F454036
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 491 | 295 | 982 | 353 |
Family's Representative Sequence
| Representative Sequence | 3300000549|LJQas_1000586|LJQas_10005867 |
| Length | 405 |
| Sequence | LTASWTRRRPVSRGNRPKPGWSEQNGTVMPEQMSQHTSVFSGQRRQTQKLRAHPGEPSHGPLTAEELQLAVRNHSMPLEALRSDITPPGLHYLLTHFDIPFIDADHWHLRIGGAVQRSLELSLRALRRAPSISVPVTLECGGNGRSLLRPRPLSQPWMLEGVGTATWTGVPLAYLLAQARVDDDAVEVVFTGADTGIQGGVRQQYARSLPIAEALRPDVVLAYRMNDSDLPPQHGYPLRLVVPGWYGMASVKWLSSVKVVTKPFDGFQQSVAYRYQQDADDAGTPVTWIKVRSLMIPPGVPDFFTRRRILPAGPVMLRGRAWSGEGAVQRVDVGIDGKWAPAHLEHPAAPFAWCAWTIPWVADPGEHELSCRATDASGAVQPLEPVWNYQGVGNNVVQRVKVSVE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 2 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 3 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 6 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 8 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 10 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 12 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 25 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 38 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 39 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 41 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 42 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 43 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 44 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 45 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 46 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 47 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 49 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 50 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 53 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 54 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 55 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 56 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 57 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 58 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 59 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 60 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 61 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 63 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 84 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 120 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 123 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 124 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 125 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 126 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 127 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 128 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 129 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 130 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 131 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 132 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 133 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 134 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 135 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 136 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 137 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 138 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 139 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 140 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 141 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 142 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 143 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 144 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 145 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 146 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 147 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 148 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 149 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 150 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 151 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 152 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 153 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 154 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 155 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 156 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 157 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 158 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 159 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 160 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 