
397 Ga0395901_0009677 3300038443 Bacteria 9775
398 Ga0395901_0015349 3300038443 Bacteria 7795
399 Ga0395901_0015868 3300038443 Bacteria 7676
400 Ga0395901_0017881 3300038443 Bacteria 7236
401 Ga0395901_0053138 3300038443 Bacteria 4210
402 Ga0395901_0054359 3300038443 Bacteria 4161
403 Ga0395901_0090085 3300038443 Bacteria 3210
404 Ga0395901_0090914 3300038443 Bacteria 3195
405 Ga0395901_0149507 3300038443 Bacteria 2454
406 Ga0436365_0391692 3300039437 Bacteria 35650
407 Ga0439461_0000241 3300041410 Bacteria 7748
408 Ga0439465_0000096 3300041413 Bacteria 19874
409 Ga0439465_0000236 3300041413 Bacteria 15097
410 Ga0439431_0000402 3300041997 Bacteria 9145
411 Ga0439445_0000007 3300042004 Bacteria 26076
412 Ga0439445_0000022 3300042004 Bacteria 20558
413 Ga0439445_0000567 3300042004 Bacteria 7566
414 Ga0439432_000158 3300042006 Bacteria 23212
415 Ga0439449_0000167 3300042007 Bacteria 22545
416 Ga0439449_0001147 3300042007 Bacteria 10391
417 Ga0439449_0010833 3300042007 Bacteria 3441
418 Ga0439449_0020208 3300042007 Bacteria 2495
419 Ga0439462_0000307 3300042015 Bacteria 9114
420 Ga0439446_0019332 3300042156 Bacteria 1914
421 Ga0439434_0000724 3300042435 Bacteria 9435
422 Ga0439464_0000431 3300042439 Bacteria 8263
423 Ga0466969_0000552 3300044656 Bacteria 20563
424 Ga0466972_0021044 3300044658 Bacteria 3256
425 Ga0466966_0000577 3300044684 Bacteria 23336
426 Ga0466966_0043086 3300044684 Bacteria 2894
427 Ga0466966_0052802 3300044684 Bacteria 2580
428 Ga0466961_0000938 3300044693 Bacteria 18062
429 Ga0466961_0023705 3300044693 Bacteria 3949
430 Ga0466961_0029172 3300044693 Bacteria 3547
431 Ga0466963_0021581 3300044694 Bacteria 4065
432 Ga0466971_0000322 3300044719 Bacteria 18467
433 Ga0466971_0008098 3300044719 Bacteria 4583
434 Ga0466970_0002098 3300044765 Bacteria 9625
435 Ga0466970_0013470 3300044765 Bacteria 4192
436 Ga0466970_0018032 3300044765 Bacteria 3653
437 Ga0466970_0064382 3300044765 Bacteria 1966
438 Ga0466957_0000540 3300044842 Bacteria 19108
439 Ga0466959_0000477 3300045049 Bacteria 23340
440 Ga0466959_0010807 3300045049 Bacteria 6543
441 Ga0466958_0002844 3300045836 Bacteria 8812
442 Ga0466958_0006275 3300045836 Bacteria 6458
443 Ga0466967_0003754 3300045976 Bacteria 10015
444 Ga0466967_0013733 3300045976 Bacteria 6274
445 Ga0495590_0009337 3300046457 Bacteria 3720
446 Ga0495663_0006154 3300046525 Bacteria 3317
447 Ga0495598_0004419 3300046537 Bacteria 3043
448 Ga0495621_0000300 3300046539 Bacteria 11927
449 Ga0495625_0000107 3300046660 Bacteria 125777
450 Ga0495625_0020602 3300046660 Bacteria 5088
451 Ga0495670_0000005 3300046691 Bacteria 289725
452 Ga0495670_0031044 3300046691 Bacteria 2654
453 Ga0495649_0015113 3300046694 Bacteria 4399
454 Ga0495681_0012685 3300047470 Bacteria 4938
455 Ga0496100_0006447 3300048903 Bacteria 6398
456 Ga0496101_0001002 3300048904 Bacteria 16720
457 Ga0496102_0160467 3300048905 Bacteria 2115
458 Ga0496103_0044188 3300048906 Bacteria 2745
459 Ga0496107_0002671 3300048910 Bacteria 11678
460 Ga0496110_0000637 3300048913 Bacteria 24040
461 Ga0496111_0000353 3300048914 Bacteria 22730
462 Ga0496112_0001482 3300048915 Bacteria 18050
