F454036

General Info

Members Datasets Scaffolds Average Seq Length
491 295 982 353

Family's Representative Sequence

Representative Sequence 3300000549|LJQas_1000586|LJQas_10005867
Length 405
Sequence LTASWTRRRPVSRGNRPKPGWSEQNGTVMPEQMSQHTSVFSGQRRQTQKLRAHPGEPSHGPLTAEELQLAVRNHSMPLEALRSDITPPGLHYLLTHFDIPFIDADHWHLRIGGAVQRSLELSLRALRRAPSISVPVTLECGGNGRSLLRPRPLSQPWMLEGVGTATWTGVPLAYLLAQARVDDDAVEVVFTGADTGIQGGVRQQYARSLPIAEALRPDVVLAYRMNDSDLPPQHGYPLRLVVPGWYGMASVKWLSSVKVVTKPFDGFQQSVAYRYQQDADDAGTPVTWIKVRSLMIPPGVPDFFTRRRILPAGPVMLRGRAWSGEGAVQRVDVGIDGKWAPAHLEHPAAPFAWCAWTIPWVADPGEHELSCRATDASGAVQPLEPVWNYQGVGNNVVQRVKVSVE

Samples

Sample ID Description Type Environment
1 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
46 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
47 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
48 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
49 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
50 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
54 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
55 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
56 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
57 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
58 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
63 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
64 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
75 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
120 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
123 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
124 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
125 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
126 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
127 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
128 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
129 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
130 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
131 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
132 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
133 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
134 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
135 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
136 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
137 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
138 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
139 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
140 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
141 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
142 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
143 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
144 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
145 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
146 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
147 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
148 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
149 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
150 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
151 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
152 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
153 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
154 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
155 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
156 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
157 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
158 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
159 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
160 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
161 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
162 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
163 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
164 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
165 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
166 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
167 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
168 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
169 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
170 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
171 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
172 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
173 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
174 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
175 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
176 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
177 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
178 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
179 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
180 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
181 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
182 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
183 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
184 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
185 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
186 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
187 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
188 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
189 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
190 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
191 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
192 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
193 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
194 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
195 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
196 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
197 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
198 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
199 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
200 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
201 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
202 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
203 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
204 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
205 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
206 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
207 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
208 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
209 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
210 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
211 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
212 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
213 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
214 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
215 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
216 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
217 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
218 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
219 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
220 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
221 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
222 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
223 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
224 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
225 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
226 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
227 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
228 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
229 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
230 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
231 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
238 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
240 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
241 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
242 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
244 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
245 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
246 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
247 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
248 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
249 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
250 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
251 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
252 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
253 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
254 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
255 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
256 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
257 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
258 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
259 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
260 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
261 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
262 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
263 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
264 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
265 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
266 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
267 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
268 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
269 2690315906 Arthrobacter sp. OY3WO11 Isolate Unclassified
270 2808606357 Arthrobacter sp. SLBN-122 Isolate Unclassified
271 2808606360 Arthrobacter sp. SLBN-112 Isolate Unclassified
272 2808606366 Arthrobacter sp. SLBN-83 Isolate Unclassified
273 2808606370 Arthrobacter sp. SLBN-100 Isolate Unclassified
274 2808606371 Arthrobacter sp. SLBN-53 Isolate Unclassified
275 2811994871 Arthrobacter sp. SLBN-179 Isolate Unclassified
276 2857740372 Paenarthrobacter sp. R-74611 Isolate Unclassified
277 2904497146 Arthrobacter sp. 1276 Isolate Rhizosphere
278 2904776348 Paenarthrobacter sp. 1092 Isolate Rhizosphere
279 2910809715 Paenarthrobacter sp. CM16 Isolate Unclassified
280 2919034639 Paenarthrobacter nitroguajacolicus 247 Isolate Rhizosphere
281 2919059106 Arthrobacter sp. 1088 Isolate Rhizosphere
282 2919391150 Arthrobacter ipis 2973 Isolate Unclassified
283 2919538618 Paenarthrobacter nitroguajacolicus 3945 Isolate Unclassified
284 2932426870 Paenarthrobacter sp. 4246 Isolate Rhizosphere
285 2939598168 Arthrobacter sp. 754 Isolate Rhizosphere
286 2939647034 Arthrobacter sp. 2762 Isolate Rhizosphere
287 2939674588 Arthrobacter bambusae 3552 Isolate Rhizosphere
288 2945916053 Arthrobacter ulcerisalmonis W1I2 Isolate Rhizosphere
289 2945941187 Arthrobacter pascens W1I14 Isolate Rhizosphere
290 2945956166 Arthrobacter globiformus W2I3 Isolate Rhizosphere
291 2946037020 Arthrobacter sp. W4I7 Isolate Rhizosphere
292 2946059875 Arthrobacter sp. SLBN-112 Isolate Rhizosphere
293 2953998280 Pseudarthrobacter sp. W1I19 Isolate Rhizosphere
294 2974302888 Pseudarthrobacter sp. SORGH_AS 212 Isolate Unclassified
295 8054107350 Arthrobacter rhizosphaerae CCNWLXL 1-35 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.5
Metatranscriptomes 0
Isolates 5.5