161 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 162 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 163 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 164 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 165 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 166 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 167 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 168 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 169 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 170 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 171 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 172 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 173 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 174 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 175 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 176 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 177 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 178 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 179 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 180 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 181 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 219 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 220 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 221 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 222 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 223 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 224 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 225 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 226 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 227 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 228 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 229 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 230 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 231 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 232 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 233 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 234 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 235 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 236 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 237 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 238 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 239 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 240 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 241 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 242 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 243 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 244 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 245 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 246 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 247 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 248 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 249 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 250 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 251 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 252 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 253 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 254 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 255 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 256 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 257 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 258 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 259 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 260 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 261 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 262 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 263 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 264 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 265 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 267 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 268 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 269 | 2690315906 | Arthrobacter sp. OY3WO11 | Isolate | Unclassified |
| 270 | 2808606357 | Arthrobacter sp. SLBN-122 | Isolate | Unclassified |
| 271 | 2808606360 | Arthrobacter sp. SLBN-112 | Isolate | Unclassified |
| 272 | 2808606366 | Arthrobacter sp. SLBN-83 | Isolate | Unclassified |
| 273 | 2808606370 | Arthrobacter sp. SLBN-100 | Isolate | Unclassified |
| 274 | 2808606371 | Arthrobacter sp. SLBN-53 | Isolate | Unclassified |
| 275 | 2811994871 | Arthrobacter sp. SLBN-179 | Isolate | Unclassified |