463 Ga0496112_0050297 3300048915 Bacteria 4087
464 Ga0496113_0000931 3300048916 Bacteria 15525
465 Ga0496115_0000218 3300048918 Bacteria 52824
466 Ga0496126_0022565 3300048929 Bacteria 6121
467 Ga0501034_0000568 3300049571 Bacteria 58539
468 Ga0501073_0000369 3300049589 Bacteria 30331
469 Ga0501225_0003565 3300049705 Bacteria 4696
470 Ga0501079_0016692 3300049741 Bacteria 5607
471 nmdc:mga03683_22224_c1 3300050489 Bacteria 2457
472 nmdc:mga0a205_7043_c1 3300050515 Bacteria 10158
473 Ga0500635_0014756 3300053080 Bacteria 2295
474 Ga0500562_009978 3300053108 Bacteria 2403
475 Ga0500608_000083 3300053122 Bacteria 39042
476 Ga0500658_0000640 3300053134 Bacteria 14541
477 Ga0500658_0015358 3300053134 Bacteria 2842
478 Ga0466962_0000291 3300061719 Bacteria 21315
479 Ga0466962_0047789 3300061719 Bacteria 2045
480 2643907030 2643221579 Bacteria 4443405
481 2644128453 2643221622 Bacteria 4212502
482 2830077180 2830075706 Bacteria 3855215
483 2896431503 2896429255 Bacteria 2557483
484 2928030552 2928027323 Bacteria 4382488
485 2984557120 2984555340 Bacteria 4247089
486 2984568513 2984564862 Bacteria 4339992
487 2990266648 2990265787 Bacteria 3943888
488 2993359564 2993356040 Bacteria 4247105
489 2993695551 2993693658 Bacteria 4040749
490 8002870264 8002869464 Bacteria 3588529
491 Ga0105239_10180185
492 JGI24740J21852_10003447
493 JGI24740J21852_10003981
494 JGI24739J22299_10020872
495 JGI24737J22298_10000083
496 JGI24737J22298_10000973
497 JGI24737J22298_10002423
498 JGI24738J21930_10001027
499 JGI25150J39212_1000341
500 JGI25151J46595_10015017
501 JGI25153J46596_10000108
502 rootL2_10080482
503 Ga0055536_1001929
504 Ga0055530_10000074
505 Ga0055530_10008168
506 Ga0055540_1002019
507 Ga0055531_10000253
508 Ga0065165_1004225
509 Ga0070658_10007767
510 Ga0070658_10056325
511 Ga0070658_10095313
512 Ga0070676_10046362
513 Ga0070690_100000372
514 Ga0070670_100009770
515 Ga0070670_100014726
516 Ga0070670_100027978
517 Ga0070677_10002874
518 Ga0070677_10005290
519 Ga0068869_100000138
520 Ga0070666_10001322
521 Ga0070666_10001551
522 Ga0070666_10002244
523 Ga0068868_100000103
524 Ga0068868_100002446
525 Ga0068868_100006105
526 Ga0070660_100000716
527 Ga0070661_100013420
528 Ga0070692_10003378
529 Ga0070668_100003039
530 Ga0070669_100001573
531 Ga0070669_100066373
532 Ga0070675_100029777
533 Ga0070675_100032553
534 Ga0070675_100033981
535 Ga0070671_100000133
536 Ga0070671_100006840
537 Ga0070671_100006845
538 Ga0070674_100007575
539 Ga0070673_100000336
540 Ga0070673_100006690
541 Ga0070673_100011495
542 Ga0070673_100013139
543 Ga0070673_100050650
544 Ga0070659_100000817
545 Ga0070659_100001395
546 Ga0070659_100002850
547 Ga0070659_100016088
548 Ga0070659_100018443
549 Ga0070659_100023508
550 Ga0070667_100002716
551 Ga0070667_100005718
552 Ga0070667_100012108
553 Ga0070667_100023262
554 Ga0070667_100031646
555 Ga0070714_100013317
556 Ga0070714_100081236
557 Ga0070700_100008160
558 Ga0070663_100003732
559 Ga0070663_100006966
560 Ga0070663_100012048
561 Ga0070663_100019224
562 Ga0070678_100002264
563 Ga0070678_100004532
564 Ga0070678_100007584
565 Ga0070678_100033690
566 Ga0070662_100000140