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.41
Nodule 0
Rhizoplane 5.5
Rhizosphere 91.04
Stem 0
Stem Tuber 0
Unclassified 0.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1000586 3300000549 Bacteria 5913
2 rootH2_10130506 3300003320 Bacteria 2095
3 rootH2_10144228 3300003320 Bacteria 2523
4 Ga0070670_100024368 3300005331 Bacteria 5203
5 Ga0070677_10026182 3300005333 Bacteria 2184
6 Ga0068869_100005227 3300005334 Bacteria 8153
7 Ga0070666_10048583 3300005335 Bacteria 2851
8 Ga0070680_100001936 3300005336 Bacteria 15218
9 Ga0070682_100001084 3300005337 Bacteria 15675
10 Ga0068868_100003103 3300005338 Bacteria 11561
11 Ga0070689_100000317 3300005340 Bacteria 28150
12 Ga0070689_100124432 3300005340 Bacteria 2062
13 Ga0070691_10000355 3300005341 Bacteria 16420
14 Ga0070687_100000251 3300005343 Bacteria 18294
15 Ga0070692_10019493 3300005345 Bacteria 3273
16 Ga0070675_100157289 3300005354 Bacteria 1952
17 Ga0070671_100269501 3300005355 Bacteria 1447
18 Ga0070667_100097731 3300005367 Bacteria 2533
19 Ga0070703_10012155 3300005406 Bacteria 2438
20 Ga0070701_10000853 3300005438 Bacteria 10941
21 Ga0070705_100000115 3300005440 Bacteria 45886
22 Ga0070700_100000903 3300005441 Bacteria 14651
23 Ga0070694_100000066 3300005444 Bacteria 49292
24 Ga0070694_100064230 3300005444 Bacteria 2512
25 Ga0070694_100160928 3300005444 Bacteria 1647
26 Ga0070708_100002210 3300005445 Bacteria 15041
27 Ga0070708_100008673 3300005445 Bacteria 8169
28 Ga0070708_100032831 3300005445 Bacteria 4505
29 Ga0070708_100278160 3300005445 Bacteria 1575
30 Ga0070678_100056995 3300005456 Bacteria 2860
31 Ga0068867_100000422 3300005459 Bacteria 28308
32 Ga0070706_100000036 3300005467 Bacteria 151766
33 Ga0070706_100040024 3300005467 Bacteria 4327
34 Ga0070706_100085561 3300005467 Bacteria 2922
35 Ga0070707_100008469 3300005468 Bacteria 9553
36 Ga0070707_100027499 3300005468 Bacteria 5411
37 Ga0070707_100093590 3300005468 Bacteria 2909
38 Ga0070707_100402173 3300005468 Bacteria 1329
39 Ga0070707_100423806 3300005468 Bacteria 1291
40 Ga0070698_100000198 3300005471 Bacteria 57734
41 Ga0070698_100038027 3300005471 Bacteria 4960
42 Ga0070699_100000052 3300005518 Bacteria 111597
43 Ga0070679_100041110 3300005530 Bacteria 4603
44 Ga0070697_100008358 3300005536 Bacteria 8076
45 Ga0070697_100008599 3300005536 Bacteria 7971
46 Ga0070697_100011227 3300005536 Bacteria 7001
47 Ga0070697_100017456 3300005536 Bacteria 5647
48 Ga0070697_100084088 3300005536 Bacteria 2624
49 Ga0070697_100179746 3300005536 Bacteria 1793
50 Ga0070672_100101753 3300005543 Bacteria 2331
51 Ga0070686_100000167 3300005544 Bacteria 45886
52 Ga0070695_100000164 3300005545 Bacteria 31583
53 Ga0070695_100007139 3300005545 Bacteria 6622
54 Ga0070695_100078205 3300005545 Bacteria 2181
55 Ga0070696_100000739 3300005546 Bacteria 20870
56 Ga0070696_100000933 3300005546 Bacteria 18945
57 Ga0070693_100000323 3300005547 Bacteria 22003
58 Ga0070704_100000093 3300005549 Bacteria 30795
59 Ga0068855_100005066 3300005563 Bacteria 16071
60 Ga0068854_100025736 3300005578 Bacteria 4037
61 Ga0070702_100003437 3300005615 Bacteria 7084
62 Ga0068859_100013618 3300005617 Bacteria 8153
63 Ga0068859_100070993 3300005617 Bacteria 3518
64 Ga0068864_100011897 3300005618 Bacteria 7185
65 Ga0068858_100005171 3300005842 Bacteria 12778
66 Ga0068860_100003453 3300005843 Bacteria 16255
67 Ga0068862_100001425 3300005844 Bacteria 22156
68 Ga0081455_10042572 3300005937 Bacteria 3981
69 Ga0081538_10005326 3300005981 Bacteria 11582
70 Ga0070717_10000105 3300006028 Bacteria 66343
71 Ga0070717_10042070 3300006028 Bacteria 3727
72 Ga0075365_10008218 3300006038 Bacteria 5905
73 Ga0075432_10018835 3300006058 Bacteria 2356
74 Ga0070716_100034944 3300006173 Bacteria 2760
75 Ga0097621_100003699 3300006237 Bacteria 10581
76 Ga0068871_100000965 3300006358 Bacteria 19218
77 Ga0075428_100000502 3300006844 Bacteria 39707
78 Ga0075428_100071259 3300006844 Bacteria 3799
79 Ga0075428_100141150 3300006844 Bacteria 2619
80 Ga0075428_100336606 3300006844 Bacteria 1621
81 Ga0075430_100000620 3300006846 Bacteria 27115
82 Ga0075430_100008701 3300006846 Bacteria 8565
83 Ga0075430_100053261 3300006846 Bacteria 3407
84 Ga0075431_100007715 3300006847 Bacteria 10716
85 Ga0075431_100220054 3300006847 Bacteria 1937
86 Ga0075433_10000611 3300006852 Bacteria 23830
87 Ga0075433_10008931 3300006852 Bacteria 8001
88 Ga0075433_10015296 3300006852 Bacteria 6288
89 Ga0075433_10068436 3300006852 Bacteria 3117
90 Ga0075433_10248490 3300006852 Bacteria 1578
91 Ga0075433_10343031 3300006852 Bacteria 1320
92 Ga0075434_100000406 3300006871 Bacteria 31740
93 Ga0075434_100000420 3300006871 Bacteria 31423
94 Ga0075434_100001960 3300006871 Bacteria 17843
95 Ga0075434_100004191 3300006871 Bacteria 12920
96 Ga0075434_100037772 3300006871 Bacteria 4781
97 Ga0075434_100154967 3300006871 Bacteria 2311
98 Ga0075434_100156318 3300006871 Unclassified 2299
99 Ga0075429_100006458 3300006880 Bacteria 10155
100 Ga0068865_100000043 3300006881 Bacteria 70962
101 Ga0075436_100000513 3300006914 Bacteria 25110
102 Ga0075436_100251135 3300006914 Bacteria 1259
103 Ga0097620_100013618 3300006931 Bacteria 8153
104 Ga0097620_100070993 3300006931 Bacteria 3518
105 Ga0075435_100000668 3300007076 Bacteria 21181
106 Ga0075435_100022097 3300007076 Bacteria 4905
107 Ga0075435_100023865 3300007076 Bacteria 4738
108 Ga0075435_100025101 3300007076 Bacteria 4636
109 Ga0075435_100059147 3300007076 Bacteria 3106
110 Ga0075435_100088147 3300007076 Bacteria 2557
111 Ga0105251_10057927 3300009011 Bacteria 1830
112 Ga0105244_10011440 3300009036 Bacteria 5321
113 Ga0111539_10025953 3300009094 Bacteria 7173
114 Ga0111539_10033795 3300009094 Bacteria 6206
115 Ga0105245_10002730 3300009098 Bacteria 15887
116 Ga0105245_10021533 3300009098 Bacteria 5657