| 276 | 2857740372 | Paenarthrobacter sp. R-74611 | Isolate | Unclassified |
| 277 | 2904497146 | Arthrobacter sp. 1276 | Isolate | Rhizosphere |
| 278 | 2904776348 | Paenarthrobacter sp. 1092 | Isolate | Rhizosphere |
| 279 | 2910809715 | Paenarthrobacter sp. CM16 | Isolate | Unclassified |
| 280 | 2919034639 | Paenarthrobacter nitroguajacolicus 247 | Isolate | Rhizosphere |
| 281 | 2919059106 | Arthrobacter sp. 1088 | Isolate | Rhizosphere |
| 282 | 2919391150 | Arthrobacter ipis 2973 | Isolate | Unclassified |
| 283 | 2919538618 | Paenarthrobacter nitroguajacolicus 3945 | Isolate | Unclassified |
| 284 | 2932426870 | Paenarthrobacter sp. 4246 | Isolate | Rhizosphere |
| 285 | 2939598168 | Arthrobacter sp. 754 | Isolate | Rhizosphere |
| 286 | 2939647034 | Arthrobacter sp. 2762 | Isolate | Rhizosphere |
| 287 | 2939674588 | Arthrobacter bambusae 3552 | Isolate | Rhizosphere |
| 288 | 2945916053 | Arthrobacter ulcerisalmonis W1I2 | Isolate | Rhizosphere |
| 289 | 2945941187 | Arthrobacter pascens W1I14 | Isolate | Rhizosphere |
| 290 | 2945956166 | Arthrobacter globiformus W2I3 | Isolate | Rhizosphere |
| 291 | 2946037020 | Arthrobacter sp. W4I7 | Isolate | Rhizosphere |
| 292 | 2946059875 | Arthrobacter sp. SLBN-112 | Isolate | Rhizosphere |
| 293 | 2953998280 | Pseudarthrobacter sp. W1I19 | Isolate | Rhizosphere |
| 294 | 2974302888 | Pseudarthrobacter sp. SORGH_AS 212 | Isolate | Unclassified |
| 295 | 8054107350 | Arthrobacter rhizosphaerae CCNWLXL 1-35 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.5 |
| Metatranscriptomes | 0 |
| Isolates | 5.5 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.41 |
| Nodule | 0 |
| Rhizoplane | 5.5 |
| Rhizosphere | 91.04 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.61 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJQas_1000586 | 3300000549 | Bacteria | 5913 |
| 2 | rootH2_10130506 | 3300003320 | Bacteria | 2095 |
| 3 | rootH2_10144228 | 3300003320 | Bacteria | 2523 |
| 4 | Ga0070670_100024368 | 3300005331 | Bacteria | 5203 |
| 5 | Ga0070677_10026182 | 3300005333 | Bacteria | 2184 |
| 6 | Ga0068869_100005227 | 3300005334 | Bacteria | 8153 |
| 7 | Ga0070666_10048583 | 3300005335 | Bacteria | 2851 |
| 8 | Ga0070680_100001936 | 3300005336 | Bacteria | 15218 |
| 9 | Ga0070682_100001084 | 3300005337 | Bacteria | 15675 |
| 10 | Ga0068868_100003103 | 3300005338 | Bacteria | 11561 |
| 11 | Ga0070689_100000317 | 3300005340 | Bacteria | 28150 |
| 12 | Ga0070689_100124432 | 3300005340 | Bacteria | 2062 |
| 13 | Ga0070691_10000355 | 3300005341 | Bacteria | 16420 |
| 14 | Ga0070687_100000251 | 3300005343 | Bacteria | 18294 |
| 15 | Ga0070692_10019493 | 3300005345 | Bacteria | 3273 |
| 16 | Ga0070675_100157289 | 3300005354 | Bacteria | 1952 |
| 17 | Ga0070671_100269501 | 3300005355 | Bacteria | 1447 |
| 18 | Ga0070667_100097731 | 3300005367 | Bacteria | 2533 |
| 19 | Ga0070703_10012155 | 3300005406 | Bacteria | 2438 |
| 20 | Ga0070701_10000853 | 3300005438 | Bacteria | 10941 |
| 21 | Ga0070705_100000115 | 3300005440 | Bacteria | 45886 |
| 22 | Ga0070700_100000903 | 3300005441 | Bacteria | 14651 |
| 23 | Ga0070694_100000066 | 3300005444 | Bacteria | 49292 |
| 24 | Ga0070694_100064230 | 3300005444 | Bacteria | 2512 |
| 25 | Ga0070694_100160928 | 3300005444 | Bacteria | 1647 |
| 26 | Ga0070708_100002210 | 3300005445 | Bacteria | 15041 |
| 27 | Ga0070708_100008673 | 3300005445 | Bacteria | 8169 |
| 28 | Ga0070708_100032831 | 3300005445 | Bacteria | 4505 |
| 29 | Ga0070708_100278160 | 3300005445 | Bacteria | 1575 |
| 30 | Ga0070678_100056995 | 3300005456 | Bacteria | 2860 |
| 31 | Ga0068867_100000422 | 3300005459 | Bacteria | 28308 |
| 32 | Ga0070706_100000036 | 3300005467 | Bacteria | 151766 |
| 33 | Ga0070706_100040024 | 3300005467 | Bacteria | 4327 |
| 34 | Ga0070706_100085561 | 3300005467 | Bacteria | 2922 |
| 35 | Ga0070707_100008469 | 3300005468 | Bacteria | 9553 |
| 36 | Ga0070707_100027499 | 3300005468 | Bacteria | 5411 |
| 37 | Ga0070707_100093590 | 3300005468 | Bacteria | 2909 |
| 38 | Ga0070707_100402173 | 3300005468 | Bacteria | 1329 |
| 39 | Ga0070707_100423806 | 3300005468 | Bacteria | 1291 |
| 40 | Ga0070698_100000198 | 3300005471 | Bacteria | 57734 |
| 41 | Ga0070698_100038027 | 3300005471 | Bacteria | 4960 |
| 42 | Ga0070699_100000052 | 3300005518 | Bacteria | 111597 |
| 43 | Ga0070679_100041110 | 3300005530 | Bacteria | 4603 |
| 44 | Ga0070697_100008358 | 3300005536 | Bacteria | 8076 |
| 45 | Ga0070697_100008599 | 3300005536 | Bacteria | 7971 |
| 46 | Ga0070697_100011227 | 3300005536 | Bacteria | 7001 |