567 Ga0070662_100005556
568 Ga0070662_100016108
569 Ga0070662_100032714
570 Ga0068867_100000319
571 Ga0068867_100010238
572 Ga0068867_100017139
573 Ga0070685_10007070
574 Ga0070684_100076880
575 Ga0068853_100000360
576 Ga0068853_100071057
577 Ga0068853_100072503
578 Ga0070672_100000388
579 Ga0070672_100000508
580 Ga0070672_100004137
581 Ga0070686_100011597
582 Ga0070686_100058978
583 Ga0070665_100001570
584 Ga0070665_100007276
585 Ga0070665_100026046
586 Ga0068855_100000640
587 Ga0068855_100103386
588 Ga0070664_100091827
589 Ga0068857_100003472
590 Ga0068857_100012406
591 Ga0068857_100020716
592 Ga0068854_100000197
593 Ga0068854_100000554
594 Ga0068852_100000673
595 Ga0068852_100004368
596 Ga0068852_100010460
597 Ga0068859_100007797
598 Ga0068859_100008891
599 Ga0068859_100021403
600 Ga0068859_100028369
601 Ga0068864_100000787
602 Ga0068864_100024621
603 Ga0068851_10004880
604 Ga0068870_10001438
605 Ga0068863_100004250
606 Ga0068863_100005421
607 Ga0068863_100030647
608 Ga0068863_100059669
609 Ga0068858_100013619
610 Ga0068858_100016883
611 Ga0068858_100027749
612 Ga0068860_100002940
613 Ga0068860_100007433
614 Ga0068860_100020269
615 Ga0068862_100001236
616 Ga0097621_100001066
617 Ga0068871_100013369
618 Ga0068871_100062010
619 Ga0075433_10005698
620 Ga0068865_100006603
621 Ga0068865_100009419
622 Ga0097620_100007797
623 Ga0097620_100008891
624 Ga0097620_100021403
625 Ga0097620_100028369
626 Ga0105240_10000906
627 Ga0105240_10027081
628 Ga0105240_10249644
629 Ga0105245_10000407
630 Ga0105245_10006189
631 Ga0105245_10043071
632 Ga0105248_10002536
633 Ga0105248_10007242
634 Ga0105248_10041825
635 Ga0105248_10099140
636 Ga0105248_10146645
637 Ga0105237_10009430
638 Ga0105238_10033126
639 Ga0105249_10059201
640 Ga0105028_101026
641 Ga0105239_10014625
642 Ga0105246_10008856
643 Ga0157373_10004157
644 Ga0157371_10001390
645 Ga0157371_10013291
646 Ga0157371_10018111
647 Ga0157370_10045194
648 Ga0157369_10009651
649 Ga0157369_10029230
650 Ga0157374_10014845
651 Ga0157374_10034435
652 Ga0157374_10045883
653 Ga0157378_10002885
654 Ga0163162_10000028
655 Ga0163162_10010671
656 Ga0163162_10026950
657 Ga0163162_10027173
658 Ga0163162_10083886
659 Ga0157372_10029161
660 Ga0157372_10068316
661 Ga0157375_10123727
662 Ga0163163_10028183
663 Ga0163163_10132193
664 Ga0157379_10015040
665 Ga0157379_10061076
666 Ga0183365_10003
667 Ga0183363_1006
668 Ga0163161_10042705
669 Ga0213875_10006046
670 Ga0207425_1000098
671 Ga0209233_1002221
672 Ga0209565_1000214
673 Ga0209673_1005929
674 Ga0209676_1000052
675 Ga0209676_1002804
676 Ga0209676_1004273
677 Ga0209025_1000413
678 Ga0209564_1000887
679 Ga0209564_1008362
680 Ga0209758_1000019
681 Ga0209758_1032406
682 Ga0209050_1000005
683 Ga0209050_1000039
684 Ga0209050_1005026
685 Ga0209050_1011314
686 Ga0209051_1000739
687 Ga0209257_1000051
688 Ga0209257_1001016
689 Ga0209257_1001081
690 Ga0207697_10000221
691 Ga0207656_10001724
692 Ga0207656_10002175
693 Ga0207682_10000432
694 Ga0207682_10005440
695 Ga0207688_10002840
696 Ga0207680_10004188
697 Ga0207680_10006011
698 Ga0207680_10006324
699 Ga0207647_10000024
700 Ga0207647_10000679