117 Ga0114129_10000393 3300009147 Bacteria 51077
118 Ga0114129_10017768 3300009147 Bacteria 10127
119 Ga0114129_10101226 3300009147 Bacteria 3987
120 Ga0114129_10102635 3300009147 Bacteria 3955
121 Ga0114129_10666112 3300009147 Bacteria 1341
122 Ga0105243_10002483 3300009148 Bacteria 15383
123 Ga0105243_10066999 3300009148 Bacteria 2889
124 Ga0105243_10086908 3300009148 Bacteria 2565
125 Ga0105241_10060798 3300009174 Bacteria 2907
126 Ga0105242_10000296 3300009176 Bacteria 39554
127 Ga0105248_10058291 3300009177 Bacteria 4337
128 Ga0105248_10155338 3300009177 Bacteria 2582
129 Ga0105249_10013242 3300009553 Bacteria 7279
130 Ga0105239_10100776 3300010375 Bacteria 3195
131 Ga0105246_10012860 3300011119 Bacteria 5234
132 Ga0105246_10013182 3300011119 Bacteria 5176
133 Ga0157371_10042930 3300013102 Bacteria 3222
134 Ga0157369_10118773 3300013105 Bacteria 2806
135 Ga0157369_10151684 3300013105 Bacteria 2449
136 Ga0157378_10000140 3300013297 Bacteria 67335
137 Ga0157378_10065443 3300013297 Bacteria 3254
138 Ga0163162_10034362 3300013306 Bacteria 5046
139 Ga0157375_10148212 3300013308 Bacteria 2479
140 Ga0163163_10092245 3300014325 Bacteria 3043
141 Ga0163163_10167940 3300014325 Bacteria 2240
142 Ga0157379_10136603 3300014968 Bacteria 2209
143 Ga0157376_10001393 3300014969 Bacteria 15896
144 Ga0209051_1008918 3300025303 Bacteria 5239
145 Ga0207697_10001206 3300025315 Bacteria 14167
146 Ga0207697_10006018 3300025315 Bacteria 5551
147 Ga0207655_1013460 3300025728 Bacteria 4696
148 Ga0207655_1036831 3300025728 Bacteria 2164
149 Ga0207655_1040046 3300025728 Bacteria 2028
150 Ga0207653_10004260 3300025885 Bacteria 4494
151 Ga0207682_10000126 3300025893 Bacteria 34447
152 Ga0207642_10002243 3300025899 Bacteria 6005
153 Ga0207680_10104690 3300025903 Bacteria 1824
154 Ga0207645_10008636 3300025907 Bacteria 7094
155 Ga0207643_10077588 3300025908 Bacteria 1921
156 Ga0207684_10000020 3300025910 Bacteria 342787
157 Ga0207684_10000441 3300025910 Bacteria 55041
158 Ga0207684_10007210 3300025910 Bacteria 10047
159 Ga0207684_10017186 3300025910 Bacteria 6207
160 Ga0207662_10000024 3300025918 Bacteria 70677
161 Ga0207652_10029903 3300025921 Bacteria 4559
162 Ga0207646_10001140 3300025922 Bacteria 33868
163 Ga0207646_10002272 3300025922 Bacteria 22859
164 Ga0207646_10003775 3300025922 Bacteria 16875
165 Ga0207646_10034128 3300025922 Bacteria 4598
166 Ga0207650_10004213 3300025925 Bacteria 9820
167 Ga0207659_10014866 3300025926 Bacteria 5030
168 Ga0207687_10026914 3300025927 Bacteria 3854
169 Ga0207700_10165307 3300025928 Bacteria 1841
170 Ga0207686_10001122 3300025934 Bacteria 15496
171 Ga0207709_10006556 3300025935 Bacteria 6536
172 Ga0207670_10080441 3300025936 Bacteria 2278
173 Ga0207704_10058283 3300025938 Bacteria 2377
174 Ga0207665_10028280 3300025939 Bacteria 3703
175 Ga0207691_10115023 3300025940 Bacteria 2389
176 Ga0207711_10281591 3300025941 Bacteria 1531
177 Ga0207689_10000162 3300025942 Bacteria 57621
178 Ga0207689_10019504 3300025942 Bacteria 5715
179 Ga0207667_10005789 3300025949 Bacteria 15080
180 Ga0207651_10012861 3300025960 Bacteria 4758
181 Ga0207651_10171775 3300025960 Bacteria 1710
182 Ga0207640_10018355 3300025981 Bacteria 4110
183 Ga0207677_10000875 3300026023 Bacteria 17082
184 Ga0207703_10029263 3300026035 Bacteria 4345
185 Ga0207708_10001467 3300026075 Bacteria 17645
186 Ga0207702_10127613 3300026078 Bacteria 2286
187 Ga0207702_10374748 3300026078 Bacteria 1367
188 Ga0207648_10000147 3300026089 Bacteria 70420
189 Ga0207676_10094070 3300026095 Bacteria 2469
190 Ga0207676_10194056 3300026095 Bacteria 1789
191 Ga0207675_100000104 3300026118 Bacteria 67261
192 Ga0207675_100005042 3300026118 Bacteria 12711
193 Ga0207683_10003489 3300026121 Bacteria 13724
194 Ga0207428_10000591 3300027907 Bacteria 42796
195 Ga0207428_10009302 3300027907 Bacteria 8817
196 Ga0207428_10019358 3300027907 Bacteria 5805
197 Ga0268265_10000875 3300028380 Bacteria 28237
198 Ga0268264_10000841 3300028381 Bacteria 32855
199 Ga0265319_1003152 3300028563 Bacteria 8687
200 Ga0265334_10016102 3300028573 Bacteria 3095
201 Ga0265324_10042953 3300029957 Bacteria 1561
202 Ga0265320_10011874 3300031240 Bacteria 5103
203 Ga0265340_10015242 3300031247 Bacteria 3998
204 Ga0265316_10011245 3300031344 Bacteria 8093
205 Ga0307408_100021476 3300031548 Bacteria 4368
206 Ga0307408_100039793 3300031548 Bacteria 3326
207 Ga0307408_100170101 3300031548 Bacteria 1739
208 Ga0265314_10045828 3300031711 Bacteria 3089
209 Ga0307405_10008040 3300031731 Bacteria 5320
210 Ga0307405_10013234 3300031731 Bacteria 4397
211 Ga0307405_10014199 3300031731 Bacteria 4274
212 Ga0307405_10120341 3300031731 Bacteria 1795
213 Ga0307413_10038462 3300031824 Bacteria 2773
214 Ga0307413_10041989 3300031824 Bacteria 2683
215 Ga0307413_10068560 3300031824 Bacteria 2222
216 Ga0307413_10119284 3300031824 Bacteria 1783
217 Ga0307413_10151139 3300031824 Bacteria 1618
218 Ga0307410_10033515 3300031852 Bacteria 3316
219 Ga0307410_10045226 3300031852 Bacteria 2930
220 Ga0307410_10056489 3300031852 Bacteria 2669
221 Ga0307410_10115872 3300031852 Bacteria 1946
222 Ga0307410_10137383 3300031852 Bacteria 1803
223 Ga0307410_10151640 3300031852 Bacteria 1726
224 Ga0307406_10026807 3300031901 Bacteria 3465
225 Ga0307406_10034961 3300031901 Bacteria 3086
226 Ga0307406_10046104 3300031901 Bacteria 2741
227 Ga0307406_10234931 3300031901 Bacteria 1371
228 Ga0307407_10016419 3300031903 Bacteria 3686
229 Ga0307407_10043578 3300031903 Bacteria 2523
230 Ga0307407_10076792 3300031903 Bacteria 2006
231 Ga0307412_10048946 3300031911 Bacteria 2782
232 Ga0307412_10069772 3300031911 Bacteria 2393
233 Ga0307412_10087338 3300031911 Bacteria 2172
234 Ga0307409_100038141 3300031995 Bacteria 3550
235 Ga0307416_100005550 3300032002 Bacteria 7763
236 Ga0307416_100162820 3300032002 Bacteria 2064