| 47 | Ga0070697_100017456 | 3300005536 | Bacteria | 5647 |
| 48 | Ga0070697_100084088 | 3300005536 | Bacteria | 2624 |
| 49 | Ga0070697_100179746 | 3300005536 | Bacteria | 1793 |
| 50 | Ga0070672_100101753 | 3300005543 | Bacteria | 2331 |
| 51 | Ga0070686_100000167 | 3300005544 | Bacteria | 45886 |
| 52 | Ga0070695_100000164 | 3300005545 | Bacteria | 31583 |
| 53 | Ga0070695_100007139 | 3300005545 | Bacteria | 6622 |
| 54 | Ga0070695_100078205 | 3300005545 | Bacteria | 2181 |
| 55 | Ga0070696_100000739 | 3300005546 | Bacteria | 20870 |
| 56 | Ga0070696_100000933 | 3300005546 | Bacteria | 18945 |
| 57 | Ga0070693_100000323 | 3300005547 | Bacteria | 22003 |
| 58 | Ga0070704_100000093 | 3300005549 | Bacteria | 30795 |
| 59 | Ga0068855_100005066 | 3300005563 | Bacteria | 16071 |
| 60 | Ga0068854_100025736 | 3300005578 | Bacteria | 4037 |
| 61 | Ga0070702_100003437 | 3300005615 | Bacteria | 7084 |
| 62 | Ga0068859_100013618 | 3300005617 | Bacteria | 8153 |
| 63 | Ga0068859_100070993 | 3300005617 | Bacteria | 3518 |
| 64 | Ga0068864_100011897 | 3300005618 | Bacteria | 7185 |
| 65 | Ga0068858_100005171 | 3300005842 | Bacteria | 12778 |
| 66 | Ga0068860_100003453 | 3300005843 | Bacteria | 16255 |
| 67 | Ga0068862_100001425 | 3300005844 | Bacteria | 22156 |
| 68 | Ga0081455_10042572 | 3300005937 | Bacteria | 3981 |
| 69 | Ga0081538_10005326 | 3300005981 | Bacteria | 11582 |
| 70 | Ga0070717_10000105 | 3300006028 | Bacteria | 66343 |
| 71 | Ga0070717_10042070 | 3300006028 | Bacteria | 3727 |
| 72 | Ga0075365_10008218 | 3300006038 | Bacteria | 5905 |
| 73 | Ga0075432_10018835 | 3300006058 | Bacteria | 2356 |
| 74 | Ga0070716_100034944 | 3300006173 | Bacteria | 2760 |
| 75 | Ga0097621_100003699 | 3300006237 | Bacteria | 10581 |
| 76 | Ga0068871_100000965 | 3300006358 | Bacteria | 19218 |
| 77 | Ga0075428_100000502 | 3300006844 | Bacteria | 39707 |
| 78 | Ga0075428_100071259 | 3300006844 | Bacteria | 3799 |
| 79 | Ga0075428_100141150 | 3300006844 | Bacteria | 2619 |
| 80 | Ga0075428_100336606 | 3300006844 | Bacteria | 1621 |
| 81 | Ga0075430_100000620 | 3300006846 | Bacteria | 27115 |
| 82 | Ga0075430_100008701 | 3300006846 | Bacteria | 8565 |
| 83 | Ga0075430_100053261 | 3300006846 | Bacteria | 3407 |
| 84 | Ga0075431_100007715 | 3300006847 | Bacteria | 10716 |
| 85 | Ga0075431_100220054 | 3300006847 | Bacteria | 1937 |
| 86 | Ga0075433_10000611 | 3300006852 | Bacteria | 23830 |
| 87 | Ga0075433_10008931 | 3300006852 | Bacteria | 8001 |
| 88 | Ga0075433_10015296 | 3300006852 | Bacteria | 6288 |
| 89 | Ga0075433_10068436 | 3300006852 | Bacteria | 3117 |
| 90 | Ga0075433_10248490 | 3300006852 | Bacteria | 1578 |
| 91 | Ga0075433_10343031 | 3300006852 | Bacteria | 1320 |
| 92 | Ga0075434_100000406 | 3300006871 | Bacteria | 31740 |
| 93 | Ga0075434_100000420 | 3300006871 | Bacteria | 31423 |
| 94 | Ga0075434_100001960 | 3300006871 | Bacteria | 17843 |
| 95 | Ga0075434_100004191 | 3300006871 | Bacteria | 12920 |
| 96 | Ga0075434_100037772 | 3300006871 | Bacteria | 4781 |
| 97 | Ga0075434_100154967 | 3300006871 | Bacteria | 2311 |
| 98 | Ga0075434_100156318 | 3300006871 | Unclassified | 2299 |
| 99 | Ga0075429_100006458 | 3300006880 | Bacteria | 10155 |
| 100 | Ga0068865_100000043 | 3300006881 | Bacteria | 70962 |
| 101 | Ga0075436_100000513 | 3300006914 | Bacteria | 25110 |
| 102 | Ga0075436_100251135 | 3300006914 | Bacteria | 1259 |
| 103 | Ga0097620_100013618 | 3300006931 | Bacteria | 8153 |
| 104 | Ga0097620_100070993 | 3300006931 | Bacteria | 3518 |
| 105 | Ga0075435_100000668 | 3300007076 | Bacteria | 21181 |
| 106 | Ga0075435_100022097 | 3300007076 | Bacteria | 4905 |
| 107 | Ga0075435_100023865 | 3300007076 | Bacteria | 4738 |
| 108 | Ga0075435_100025101 | 3300007076 | Bacteria | 4636 |
| 109 | Ga0075435_100059147 | 3300007076 | Bacteria | 3106 |
| 110 | Ga0075435_100088147 | 3300007076 | Bacteria | 2557 |
| 111 | Ga0105251_10057927 | 3300009011 | Bacteria | 1830 |
| 112 | Ga0105244_10011440 | 3300009036 | Bacteria | 5321 |
| 113 | Ga0111539_10025953 | 3300009094 | Bacteria | 7173 |
| 114 | Ga0111539_10033795 | 3300009094 | Bacteria | 6206 |
| 115 | Ga0105245_10002730 | 3300009098 | Bacteria | 15887 |
| 116 | Ga0105245_10021533 | 3300009098 | Bacteria | 5657 |
| 117 | Ga0114129_10000393 | 3300009147 | Bacteria | 51077 |
| 118 | Ga0114129_10017768 | 3300009147 | Bacteria | 10127 |
| 119 | Ga0114129_10101226 | 3300009147 | Bacteria | 3987 |
| 120 | Ga0114129_10102635 | 3300009147 | Bacteria | 3955 |
| 121 | Ga0114129_10666112 | 3300009147 | Bacteria | 1341 |
| 122 | Ga0105243_10002483 | 3300009148 | Bacteria | 15383 |