701 Ga0207647_10002216
702 Ga0207645_10005288
703 Ga0207705_10014671
704 Ga0207705_10064920
705 Ga0207654_10058396
706 Ga0207695_10000040
707 Ga0207695_10016274
708 Ga0207695_10022021
709 Ga0207671_10009442
710 Ga0207671_10020377
711 Ga0207657_10002144
712 Ga0207657_10003427
713 Ga0207657_10005216
714 Ga0207657_10009627
715 Ga0207657_10016365
716 Ga0207649_10020855
717 Ga0207652_10061352
718 Ga0207681_10002062
719 Ga0207681_10010847
720 Ga0207681_10021582
721 Ga0207694_10001319
722 Ga0207694_10002489
723 Ga0207694_10010865
724 Ga0207650_10003597
725 Ga0207650_10009053
726 Ga0207650_10031621
727 Ga0207650_10038228
728 Ga0207659_10021109
729 Ga0207659_10065071
730 Ga0207687_10006558
731 Ga0207664_10012343
732 Ga0207664_10062164
733 Ga0207644_10000256
734 Ga0207644_10000612
735 Ga0207644_10002528
736 Ga0207690_10001622
737 Ga0207690_10002638
738 Ga0207690_10007713
739 Ga0207690_10014923
740 Ga0207706_10000346
741 Ga0207706_10002508
742 Ga0207706_10004341
743 Ga0207706_10006925
744 Ga0207706_10008611
745 Ga0207706_10043090
746 Ga0207706_10074519
747 Ga0207706_10079579
748 Ga0207706_10107611
749 Ga0207704_10012560
750 Ga0207704_10040263
751 Ga0207691_10000592
752 Ga0207691_10007872
753 Ga0207691_10010277
754 Ga0207691_10015900
755 Ga0207691_10057649
756 Ga0207691_10066442
757 Ga0207711_10001385
758 Ga0207711_10002016
759 Ga0207711_10006833
760 Ga0207689_10000033
761 Ga0207679_10005553
762 Ga0207667_10005076
763 Ga0207667_10005349
764 Ga0207651_10000139
765 Ga0207651_10006461
766 Ga0207651_10014755
767 Ga0207712_10001041
768 Ga0207712_10039339
769 Ga0207668_10000150
770 Ga0207640_10001090
771 Ga0207640_10003205
772 Ga0207658_10005003
773 Ga0207658_10009569
774 Ga0207658_10010086
775 Ga0207658_10011118
776 Ga0207658_10020827
777 Ga0207677_10002457
778 Ga0207677_10005504
779 Ga0207677_10005908
780 Ga0207677_10007047
781 Ga0207703_10000472
782 Ga0207703_10004952
783 Ga0207703_10008173
784 Ga0207639_10000116
785 Ga0207639_10029492
786 Ga0207639_10066387
787 Ga0207678_10000357
788 Ga0207678_10005235
789 Ga0207678_10005905
790 Ga0207678_10033423
791 Ga0207641_10004168
792 Ga0207641_10024248
793 Ga0207648_10000554
794 Ga0207648_10001898
795 Ga0207648_10004044
796 Ga0207648_10012040
797 Ga0207648_10023172
798 Ga0207676_10000439
799 Ga0207676_10001863
800 Ga0207674_10000104
801 Ga0207674_10006838
802 Ga0207674_10034394
803 Ga0207674_10036502
804 Ga0207675_100047415
805 Ga0207683_10003703
806 Ga0207683_10005306
807 Ga0207683_10005874
808 Ga0207683_10084000
809 Ga0207698_10000908
810 Ga0207698_10006257
811 Ga0207698_10012811
812 Ga0207698_10084143
813 Ga0268266_10000008
814 Ga0268266_10002617
815 Ga0268266_10006044
816 Ga0268266_10011239
817 Ga0268265_10001717
818 Ga0268265_10001931
819 Ga0268265_10008167
820 Ga0268264_10001663
821 Ga0268264_10020009
822 Ga0307513_10009145
823 Ga0307513_10078401
824 Ga0307509_10010714
825 Ga0307408_100030105
826 Ga0307408_100071366
827 Ga0307405_10010976
828 Ga0307413_10001063
829 Ga0307413_10001820
830 Ga0307413_10002980
831 Ga0307413_10004513
832 Ga0307410_10000301
833 Ga0307410_10011895
834 Ga0307410_10054053
835 Ga0307406_10015103
836 Ga0307407_10001009