237 Ga0307416_100218289 3300032002 Bacteria 1826
238 Ga0307416_100249971 3300032002 Bacteria 1725
239 Ga0307416_100255894 3300032002 Bacteria 1707
240 Ga0307416_100294042 3300032002 Bacteria 1610
241 Ga0307416_100335649 3300032002 Bacteria 1521
242 Ga0307414_10192179 3300032004 Bacteria 1653
243 Ga0307414_10264215 3300032004 Bacteria 1438
244 Ga0307411_10029162 3300032005 Bacteria 3365
245 Ga0307415_100068238 3300032126 Bacteria 2488
246 Ga0307415_100378542 3300032126 Bacteria 1201
247 Ga0373948_0004509 3300034817 Bacteria 2208
248 Ga0373926_0000374 3300035083 Bacteria 11463
249 Ga0373928_0001441 3300035084 Bacteria 4620
250 Ga0373940_0008080 3300035088 Bacteria 2401
251 Ga0373952_0003435 3300035092 Bacteria 2858
252 Ga0373932_0002228 3300035112 Bacteria 4982
253 Ga0373939_0000980 3300035114 Bacteria 7091
254 Ga0373941_0040190 3300035115 Bacteria 1441
255 Ga0373946_0057869 3300035171 Unclassified 1640
256 Ga0373961_0022590 3300035241 Bacteria 1684
257 Ga0373962_0003422 3300035242 Bacteria 3813
258 Ga0373931_0000177 3300035691 Bacteria 27824
259 Ga0373927_0019415 3300035695 Bacteria 4457
260 Ga0373925_0072097 3300037068 Bacteria 2613
261 Ga0395899_0001483 3300037312 Bacteria 19971
262 Ga0395899_0013365 3300037312 Bacteria 6280
263 Ga0395899_0103433 3300037312 Bacteria 2054
264 Ga0395900_0056857 3300037418 Bacteria 4027
265 Ga0395898_0075975 3300037466 Bacteria 3244
266 Ga0395898_0245901 3300037466 Bacteria 1706
267 Ga0395905_0250671 3300037471 Bacteria 1654
268 Ga0395901_0008604 3300038443 Bacteria 10316
269 Ga0395901_0321686 3300038443 Bacteria 1600
270 Ga0436363_1309023 3300039450 Bacteria 2605
271 Ga0436362_0909728 3300039453 Bacteria 1397
272 Ga0439436_0004373 3300041404 Bacteria 4328
273 Ga0439438_024979 3300041405 Bacteria 1632
274 Ga0439439_0007543 3300041406 Bacteria 2548
275 Ga0439461_0000481 3300041410 Bacteria 5761
276 Ga0439466_0002744 3300041411 Bacteria 6893
277 Ga0439466_0041154 3300041411 Bacteria 1543
278 Ga0439433_0004374 3300041999 Bacteria 3046
279 Ga0439433_0041875 3300041999 Bacteria 1067
280 Ga0439441_009392 3300042001 Bacteria 1618
281 Ga0439442_001374 3300042002 Bacteria 4817
282 Ga0439442_002583 3300042002 Bacteria 3552
283 Ga0439449_0001865 3300042007 Bacteria 8296
284 Ga0439462_0016256 3300042015 Bacteria 1922
285 Ga0450920_000526 3300042122 Bacteria 6042
286 Ga0450920_003839 3300042122 Bacteria 2616
287 Ga0450920_012382 3300042122 Bacteria 1600
288 Ga0450907_000584 3300042146 Bacteria 9809
289 Ga0450910_001694 3300042147 Bacteria 2827
290 Ga0439434_0009163 3300042435 Bacteria 2910
291 Ga0439434_0016708 3300042435 Bacteria 2193
292 Ga0439435_0001815 3300042436 Bacteria 4072
293 Ga0450918_001097 3300042531 Bacteria 5566
294 Ga0466963_0022653 3300044694 Bacteria 3981
295 Ga0451576_0009298 3300045051 Bacteria 11411
296 Ga0451576_0020809 3300045051 Bacteria 7139
297 Ga0451576_0047301 3300045051 Bacteria 4523
298 Ga0466967_0109340 3300045976 Bacteria 2538
299 Ga0495653_0009296 3300046463 Bacteria 8042
300 Ga0495580_0008764 3300046472 Bacteria 8012
301 Ga0495582_0019386 3300046473 Bacteria 3718
302 Ga0495639_0014771 3300046475 Bacteria 3383
303 Ga0495639_0028944 3300046475 Bacteria 2456
304 Ga0495662_0002526 3300046476 Bacteria 9225
305 Ga0495594_0064603 3300046499 Bacteria 2029
306 Ga0495630_0016327 3300046517 Bacteria 5424
307 Ga0495631_0030681 3300046518 Bacteria 2437
308 Ga0495643_0071739 3300046522 Bacteria 1817
309 Ga0495666_0007281 3300046526 Bacteria 5552
310 Ga0495642_0055796 3300046528 Bacteria 1631
311 Ga0495654_0079682 3300046530 Bacteria 1538
312 Ga0495665_0000983 3300046531 Bacteria 15128
313 Ga0495665_0069990 3300046531 Bacteria 1849
314 Ga0495586_0004594 3300046535 Bacteria 7380
315 Ga0495586_0018559 3300046535 Bacteria 3704
316 Ga0495586_0033812 3300046535 Bacteria 2744
317 Ga0495586_0052936 3300046535 Bacteria 2198
318 Ga0495587_0001116 3300046536 Bacteria 17582
319 Ga0495598_0008773 3300046537 Bacteria 2365
320 Ga0495633_0046004 3300046558 Bacteria 2065
321 Ga0495667_0002674 3300046559 Bacteria 11911
322 Ga0495656_0004238 3300046615 Bacteria 4895
323 Ga0495635_0053108 3300046663 Bacteria 2792
324 Ga0495659_0010181 3300046664 Bacteria 3013
325 Ga0495588_0017710 3300046674 Bacteria 3464
326 Ga0495588_0040433 3300046674 Bacteria 2378
327 Ga0495588_0099094 3300046674 Bacteria 1530
328 Ga0495657_0061571 3300046675 Bacteria 2482
329 Ga0495623_0023875 3300046679 Bacteria 3945
330 Ga0495647_0001798 3300046681 Bacteria 6626
331 Ga0495658_0025915 3300046683 Bacteria 3138
332 Ga0495613_0216083 3300046689 Bacteria 1347
333 Ga0495670_0000338 3300046691 Bacteria 22344
334 Ga0495670_0062159 3300046691 Bacteria 1878
335 Ga0495670_0067613 3300046691 Bacteria 1804
336 Ga0495600_0128663 3300046809 Bacteria 1646
337 Ga0495600_0171866 3300046809 Bacteria 1398
338 Ga0495581_0002780 3300047315 Bacteria 9976
339 Ga0495604_0087319 3300047317 Bacteria 2323
340 Ga0495636_0005293 3300047318 Bacteria 5067
341 Ga0495636_0030359 3300047318 Bacteria 2210
342 Ga0495680_0007190 3300047322 Bacteria 10255
343 Ga0495675_0012523 3300047444 Bacteria 5339
344 Ga0495681_0037248 3300047470 Bacteria 2398
345 Ga0495684_0055510 3300047471 Bacteria 3021
346 Ga0495593_0009654 3300047673 Bacteria 5600
347 Ga0496100_0003367 3300048903 Bacteria 8324
348 Ga0496102_0077871 3300048905 Bacteria 3051
349 Ga0496102_0083209 3300048905 Bacteria 2952
350 Ga0496102_0537528 3300048905 Bacteria 1091
351 Ga0496103_0010898 3300048906 Bacteria 5380
352 Ga0496103_0017766 3300048906 Bacteria 4260
353 Ga0496103_0160284 3300048906 Bacteria 1443
354 Ga0496104_0008368 3300048907 Bacteria 9193
355 Ga0496104_0080987 3300048907 Bacteria 3095
356 Ga0496105_0002859 3300048908 Bacteria 12642
357 Ga0496106_0004267 3300048909 Bacteria 10633
358 Ga0496106_0010677 3300048909 Bacteria 6787
359 Ga0496107_0000513 3300048910 Bacteria 21539