| 123 | Ga0105243_10066999 | 3300009148 | Bacteria | 2889 |
| 124 | Ga0105243_10086908 | 3300009148 | Bacteria | 2565 |
| 125 | Ga0105241_10060798 | 3300009174 | Bacteria | 2907 |
| 126 | Ga0105242_10000296 | 3300009176 | Bacteria | 39554 |
| 127 | Ga0105248_10058291 | 3300009177 | Bacteria | 4337 |
| 128 | Ga0105248_10155338 | 3300009177 | Bacteria | 2582 |
| 129 | Ga0105249_10013242 | 3300009553 | Bacteria | 7279 |
| 130 | Ga0105239_10100776 | 3300010375 | Bacteria | 3195 |
| 131 | Ga0105246_10012860 | 3300011119 | Bacteria | 5234 |
| 132 | Ga0105246_10013182 | 3300011119 | Bacteria | 5176 |
| 133 | Ga0157371_10042930 | 3300013102 | Bacteria | 3222 |
| 134 | Ga0157369_10118773 | 3300013105 | Bacteria | 2806 |
| 135 | Ga0157369_10151684 | 3300013105 | Bacteria | 2449 |
| 136 | Ga0157378_10000140 | 3300013297 | Bacteria | 67335 |
| 137 | Ga0157378_10065443 | 3300013297 | Bacteria | 3254 |
| 138 | Ga0163162_10034362 | 3300013306 | Bacteria | 5046 |
| 139 | Ga0157375_10148212 | 3300013308 | Bacteria | 2479 |
| 140 | Ga0163163_10092245 | 3300014325 | Bacteria | 3043 |
| 141 | Ga0163163_10167940 | 3300014325 | Bacteria | 2240 |
| 142 | Ga0157379_10136603 | 3300014968 | Bacteria | 2209 |
| 143 | Ga0157376_10001393 | 3300014969 | Bacteria | 15896 |
| 144 | Ga0209051_1008918 | 3300025303 | Bacteria | 5239 |
| 145 | Ga0207697_10001206 | 3300025315 | Bacteria | 14167 |
| 146 | Ga0207697_10006018 | 3300025315 | Bacteria | 5551 |
| 147 | Ga0207655_1013460 | 3300025728 | Bacteria | 4696 |
| 148 | Ga0207655_1036831 | 3300025728 | Bacteria | 2164 |
| 149 | Ga0207655_1040046 | 3300025728 | Bacteria | 2028 |
| 150 | Ga0207653_10004260 | 3300025885 | Bacteria | 4494 |
| 151 | Ga0207682_10000126 | 3300025893 | Bacteria | 34447 |
| 152 | Ga0207642_10002243 | 3300025899 | Bacteria | 6005 |
| 153 | Ga0207680_10104690 | 3300025903 | Bacteria | 1824 |
| 154 | Ga0207645_10008636 | 3300025907 | Bacteria | 7094 |
| 155 | Ga0207643_10077588 | 3300025908 | Bacteria | 1921 |
| 156 | Ga0207684_10000020 | 3300025910 | Bacteria | 342787 |
| 157 | Ga0207684_10000441 | 3300025910 | Bacteria | 55041 |
| 158 | Ga0207684_10007210 | 3300025910 | Bacteria | 10047 |
| 159 | Ga0207684_10017186 | 3300025910 | Bacteria | 6207 |
| 160 | Ga0207662_10000024 | 3300025918 | Bacteria | 70677 |
| 161 | Ga0207652_10029903 | 3300025921 | Bacteria | 4559 |
| 162 | Ga0207646_10001140 | 3300025922 | Bacteria | 33868 |
| 163 | Ga0207646_10002272 | 3300025922 | Bacteria | 22859 |
| 164 | Ga0207646_10003775 | 3300025922 | Bacteria | 16875 |
| 165 | Ga0207646_10034128 | 3300025922 | Bacteria | 4598 |
| 166 | Ga0207650_10004213 | 3300025925 | Bacteria | 9820 |
| 167 | Ga0207659_10014866 | 3300025926 | Bacteria | 5030 |
| 168 | Ga0207687_10026914 | 3300025927 | Bacteria | 3854 |
| 169 | Ga0207700_10165307 | 3300025928 | Bacteria | 1841 |
| 170 | Ga0207686_10001122 | 3300025934 | Bacteria | 15496 |
| 171 | Ga0207709_10006556 | 3300025935 | Bacteria | 6536 |
| 172 | Ga0207670_10080441 | 3300025936 | Bacteria | 2278 |
| 173 | Ga0207704_10058283 | 3300025938 | Bacteria | 2377 |
| 174 | Ga0207665_10028280 | 3300025939 | Bacteria | 3703 |
| 175 | Ga0207691_10115023 | 3300025940 | Bacteria | 2389 |
| 176 | Ga0207711_10281591 | 3300025941 | Bacteria | 1531 |
| 177 | Ga0207689_10000162 | 3300025942 | Bacteria | 57621 |
| 178 | Ga0207689_10019504 | 3300025942 | Bacteria | 5715 |
| 179 | Ga0207667_10005789 | 3300025949 | Bacteria | 15080 |
| 180 | Ga0207651_10012861 | 3300025960 | Bacteria | 4758 |
| 181 | Ga0207651_10171775 | 3300025960 | Bacteria | 1710 |
| 182 | Ga0207640_10018355 | 3300025981 | Bacteria | 4110 |
| 183 | Ga0207677_10000875 | 3300026023 | Bacteria | 17082 |
| 184 | Ga0207703_10029263 | 3300026035 | Bacteria | 4345 |
| 185 | Ga0207708_10001467 | 3300026075 | Bacteria | 17645 |
| 186 | Ga0207702_10127613 | 3300026078 | Bacteria | 2286 |
| 187 | Ga0207702_10374748 | 3300026078 | Bacteria | 1367 |
| 188 | Ga0207648_10000147 | 3300026089 | Bacteria | 70420 |
| 189 | Ga0207676_10094070 | 3300026095 | Bacteria | 2469 |
| 190 | Ga0207676_10194056 | 3300026095 | Bacteria | 1789 |
| 191 | Ga0207675_100000104 | 3300026118 | Bacteria | 67261 |
| 192 | Ga0207675_100005042 | 3300026118 | Bacteria | 12711 |
| 193 | Ga0207683_10003489 | 3300026121 | Bacteria | 13724 |
| 194 | Ga0207428_10000591 | 3300027907 | Bacteria | 42796 |
| 195 | Ga0207428_10009302 | 3300027907 | Bacteria | 8817 |
| 196 | Ga0207428_10019358 | 3300027907 | Bacteria | 5805 |
| 197 | Ga0268265_10000875 | 3300028380 | Bacteria | 28237 |
| 198 | Ga0268264_10000841 | 3300028381 | Bacteria | 32855 |