837 Ga0307407_10018510
838 Ga0307409_100001143
839 Ga0307409_100020360
840 Ga0307409_100056368
841 Ga0307414_10010376
842 Ga0307414_10023921
843 Ga0307414_10048393
844 Ga0307411_10001187
845 Ga0307411_10010937
846 Ga0307411_10015144
847 Ga0307411_10018508
848 Ga0307411_10033505
849 Ga0307411_10065542
850 Ga0307411_10079262
851 Ga0307415_100000452
852 Ga0307415_100111182
853 Ga0395899_0017627
854 Ga0395899_0027161
855 Ga0395899_0035283
856 Ga0395899_0038016
857 Ga0395899_0049653
858 Ga0395899_0059298
859 Ga0395900_0012282
860 Ga0395900_0018035
861 Ga0395900_0030696
862 Ga0395900_0038763
863 Ga0395900_0039605
864 Ga0395900_0048587
865 Ga0395900_0069699
866 Ga0395898_0002665
867 Ga0395898_0022272
868 Ga0395905_0001093
869 Ga0395905_0005271
870 Ga0395905_0014032
871 Ga0395905_0017553
872 Ga0395905_0018553
873 Ga0395905_0018844
874 Ga0395905_0024038
875 Ga0395905_0025511
876 Ga0395905_0031892
877 Ga0395905_0032336
878 Ga0395905_0037161
879 Ga0395905_0061134
880 Ga0395905_0073075
881 Ga0395905_0107848
882 Ga0395905_0123896
883 Ga0395905_0153034
884 Ga0436364_0828660
885 Ga0395901_0000329
886 Ga0395901_0009570
887 Ga0395901_0009677
888 Ga0395901_0015349
889 Ga0395901_0015868
890 Ga0395901_0017881
891 Ga0395901_0053138
892 Ga0395901_0054359
893 Ga0395901_0090085
894 Ga0395901_0090914
895 Ga0395901_0149507
896 Ga0436365_0391692
897 Ga0439461_0000241
898 Ga0439465_0000096
899 Ga0439465_0000236
900 Ga0439431_0000402
901 Ga0439445_0000007
902 Ga0439445_0000022
903 Ga0439445_0000567
904 Ga0439432_000158
905 Ga0439449_0000167
906 Ga0439449_0001147
907 Ga0439449_0010833
908 Ga0439449_0020208
909 Ga0439462_0000307
910 Ga0439446_0019332
911 Ga0439434_0000724
912 Ga0439464_0000431
913 Ga0466969_0000552
914 Ga0466972_0021044
915 Ga0466966_0000577
916 Ga0466966_0043086
917 Ga0466966_0052802
918 Ga0466961_0000938
919 Ga0466961_0023705
920 Ga0466961_0029172
921 Ga0466963_0021581
922 Ga0466971_0000322
923 Ga0466971_0008098
924 Ga0466970_0002098
925 Ga0466970_0013470
926 Ga0466970_0018032
927 Ga0466970_0064382
928 Ga0466957_0000540
929 Ga0466959_0000477
930 Ga0466959_0010807
931 Ga0466958_0002844
932 Ga0466958_0006275
933 Ga0466967_0003754
934 Ga0466967_0013733
935 Ga0495590_0009337
936 Ga0495663_0006154
937 Ga0495598_0004419
938 Ga0495621_0000300
939 Ga0495625_0000107
940 Ga0495625_0020602
941 Ga0495670_0000005
942 Ga0495670_0031044
943 Ga0495649_0015113
944 Ga0495681_0012685
945 Ga0496100_0006447
946 Ga0496101_0001002
947 Ga0496102_0160467
948 Ga0496103_0044188
949 Ga0496107_0002671
950 Ga0496110_0000637
951 Ga0496111_0000353
952 Ga0496112_0001482
953 Ga0496112_0050297
954 Ga0496113_0000931
955 Ga0496115_0000218
956 Ga0496126_0022565
957 Ga0501034_0000568
958 Ga0501073_0000369
959 Ga0501225_0003565
960 Ga0501079_0016692
961 nmdc:mga03683_22224_c1
962 nmdc:mga0a205_7043_c1
963 Ga0500635_0014756
964 Ga0500562_009978
965 Ga0500608_000083
966 Ga0500658_0000640
967 Ga0500658_0015358
968 Ga0466962_0000291
969 Ga0466962_0047789
970 2643907030
971 2644128453
972 2830077180
973 2896431503
974 2928030552
975 2984557120
976 2984568513
977 2990266648
978 2993359564
979 2993695551
980 8002870264