360 Ga0496107_0028931 3300048910 Bacteria 3940
361 Ga0496107_0048708 3300048910 Bacteria 3054
362 Ga0496107_0136431 3300048910 Bacteria 1812
363 Ga0496108_0000674 3300048911 Bacteria 26407
364 Ga0496108_0196963 3300048911 Bacteria 1747
365 Ga0496109_0015359 3300048912 Bacteria 6671
366 Ga0496109_0118589 3300048912 Bacteria 2464
367 Ga0496110_0006729 3300048913 Bacteria 9137
368 Ga0496110_0072716 3300048913 Bacteria 3051
369 Ga0496110_0340159 3300048913 Bacteria 1367
370 Ga0496111_0049095 3300048914 Bacteria 3042
371 Ga0496112_0047202 3300048915 Bacteria 4225
372 Ga0496112_0369677 3300048915 Bacteria 1375
373 Ga0496113_0259648 3300048916 Bacteria 1388
374 Ga0501031_0074093 3300049568 Bacteria 2217
375 Ga0501032_0007511 3300049569 Bacteria 7962
376 Ga0501032_0033530 3300049569 Bacteria 3517
377 Ga0501034_0001687 3300049571 Bacteria 28468
378 Ga0501036_0182535 3300049572 Bacteria 1766
379 Ga0501037_0005772 3300049573 Bacteria 9038
380 Ga0501037_0016066 3300049573 Bacteria 5508
381 Ga0501037_0170685 3300049573 Bacteria 1546
382 Ga0501037_0207075 3300049573 Bacteria 1384
383 Ga0501038_0005777 3300049574 Bacteria 11459
384 Ga0501038_0012593 3300049574 Bacteria 7730
385 Ga0501038_0022914 3300049574 Bacteria 5590
386 Ga0501039_0006182 3300049575 Bacteria 9091
387 Ga0501039_0022288 3300049575 Bacteria 4863
388 Ga0501039_0031851 3300049575 Bacteria 4065
389 Ga0501040_0014901 3300049576 Bacteria 5132
390 Ga0501040_0051796 3300049576 Bacteria 2808
391 Ga0501041_0016627 3300049577 Bacteria 4377
392 Ga0501041_0022257 3300049577 Bacteria 3794
393 Ga0501041_0090146 3300049577 Bacteria 1893
394 Ga0501041_0125289 3300049577 Bacteria 1599
395 Ga0501042_0011314 3300049578 Bacteria 6016
396 Ga0501043_0080907 3300049579 Bacteria 2552
397 Ga0501046_0035200 3300049580 Bacteria 4036
398 Ga0501070_0076389 3300049586 Bacteria 2773
399 Ga0501070_0088447 3300049586 Bacteria 2564
400 Ga0501071_0159674 3300049587 Bacteria 1684
401 Ga0501072_0000720 3300049588 Bacteria 24044
402 Ga0501072_0022288 3300049588 Bacteria 4914
403 Ga0501072_0104297 3300049588 Bacteria 2254
404 Ga0501073_0011928 3300049589 Bacteria 6344
405 Ga0501074_0098925 3300049590 Bacteria 2088
406 Ga0501075_0016542 3300049591 Bacteria 5315
407 Ga0501075_0060226 3300049591 Bacteria 2861
408 Ga0501075_0149405 3300049591 Bacteria 1781
409 Ga0501075_0195336 3300049591 Unclassified 1543
410 Ga0501076_0003881 3300049592 Bacteria 10528
411 Ga0501076_0014654 3300049592 Bacteria 5909
412 Ga0501077_0021673 3300049593 Bacteria 4067
413 Ga0501077_0024362 3300049593 Bacteria 3843
414 Ga0501079_0006150 3300049741 Bacteria 9005
415 Ga0501079_0018197 3300049741 Bacteria 5366
416 Ga0501080_0022576 3300049742 Bacteria 5830
417 Ga0501080_0030502 3300049742 Bacteria 5023
418 Ga0501081_0026187 3300049743 Bacteria 3930
419 Ga0501081_0141851 3300049743 Bacteria 1722
420 Ga0501279_002083 3300049775 Bacteria 2650
421 Ga0501045_0010278 3300049824 Bacteria 6555
422 Ga0501045_0097276 3300049824 Bacteria 2178
423 nmdc:mga05p37_105338_c1 3300050507 Bacteria 3470
424 nmdc:mga05p37_10710_c1 3300050507 Bacteria 10884
425 nmdc:mga05p37_382184_c1 3300050507 Bacteria 1650
426 nmdc:mga05p37_775_c1 3300050507 Bacteria 35507
427 nmdc:mga09592_148_c1 3300050508 Bacteria 47706
428 nmdc:mga0qj67_315226_c1 3300050509 Bacteria 1266
429 nmdc:mga0qj67_48546_c1 3300050509 Bacteria 3353
430 nmdc:mga0qj67_740_c1 3300050509 Bacteria 22151
431 nmdc:mga06r32_2241_c1 3300050510 Bacteria 17309
432 nmdc:mga08y16_27884_c1 3300050511 Bacteria 5954
433 nmdc:mga08y16_6707_c1 3300050511 Bacteria 12072
434 nmdc:mga0n895_258674_c1 3300050512 Bacteria 1767
435 nmdc:mga0n895_26762_c1 3300050512 Bacteria 5469
436 nmdc:mga0n895_37609_c1 3300050512 Bacteria 4684
437 nmdc:mga0n895_39167_c1 3300050512 Bacteria 4597
438 nmdc:mga0n895_42377_c1 3300050512 Bacteria 4428
439 nmdc:mga0n895_924_c1 3300050512 Bacteria 21172
440 nmdc:mga0rr50_118081_c1 3300050513 Bacteria 2107
441 nmdc:mga0rr50_13072_c1 3300050513 Bacteria 5390
442 nmdc:mga0rr50_1686_c1 3300050513 Bacteria 12197
443 nmdc:mga0rr50_31547_c1 3300050513 Bacteria 3764
444 nmdc:mga0rr50_31752_c1 3300050513 Bacteria 3756
445 nmdc:mga08x19_22448_c1 3300050514 Bacteria 3909
446 nmdc:mga08x19_834_c1 3300050514 Bacteria 19567
447 nmdc:mga0a205_10857_c1 3300050515 Bacteria 8378
448 nmdc:mga0a205_121786_c1 3300050515 Bacteria 2508
449 nmdc:mga0a205_236717_c1 3300050515 Bacteria 1708
450 nmdc:mga0a205_268935_c1 3300050515 Bacteria 1582
451 nmdc:mga0a205_28573_c1 3300050515 Bacteria 5333
452 nmdc:mga0a205_45087_c1 3300050515 Bacteria 4252
453 nmdc:mga0a205_72547_c1 3300050515 Bacteria 3326
454 nmdc:mga0a205_821_c1 3300050515 Bacteria 25293
455 Ga0495595_0044077 3300053084 Bacteria 2049
456 Ga0501084_0095082 3300054114 Bacteria 2502
457 Ga0501084_0126519 3300054114 Bacteria 2150
458 Ga0501084_0236428 3300054114 Viruses 1542
459 Ga0501082_0015226 3300060353 Bacteria 6624
460 Ga0501082_0040627 3300060353 Bacteria 4011
461 Ga0501082_0422247 3300060353 Bacteria 1164
462 Ga0530510_0000042 3300061734 Bacteria 58436
463 Ga0530510_0014848 3300061734 Bacteria 5499
464 Ga0530510_0195608 3300061734 Bacteria 1501
465 2691511806 2690315906 Bacteria 4517044
466 2808829001 2808606357 Bacteria 4466944
467 2808850224 2808606360 Bacteria 4404006
468 2808877223 2808606366 Bacteria 4415912
469 2808893238 2808606370 Bacteria 4942454
470 2808898681 2808606371 Bacteria 4251511
471 2812319264 2811994871 Bacteria 4497550
472 2857744841 2857740372 Bacteria 4782044
473 2904499135 2904497146 Bacteria 4731781
474 2904780616 2904776348 Bacteria 4658726
475 2910811363 2910809715 Bacteria 4982797
476 2919039114 2919034639 Bacteria 4763403
477 2919060884 2919059106 Bacteria 4991624
478 2919395637 2919391150 Bacteria 4884741
479 2919541309 2919538618 Bacteria 4677069
480 2932430188 2932426870 Bacteria 4547726