| 199 | Ga0265319_1003152 | 3300028563 | Bacteria | 8687 |
| 200 | Ga0265334_10016102 | 3300028573 | Bacteria | 3095 |
| 201 | Ga0265324_10042953 | 3300029957 | Bacteria | 1561 |
| 202 | Ga0265320_10011874 | 3300031240 | Bacteria | 5103 |
| 203 | Ga0265340_10015242 | 3300031247 | Bacteria | 3998 |
| 204 | Ga0265316_10011245 | 3300031344 | Bacteria | 8093 |
| 205 | Ga0307408_100021476 | 3300031548 | Bacteria | 4368 |
| 206 | Ga0307408_100039793 | 3300031548 | Bacteria | 3326 |
| 207 | Ga0307408_100170101 | 3300031548 | Bacteria | 1739 |
| 208 | Ga0265314_10045828 | 3300031711 | Bacteria | 3089 |
| 209 | Ga0307405_10008040 | 3300031731 | Bacteria | 5320 |
| 210 | Ga0307405_10013234 | 3300031731 | Bacteria | 4397 |
| 211 | Ga0307405_10014199 | 3300031731 | Bacteria | 4274 |
| 212 | Ga0307405_10120341 | 3300031731 | Bacteria | 1795 |
| 213 | Ga0307413_10038462 | 3300031824 | Bacteria | 2773 |
| 214 | Ga0307413_10041989 | 3300031824 | Bacteria | 2683 |
| 215 | Ga0307413_10068560 | 3300031824 | Bacteria | 2222 |
| 216 | Ga0307413_10119284 | 3300031824 | Bacteria | 1783 |
| 217 | Ga0307413_10151139 | 3300031824 | Bacteria | 1618 |
| 218 | Ga0307410_10033515 | 3300031852 | Bacteria | 3316 |
| 219 | Ga0307410_10045226 | 3300031852 | Bacteria | 2930 |
| 220 | Ga0307410_10056489 | 3300031852 | Bacteria | 2669 |
| 221 | Ga0307410_10115872 | 3300031852 | Bacteria | 1946 |
| 222 | Ga0307410_10137383 | 3300031852 | Bacteria | 1803 |
| 223 | Ga0307410_10151640 | 3300031852 | Bacteria | 1726 |
| 224 | Ga0307406_10026807 | 3300031901 | Bacteria | 3465 |
| 225 | Ga0307406_10034961 | 3300031901 | Bacteria | 3086 |
| 226 | Ga0307406_10046104 | 3300031901 | Bacteria | 2741 |
| 227 | Ga0307406_10234931 | 3300031901 | Bacteria | 1371 |
| 228 | Ga0307407_10016419 | 3300031903 | Bacteria | 3686 |
| 229 | Ga0307407_10043578 | 3300031903 | Bacteria | 2523 |
| 230 | Ga0307407_10076792 | 3300031903 | Bacteria | 2006 |
| 231 | Ga0307412_10048946 | 3300031911 | Bacteria | 2782 |
| 232 | Ga0307412_10069772 | 3300031911 | Bacteria | 2393 |
| 233 | Ga0307412_10087338 | 3300031911 | Bacteria | 2172 |
| 234 | Ga0307409_100038141 | 3300031995 | Bacteria | 3550 |
| 235 | Ga0307416_100005550 | 3300032002 | Bacteria | 7763 |
| 236 | Ga0307416_100162820 | 3300032002 | Bacteria | 2064 |
| 237 | Ga0307416_100218289 | 3300032002 | Bacteria | 1826 |
| 238 | Ga0307416_100249971 | 3300032002 | Bacteria | 1725 |
| 239 | Ga0307416_100255894 | 3300032002 | Bacteria | 1707 |
| 240 | Ga0307416_100294042 | 3300032002 | Bacteria | 1610 |
| 241 | Ga0307416_100335649 | 3300032002 | Bacteria | 1521 |
| 242 | Ga0307414_10192179 | 3300032004 | Bacteria | 1653 |
| 243 | Ga0307414_10264215 | 3300032004 | Bacteria | 1438 |
| 244 | Ga0307411_10029162 | 3300032005 | Bacteria | 3365 |
| 245 | Ga0307415_100068238 | 3300032126 | Bacteria | 2488 |
| 246 | Ga0307415_100378542 | 3300032126 | Bacteria | 1201 |
| 247 | Ga0373948_0004509 | 3300034817 | Bacteria | 2208 |
| 248 | Ga0373926_0000374 | 3300035083 | Bacteria | 11463 |
| 249 | Ga0373928_0001441 | 3300035084 | Bacteria | 4620 |
| 250 | Ga0373940_0008080 | 3300035088 | Bacteria | 2401 |
| 251 | Ga0373952_0003435 | 3300035092 | Bacteria | 2858 |
| 252 | Ga0373932_0002228 | 3300035112 | Bacteria | 4982 |
| 253 | Ga0373939_0000980 | 3300035114 | Bacteria | 7091 |
| 254 | Ga0373941_0040190 | 3300035115 | Bacteria | 1441 |
| 255 | Ga0373946_0057869 | 3300035171 | Unclassified | 1640 |
| 256 | Ga0373961_0022590 | 3300035241 | Bacteria | 1684 |
| 257 | Ga0373962_0003422 | 3300035242 | Bacteria | 3813 |
| 258 | Ga0373931_0000177 | 3300035691 | Bacteria | 27824 |
| 259 | Ga0373927_0019415 | 3300035695 | Bacteria | 4457 |
| 260 | Ga0373925_0072097 | 3300037068 | Bacteria | 2613 |
| 261 | Ga0395899_0001483 | 3300037312 | Bacteria | 19971 |
| 262 | Ga0395899_0013365 | 3300037312 | Bacteria | 6280 |
| 263 | Ga0395899_0103433 | 3300037312 | Bacteria | 2054 |
| 264 | Ga0395900_0056857 | 3300037418 | Bacteria | 4027 |
| 265 | Ga0395898_0075975 | 3300037466 | Bacteria | 3244 |
| 266 | Ga0395898_0245901 | 3300037466 | Bacteria | 1706 |
| 267 | Ga0395905_0250671 | 3300037471 | Bacteria | 1654 |
| 268 | Ga0395901_0008604 | 3300038443 | Bacteria | 10316 |
| 269 | Ga0395901_0321686 | 3300038443 | Bacteria | 1600 |
| 270 | Ga0436363_1309023 | 3300039450 | Bacteria | 2605 |
| 271 | Ga0436362_0909728 | 3300039453 | Bacteria | 1397 |
| 272 | Ga0439436_0004373 | 3300041404 | Bacteria | 4328 |
| 273 | Ga0439438_024979 | 3300041405 | Bacteria | 1632 |
| 274 | Ga0439439_0007543 | 3300041406 | Bacteria | 2548 |