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00041

fn3

Fibronectin type III domain

561

647

0.91

PF22633

F5_F8_type_C_2

NedA-like, galactose-binding domain

436

534

0.91

PF00754

F5_F8_type_C

F5/8 type C domain

422

544

0.89

PF04616

Glyco_hydro_43

Glycosyl hydrolases family 43

201

385

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
2yc4-assembly1.cif.gz_A intraflagellar transport complex 25-27 from chlamydomonas 0.8778 376 504
2yc2-assembly2.cif.gz_B intraflagellar transport complex 25-27 from chlamydomonas 0.8699 376 505
6org-assembly2.cif.gz_B crystal structure of spgh29 0.8561 366 504
4zy9-assembly2.cif.gz_B x-ray crystal structure of selenomethionine-labelled v110m mutant of chitosan-binding module 1 derived from chitosanase/glucanase from paenibacillus sp. ik-5 0.8542 365 504
2yc4-assembly1.cif.gz_B intraflagellar transport complex 25-27 from chlamydomonas 0.8522 366 505
ID Description Score Start End Superfamily
2yc4A00 Mainly Beta;Sandwich;Jelly Rolls;Galactose-binding domain-like 0.8778 376 504 2.60.120.260
af_A2AP83_611_699_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.872 527 602 2.60.40.10
af_Q9UQP3_357_439_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.861 527 602 2.60.40.10
af_Q9Y2H6_867_947_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.8589 527 602 2.60.40.10
4a42B00 Mainly Beta;Sandwich;Jelly Rolls;Galactose-binding domain-like 0.8522 366 505 2.60.120.260
ID Description Score Start End GO Terms
AF-A0A6J4S140-F1-model_v4 GH43_28 / CBM32 0.9817 244 604
AF-A0A6J4S140-F1-model_v4 GH43_28 / CBM32 0.9763 244 604
AF-X1IPY1-F1-model_v4 F5/8 type C domain-containing protein 0.9733 263 509
AF-A0A7W0YLB4-F1-model_v4 Family 43 glycosylhydrolase 0.9558 14 552 GO:0004553
GO:0005975
AF-A0A401U594-F1-model_v4 Coagulation factor 5/8 type domain protein 0.9551 28 604

Map