481 2939602395 2939598168 Bacteria 4687164
482 2939651255 2939647034 Bacteria 4681660
483 2939678941 2939674588 Bacteria 4844420
484 2945917017 2945916053 Bacteria 4555517
485 2945945493 2945941187 Bacteria 4682474
486 2945956198 2945956166 Bacteria 5110334
487 2946041584 2946037020 Bacteria 4900426
488 2946060847 2946059875 Bacteria 4386623
489 2954002782 2953998280 Bacteria 4812144
490 2974305020 2974302888 Bacteria 4369871
491 8054112029 8054107350 Bacteria 5022511
492 LJQas_1000586
493 rootH2_10130506
494 rootH2_10144228
495 Ga0070670_100024368
496 Ga0070677_10026182
497 Ga0068869_100005227
498 Ga0070666_10048583
499 Ga0070680_100001936
500 Ga0070682_100001084
501 Ga0068868_100003103
502 Ga0070689_100000317
503 Ga0070689_100124432
504 Ga0070691_10000355
505 Ga0070687_100000251
506 Ga0070692_10019493
507 Ga0070675_100157289
508 Ga0070671_100269501
509 Ga0070667_100097731
510 Ga0070703_10012155
511 Ga0070701_10000853
512 Ga0070705_100000115
513 Ga0070700_100000903
514 Ga0070694_100000066
515 Ga0070694_100064230
516 Ga0070694_100160928
517 Ga0070708_100002210
518 Ga0070708_100008673
519 Ga0070708_100032831
520 Ga0070708_100278160
521 Ga0070678_100056995
522 Ga0068867_100000422
523 Ga0070706_100000036
524 Ga0070706_100040024
525 Ga0070706_100085561
526 Ga0070707_100008469
527 Ga0070707_100027499
528 Ga0070707_100093590
529 Ga0070707_100402173
530 Ga0070707_100423806
531 Ga0070698_100000198
532 Ga0070698_100038027
533 Ga0070699_100000052
534 Ga0070679_100041110
535 Ga0070697_100008358
536 Ga0070697_100008599
537 Ga0070697_100011227
538 Ga0070697_100017456
539 Ga0070697_100084088
540 Ga0070697_100179746
541 Ga0070672_100101753
542 Ga0070686_100000167
543 Ga0070695_100000164
544 Ga0070695_100007139
545 Ga0070695_100078205
546 Ga0070696_100000739
547 Ga0070696_100000933
548 Ga0070693_100000323
549 Ga0070704_100000093
550 Ga0068855_100005066
551 Ga0068854_100025736
552 Ga0070702_100003437
553 Ga0068859_100013618
554 Ga0068859_100070993
555 Ga0068864_100011897
556 Ga0068858_100005171
557 Ga0068860_100003453
558 Ga0068862_100001425
559 Ga0081455_10042572
560 Ga0081538_10005326
561 Ga0070717_10000105
562 Ga0070717_10042070
563 Ga0075365_10008218
564 Ga0075432_10018835
565 Ga0070716_100034944
566 Ga0097621_100003699
567 Ga0068871_100000965
568 Ga0075428_100000502
569 Ga0075428_100071259
570 Ga0075428_100141150
571 Ga0075428_100336606
572 Ga0075430_100000620
573 Ga0075430_100008701
574 Ga0075430_100053261
575 Ga0075431_100007715
576 Ga0075431_100220054
577 Ga0075433_10000611
578 Ga0075433_10008931
579 Ga0075433_10015296
580 Ga0075433_10068436
581 Ga0075433_10248490
582 Ga0075433_10343031
583 Ga0075434_100000406
584 Ga0075434_100000420
585 Ga0075434_100001960
586 Ga0075434_100004191
587 Ga0075434_100037772
588 Ga0075434_100154967
589 Ga0075434_100156318
590 Ga0075429_100006458
591 Ga0068865_100000043
592 Ga0075436_100000513
593 Ga0075436_100251135
594 Ga0097620_100013618
595 Ga0097620_100070993
596 Ga0075435_100000668
597 Ga0075435_100022097
598 Ga0075435_100023865
599 Ga0075435_100025101
600 Ga0075435_100059147
601 Ga0075435_100088147
602 Ga0105251_10057927
603 Ga0105244_10011440
604 Ga0111539_10025953
605 Ga0111539_10033795
606 Ga0105245_10002730
607 Ga0105245_10021533
608 Ga0114129_10000393
609 Ga0114129_10017768
610 Ga0114129_10101226
611 Ga0114129_10102635
612 Ga0114129_10666112
613 Ga0105243_10002483
614 Ga0105243_10066999
615 Ga0105243_10086908
616 Ga0105241_10060798
617 Ga0105242_10000296
618 Ga0105248_10058291
619 Ga0105248_10155338
620 Ga0105249_10013242
621 Ga0105239_10100776
622 Ga0105246_10012860
623 Ga0105246_10013182
624 Ga0157371_10042930
625 Ga0157369_10118773
626 Ga0157369_10151684
627 Ga0157378_10000140
628 Ga0157378_10065443
629 Ga0163162_10034362
630 Ga0157375_10148212
631 Ga0163163_10092245
632 Ga0163163_10167940
633 Ga0157379_10136603
634 Ga0157376_10001393
635 Ga0209051_1008918
636 Ga0207697_10001206
637 Ga0207697_10006018
638 Ga0207655_1013460
639 Ga0207655_1036831
640 Ga0207655_1040046
641 Ga0207653_10004260
642 Ga0207682_10000126
643 Ga0207642_10002243
644 Ga0207680_10104690
645 Ga0207645_10008636
646 Ga0207643_10077588
647 Ga0207684_10000020
648 Ga0207684_10000441
649 Ga0207684_10007210
650 Ga0207684_10017186
651 Ga0207662_10000024
652 Ga0207652_10029903
653 Ga0207646_10001140
654 Ga0207646_10002272
655 Ga0207646_10003775
656 Ga0207646_10034128
657 Ga0207650_10004213
658 Ga0207659_10014866
659 Ga0207687_10026914
660 Ga0207700_10165307
661 Ga0207686_10001122
662 Ga0207709_10006556
663 Ga0207670_10080441
664 Ga0207704_10058283
665 Ga0207665_10028280
666 Ga0207691_10115023
667 Ga0207711_10281591
668 Ga0207689_10000162
669 Ga0207689_10019504
670 Ga0207667_10005789
671 Ga0207651_10012861
672 Ga0207651_10171775
673 Ga0207640_10018355
674 Ga0207677_10000875
675 Ga0207703_10029263
676 Ga0207708_10001467
677 Ga0207702_10127613
678 Ga0207702_10374748
679 Ga0207648_10000147
680 Ga0207676_10094070
681 Ga0207676_10194056
682 Ga0207675_100000104
683 Ga0207675_100005042
684 Ga0207683_10003489
685 Ga0207428_10000591
686 Ga0207428_10009302
687 Ga0207428_10019358
688 Ga0268265_10000875
689 Ga0268264_10000841
690 Ga0265319_1003152
691 Ga0265334_10016102
692 Ga0265324_10042953
693 Ga0265320_10011874
694 Ga0265340_10015242
695 Ga0265316_10011245
696 Ga0307408_100021476
697 Ga0307408_100039793
698 Ga0307408_100170101
699 Ga0265314_10045828
700 Ga0307405_10008040
701 Ga0307405_10013234
702 Ga0307405_10014199
703 Ga0307405_10120341
704 Ga0307413_10038462
705 Ga0307413_10041989
706 Ga0307413_10068560
707 Ga0307413_10119284
708 Ga0307413_10151139
709 Ga0307410_10033515
710 Ga0307410_10045226
711 Ga0307410_10056489
712 Ga0307410_10115872
713 Ga0307410_10137383
714 Ga0307410_10151640
715 Ga0307406_10026807
716 Ga0307406_10034961
717 Ga0307406_10046104
718 Ga0307406_10234931