| 275 | Ga0439461_0000481 | 3300041410 | Bacteria | 5761 |
| 276 | Ga0439466_0002744 | 3300041411 | Bacteria | 6893 |
| 277 | Ga0439466_0041154 | 3300041411 | Bacteria | 1543 |
| 278 | Ga0439433_0004374 | 3300041999 | Bacteria | 3046 |
| 279 | Ga0439433_0041875 | 3300041999 | Bacteria | 1067 |
| 280 | Ga0439441_009392 | 3300042001 | Bacteria | 1618 |
| 281 | Ga0439442_001374 | 3300042002 | Bacteria | 4817 |
| 282 | Ga0439442_002583 | 3300042002 | Bacteria | 3552 |
| 283 | Ga0439449_0001865 | 3300042007 | Bacteria | 8296 |
| 284 | Ga0439462_0016256 | 3300042015 | Bacteria | 1922 |
| 285 | Ga0450920_000526 | 3300042122 | Bacteria | 6042 |
| 286 | Ga0450920_003839 | 3300042122 | Bacteria | 2616 |
| 287 | Ga0450920_012382 | 3300042122 | Bacteria | 1600 |
| 288 | Ga0450907_000584 | 3300042146 | Bacteria | 9809 |
| 289 | Ga0450910_001694 | 3300042147 | Bacteria | 2827 |
| 290 | Ga0439434_0009163 | 3300042435 | Bacteria | 2910 |
| 291 | Ga0439434_0016708 | 3300042435 | Bacteria | 2193 |
| 292 | Ga0439435_0001815 | 3300042436 | Bacteria | 4072 |
| 293 | Ga0450918_001097 | 3300042531 | Bacteria | 5566 |
| 294 | Ga0466963_0022653 | 3300044694 | Bacteria | 3981 |
| 295 | Ga0451576_0009298 | 3300045051 | Bacteria | 11411 |
| 296 | Ga0451576_0020809 | 3300045051 | Bacteria | 7139 |
| 297 | Ga0451576_0047301 | 3300045051 | Bacteria | 4523 |
| 298 | Ga0466967_0109340 | 3300045976 | Bacteria | 2538 |
| 299 | Ga0495653_0009296 | 3300046463 | Bacteria | 8042 |
| 300 | Ga0495580_0008764 | 3300046472 | Bacteria | 8012 |
| 301 | Ga0495582_0019386 | 3300046473 | Bacteria | 3718 |
| 302 | Ga0495639_0014771 | 3300046475 | Bacteria | 3383 |
| 303 | Ga0495639_0028944 | 3300046475 | Bacteria | 2456 |
| 304 | Ga0495662_0002526 | 3300046476 | Bacteria | 9225 |
| 305 | Ga0495594_0064603 | 3300046499 | Bacteria | 2029 |
| 306 | Ga0495630_0016327 | 3300046517 | Bacteria | 5424 |
| 307 | Ga0495631_0030681 | 3300046518 | Bacteria | 2437 |
| 308 | Ga0495643_0071739 | 3300046522 | Bacteria | 1817 |
| 309 | Ga0495666_0007281 | 3300046526 | Bacteria | 5552 |
| 310 | Ga0495642_0055796 | 3300046528 | Bacteria | 1631 |
| 311 | Ga0495654_0079682 | 3300046530 | Bacteria | 1538 |
| 312 | Ga0495665_0000983 | 3300046531 | Bacteria | 15128 |
| 313 | Ga0495665_0069990 | 3300046531 | Bacteria | 1849 |
| 314 | Ga0495586_0004594 | 3300046535 | Bacteria | 7380 |
| 315 | Ga0495586_0018559 | 3300046535 | Bacteria | 3704 |
| 316 | Ga0495586_0033812 | 3300046535 | Bacteria | 2744 |
| 317 | Ga0495586_0052936 | 3300046535 | Bacteria | 2198 |
| 318 | Ga0495587_0001116 | 3300046536 | Bacteria | 17582 |
| 319 | Ga0495598_0008773 | 3300046537 | Bacteria | 2365 |
| 320 | Ga0495633_0046004 | 3300046558 | Bacteria | 2065 |
| 321 | Ga0495667_0002674 | 3300046559 | Bacteria | 11911 |
| 322 | Ga0495656_0004238 | 3300046615 | Bacteria | 4895 |
| 323 | Ga0495635_0053108 | 3300046663 | Bacteria | 2792 |
| 324 | Ga0495659_0010181 | 3300046664 | Bacteria | 3013 |
| 325 | Ga0495588_0017710 | 3300046674 | Bacteria | 3464 |
| 326 | Ga0495588_0040433 | 3300046674 | Bacteria | 2378 |
| 327 | Ga0495588_0099094 | 3300046674 | Bacteria | 1530 |
| 328 | Ga0495657_0061571 | 3300046675 | Bacteria | 2482 |
| 329 | Ga0495623_0023875 | 3300046679 | Bacteria | 3945 |
| 330 | Ga0495647_0001798 | 3300046681 | Bacteria | 6626 |
| 331 | Ga0495658_0025915 | 3300046683 | Bacteria | 3138 |
| 332 | Ga0495613_0216083 | 3300046689 | Bacteria | 1347 |
| 333 | Ga0495670_0000338 | 3300046691 | Bacteria | 22344 |
| 334 | Ga0495670_0062159 | 3300046691 | Bacteria | 1878 |
| 335 | Ga0495670_0067613 | 3300046691 | Bacteria | 1804 |
| 336 | Ga0495600_0128663 | 3300046809 | Bacteria | 1646 |
| 337 | Ga0495600_0171866 | 3300046809 | Bacteria | 1398 |
| 338 | Ga0495581_0002780 | 3300047315 | Bacteria | 9976 |
| 339 | Ga0495604_0087319 | 3300047317 | Bacteria | 2323 |
| 340 | Ga0495636_0005293 | 3300047318 | Bacteria | 5067 |
| 341 | Ga0495636_0030359 | 3300047318 | Bacteria | 2210 |
| 342 | Ga0495680_0007190 | 3300047322 | Bacteria | 10255 |
| 343 | Ga0495675_0012523 | 3300047444 | Bacteria | 5339 |
| 344 | Ga0495681_0037248 | 3300047470 | Bacteria | 2398 |
| 345 | Ga0495684_0055510 | 3300047471 | Bacteria | 3021 |
| 346 | Ga0495593_0009654 | 3300047673 | Bacteria | 5600 |
| 347 | Ga0496100_0003367 | 3300048903 | Bacteria | 8324 |
| 348 | Ga0496102_0077871 | 3300048905 | Bacteria | 3051 |
| 349 | Ga0496102_0083209 | 3300048905 | Bacteria | 2952 |
| 350 | Ga0496102_0537528 | 3300048905 | Bacteria | 1091 |
| 351 | Ga0496103_0010898 | 3300048906 | Bacteria | 5380 |
| 352 | Ga0496103_0017766 | 3300048906 | Bacteria | 4260 |