719 Ga0307407_10016419
720 Ga0307407_10043578
721 Ga0307407_10076792
722 Ga0307412_10048946
723 Ga0307412_10069772
724 Ga0307412_10087338
725 Ga0307409_100038141
726 Ga0307416_100005550
727 Ga0307416_100162820
728 Ga0307416_100218289
729 Ga0307416_100249971
730 Ga0307416_100255894
731 Ga0307416_100294042
732 Ga0307416_100335649
733 Ga0307414_10192179
734 Ga0307414_10264215
735 Ga0307411_10029162
736 Ga0307415_100068238
737 Ga0307415_100378542
738 Ga0373948_0004509
739 Ga0373926_0000374
740 Ga0373928_0001441
741 Ga0373940_0008080
742 Ga0373952_0003435
743 Ga0373932_0002228
744 Ga0373939_0000980
745 Ga0373941_0040190
746 Ga0373946_0057869
747 Ga0373961_0022590
748 Ga0373962_0003422
749 Ga0373931_0000177
750 Ga0373927_0019415
751 Ga0373925_0072097
752 Ga0395899_0001483
753 Ga0395899_0013365
754 Ga0395899_0103433
755 Ga0395900_0056857
756 Ga0395898_0075975
757 Ga0395898_0245901
758 Ga0395905_0250671
759 Ga0395901_0008604
760 Ga0395901_0321686
761 Ga0436363_1309023
762 Ga0436362_0909728
763 Ga0439436_0004373
764 Ga0439438_024979
765 Ga0439439_0007543
766 Ga0439461_0000481
767 Ga0439466_0002744
768 Ga0439466_0041154
769 Ga0439433_0004374
770 Ga0439433_0041875
771 Ga0439441_009392
772 Ga0439442_001374
773 Ga0439442_002583
774 Ga0439449_0001865
775 Ga0439462_0016256
776 Ga0450920_000526
777 Ga0450920_003839
778 Ga0450920_012382
779 Ga0450907_000584
780 Ga0450910_001694
781 Ga0439434_0009163
782 Ga0439434_0016708
783 Ga0439435_0001815
784 Ga0450918_001097
785 Ga0466963_0022653
786 Ga0451576_0009298
787 Ga0451576_0020809
788 Ga0451576_0047301
789 Ga0466967_0109340
790 Ga0495653_0009296
791 Ga0495580_0008764
792 Ga0495582_0019386
793 Ga0495639_0014771
794 Ga0495639_0028944
795 Ga0495662_0002526
796 Ga0495594_0064603
797 Ga0495630_0016327
798 Ga0495631_0030681
799 Ga0495643_0071739
800 Ga0495666_0007281
801 Ga0495642_0055796
802 Ga0495654_0079682
803 Ga0495665_0000983
804 Ga0495665_0069990
805 Ga0495586_0004594
806 Ga0495586_0018559
807 Ga0495586_0033812
808 Ga0495586_0052936
809 Ga0495587_0001116
810 Ga0495598_0008773
811 Ga0495633_0046004
812 Ga0495667_0002674
813 Ga0495656_0004238
814 Ga0495635_0053108
815 Ga0495659_0010181
816 Ga0495588_0017710
817 Ga0495588_0040433
818 Ga0495588_0099094
819 Ga0495657_0061571
820 Ga0495623_0023875
821 Ga0495647_0001798
822 Ga0495658_0025915
823 Ga0495613_0216083
824 Ga0495670_0000338
825 Ga0495670_0062159
826 Ga0495670_0067613
827 Ga0495600_0128663
828 Ga0495600_0171866
829 Ga0495581_0002780
830 Ga0495604_0087319
831 Ga0495636_0005293
832 Ga0495636_0030359
833 Ga0495680_0007190
834 Ga0495675_0012523
835 Ga0495681_0037248
836 Ga0495684_0055510
837 Ga0495593_0009654
838 Ga0496100_0003367
839 Ga0496102_0077871
840 Ga0496102_0083209
841 Ga0496102_0537528
842 Ga0496103_0010898
843 Ga0496103_0017766
844 Ga0496103_0160284
845 Ga0496104_0008368
846 Ga0496104_0080987
847 Ga0496105_0002859
848 Ga0496106_0004267
849 Ga0496106_0010677
850 Ga0496107_0000513
851 Ga0496107_0028931
852 Ga0496107_0048708
853 Ga0496107_0136431
854 Ga0496108_0000674
855 Ga0496108_0196963
856 Ga0496109_0015359
857 Ga0496109_0118589
858 Ga0496110_0006729
859 Ga0496110_0072716
860 Ga0496110_0340159
861 Ga0496111_0049095
862 Ga0496112_0047202
863 Ga0496112_0369677
864 Ga0496113_0259648
865 Ga0501031_0074093
866 Ga0501032_0007511
867 Ga0501032_0033530
868 Ga0501034_0001687
869 Ga0501036_0182535
870 Ga0501037_0005772
871 Ga0501037_0016066
872 Ga0501037_0170685
873 Ga0501037_0207075
874 Ga0501038_0005777
875 Ga0501038_0012593
876 Ga0501038_0022914
877 Ga0501039_0006182
878 Ga0501039_0022288
879 Ga0501039_0031851
880 Ga0501040_0014901
881 Ga0501040_0051796
882 Ga0501041_0016627
883 Ga0501041_0022257
884 Ga0501041_0090146
885 Ga0501041_0125289
886 Ga0501042_0011314
887 Ga0501043_0080907
888 Ga0501046_0035200
889 Ga0501070_0076389
890 Ga0501070_0088447
891 Ga0501071_0159674
892 Ga0501072_0000720
893 Ga0501072_0022288
894 Ga0501072_0104297
895 Ga0501073_0011928
896 Ga0501074_0098925
897 Ga0501075_0016542
898 Ga0501075_0060226
899 Ga0501075_0149405
900 Ga0501075_0195336
901 Ga0501076_0003881
902 Ga0501076_0014654
903 Ga0501077_0021673
904 Ga0501077_0024362
905 Ga0501079_0006150
906 Ga0501079_0018197
907 Ga0501080_0022576
908 Ga0501080_0030502
909 Ga0501081_0026187
910 Ga0501081_0141851
911 Ga0501279_002083
912 Ga0501045_0010278
913 Ga0501045_0097276
914 nmdc:mga05p37_105338_c1
915 nmdc:mga05p37_10710_c1
916 nmdc:mga05p37_382184_c1
917 nmdc:mga05p37_775_c1
918 nmdc:mga09592_148_c1
919 nmdc:mga0qj67_315226_c1
920 nmdc:mga0qj67_48546_c1
921 nmdc:mga0qj67_740_c1
922 nmdc:mga06r32_2241_c1
923 nmdc:mga08y16_27884_c1
924 nmdc:mga08y16_6707_c1
925 nmdc:mga0n895_258674_c1
926 nmdc:mga0n895_26762_c1
927 nmdc:mga0n895_37609_c1
928 nmdc:mga0n895_39167_c1
929 nmdc:mga0n895_42377_c1
930 nmdc:mga0n895_924_c1
931 nmdc:mga0rr50_118081_c1
932 nmdc:mga0rr50_13072_c1
933 nmdc:mga0rr50_1686_c1
934 nmdc:mga0rr50_31547_c1
935 nmdc:mga0rr50_31752_c1
936 nmdc:mga08x19_22448_c1
937 nmdc:mga08x19_834_c1
938 nmdc:mga0a205_10857_c1
939 nmdc:mga0a205_121786_c1
940 nmdc:mga0a205_236717_c1
941 nmdc:mga0a205_268935_c1
942 nmdc:mga0a205_28573_c1
943 nmdc:mga0a205_45087_c1
944 nmdc:mga0a205_72547_c1
945 nmdc:mga0a205_821_c1
946 Ga0495595_0044077
947 Ga0501084_0095082
948 Ga0501084_0126519
949 Ga0501084_0236428
950 Ga0501082_0015226
951 Ga0501082_0040627
952 Ga0501082_0422247
953 Ga0530510_0000042
954 Ga0530510_0014848
955 Ga0530510_0195608
956 2691511806
957 2808829001
958 2808850224
959 2808877223
960 2808893238
961 2808898681
962 2812319264
963 2857744841
964 2904499135
965 2904780616
966 2910811363
967 2919039114
968 2919060884
969 2919395637
970 2919541309
971 2932430188
972 2939602395
973 2939651255
974 2939678941
975 2945917017
976 2945945493
977 2945956198
978 2946041584
979 2946060847
980 2954002782
981 2974305020
982 8054112029

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00174

Oxidored_molyb

Oxidoreductase molybdopterin binding domain

96

268

0.96

PF03404

Mo-co_dimer

Mo-co oxidoreductase dimerisation domain

286

405

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ca4-assembly1.cif.gz_A sulfite dehydrogenase from starkeya novella mutant 0.9199 73 405
2ca3-assembly1.cif.gz_A sulfite dehydrogenase from starkeya novella r55m mutant 0.9183 73 405
2c9x-assembly1.cif.gz_A sulfite dehydrogenase from starkeya novella y236f mutant 0.9181 73 405
2bpb-assembly1.cif.gz_A sulfite dehydrogenase from starkeya novella 0.9095 73 405
3r18-assembly1.cif.gz_A-2 chicken sulfite oxidase double mutant with altered activity and substrate affinity 0.8968 73 405
ID Description Score Start End Superfamily
af_I1N786_1_262_3.90.420.10 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.9403 73 274 3.90.420.10
2ca4A01 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.9266 73 279 3.90.420.10
af_P11035_116_359_3.90.420.10 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.9197 72 282 3.90.420.10
af_Q54XJ8_10_262_3.90.420.10 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.9188 73 281 3.90.420.10
2biiB01 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.9122 71 276 3.90.420.10
ID Description Score Start End GO Terms
AF-A0A538J6U1-F1-model_v4 Sulfite oxidase 0.9786 76 405 GO:0006790
GO:0008482
GO:0020037
GO:0030151
GO:0043546
AF-A0A7W1HPM1-F1-model_v4 Sulfite oxidase 0.9715 85 405 GO:0006790
GO:0008482
GO:0020037
GO:0030151
GO:0043546
AF-A0A536LKC0-F1-model_v4 Sulfite oxidase 0.9697 76 268 GO:0006790
GO:0008482
GO:0020037
GO:0043546
AF-A0A538J6U1-F1-model_v4 Sulfite oxidase 0.9586 76 405 GO:0006790
GO:0008482
GO:0020037
GO:0030151
GO:0043546
AF-A0A1W2C1P1-F1-model_v4 Oxidoreductase molybdopterin binding domain-containing protein 0.9553 163 271 GO:0006790
GO:0008482
GO:0020037
GO:0043546

Map