| 353 | Ga0496103_0160284 | 3300048906 | Bacteria | 1443 |
| 354 | Ga0496104_0008368 | 3300048907 | Bacteria | 9193 |
| 355 | Ga0496104_0080987 | 3300048907 | Bacteria | 3095 |
| 356 | Ga0496105_0002859 | 3300048908 | Bacteria | 12642 |
| 357 | Ga0496106_0004267 | 3300048909 | Bacteria | 10633 |
| 358 | Ga0496106_0010677 | 3300048909 | Bacteria | 6787 |
| 359 | Ga0496107_0000513 | 3300048910 | Bacteria | 21539 |
| 360 | Ga0496107_0028931 | 3300048910 | Bacteria | 3940 |
| 361 | Ga0496107_0048708 | 3300048910 | Bacteria | 3054 |
| 362 | Ga0496107_0136431 | 3300048910 | Bacteria | 1812 |
| 363 | Ga0496108_0000674 | 3300048911 | Bacteria | 26407 |
| 364 | Ga0496108_0196963 | 3300048911 | Bacteria | 1747 |
| 365 | Ga0496109_0015359 | 3300048912 | Bacteria | 6671 |
| 366 | Ga0496109_0118589 | 3300048912 | Bacteria | 2464 |
| 367 | Ga0496110_0006729 | 3300048913 | Bacteria | 9137 |
| 368 | Ga0496110_0072716 | 3300048913 | Bacteria | 3051 |
| 369 | Ga0496110_0340159 | 3300048913 | Bacteria | 1367 |
| 370 | Ga0496111_0049095 | 3300048914 | Bacteria | 3042 |
| 371 | Ga0496112_0047202 | 3300048915 | Bacteria | 4225 |
| 372 | Ga0496112_0369677 | 3300048915 | Bacteria | 1375 |
| 373 | Ga0496113_0259648 | 3300048916 | Bacteria | 1388 |
| 374 | Ga0501031_0074093 | 3300049568 | Bacteria | 2217 |
| 375 | Ga0501032_0007511 | 3300049569 | Bacteria | 7962 |
| 376 | Ga0501032_0033530 | 3300049569 | Bacteria | 3517 |
| 377 | Ga0501034_0001687 | 3300049571 | Bacteria | 28468 |
| 378 | Ga0501036_0182535 | 3300049572 | Bacteria | 1766 |
| 379 | Ga0501037_0005772 | 3300049573 | Bacteria | 9038 |
| 380 | Ga0501037_0016066 | 3300049573 | Bacteria | 5508 |
| 381 | Ga0501037_0170685 | 3300049573 | Bacteria | 1546 |
| 382 | Ga0501037_0207075 | 3300049573 | Bacteria | 1384 |
| 383 | Ga0501038_0005777 | 3300049574 | Bacteria | 11459 |
| 384 | Ga0501038_0012593 | 3300049574 | Bacteria | 7730 |
| 385 | Ga0501038_0022914 | 3300049574 | Bacteria | 5590 |
| 386 | Ga0501039_0006182 | 3300049575 | Bacteria | 9091 |
| 387 | Ga0501039_0022288 | 3300049575 | Bacteria | 4863 |
| 388 | Ga0501039_0031851 | 3300049575 | Bacteria | 4065 |
| 389 | Ga0501040_0014901 | 3300049576 | Bacteria | 5132 |
| 390 | Ga0501040_0051796 | 3300049576 | Bacteria | 2808 |
| 391 | Ga0501041_0016627 | 3300049577 | Bacteria | 4377 |
| 392 | Ga0501041_0022257 | 3300049577 | Bacteria | 3794 |
| 393 | Ga0501041_0090146 | 3300049577 | Bacteria | 1893 |
| 394 | Ga0501041_0125289 | 3300049577 | Bacteria | 1599 |
| 395 | Ga0501042_0011314 | 3300049578 | Bacteria | 6016 |
| 396 | Ga0501043_0080907 | 3300049579 | Bacteria | 2552 |
| 397 | Ga0501046_0035200 | 3300049580 | Bacteria | 4036 |
| 398 | Ga0501070_0076389 | 3300049586 | Bacteria | 2773 |
| 399 | Ga0501070_0088447 | 3300049586 | Bacteria | 2564 |
| 400 | Ga0501071_0159674 | 3300049587 | Bacteria | 1684 |
| 401 | Ga0501072_0000720 | 3300049588 | Bacteria | 24044 |
| 402 | Ga0501072_0022288 | 3300049588 | Bacteria | 4914 |
| 403 | Ga0501072_0104297 | 3300049588 | Bacteria | 2254 |
| 404 | Ga0501073_0011928 | 3300049589 | Bacteria | 6344 |
| 405 | Ga0501074_0098925 | 3300049590 | Bacteria | 2088 |
| 406 | Ga0501075_0016542 | 3300049591 | Bacteria | 5315 |
| 407 | Ga0501075_0060226 | 3300049591 | Bacteria | 2861 |
| 408 | Ga0501075_0149405 | 3300049591 | Bacteria | 1781 |
| 409 | Ga0501075_0195336 | 3300049591 | Unclassified | 1543 |
| 410 | Ga0501076_0003881 | 3300049592 | Bacteria | 10528 |
| 411 | Ga0501076_0014654 | 3300049592 | Bacteria | 5909 |
| 412 | Ga0501077_0021673 | 3300049593 | Bacteria | 4067 |
| 413 | Ga0501077_0024362 | 3300049593 | Bacteria | 3843 |
| 414 | Ga0501079_0006150 | 3300049741 | Bacteria | 9005 |
| 415 | Ga0501079_0018197 | 3300049741 | Bacteria | 5366 |
| 416 | Ga0501080_0022576 | 3300049742 | Bacteria | 5830 |
| 417 | Ga0501080_0030502 | 3300049742 | Bacteria | 5023 |
| 418 | Ga0501081_0026187 | 3300049743 | Bacteria | 3930 |
| 419 | Ga0501081_0141851 | 3300049743 | Bacteria | 1722 |
| 420 | Ga0501279_002083 | 3300049775 | Bacteria | 2650 |
| 421 | Ga0501045_0010278 | 3300049824 | Bacteria | 6555 |
| 422 | Ga0501045_0097276 | 3300049824 | Bacteria | 2178 |
| 423 | nmdc:mga05p37_105338_c1 | 3300050507 | Bacteria | 3470 |
| 424 | nmdc:mga05p37_10710_c1 | 3300050507 | Bacteria | 10884 |
| 425 | nmdc:mga05p37_382184_c1 | 3300050507 | Bacteria | 1650 |
| 426 | nmdc:mga05p37_775_c1 | 3300050507 | Bacteria | 35507 |
| 427 | nmdc:mga09592_148_c1 | 3300050508 | Bacteria | 47706 |
| 428 | nmdc:mga0qj67_315226_c1 | 3300050509 | Bacteria | 1266 |
| 429 | nmdc:mga0qj67_48546_c1 | 3300050509 | Bacteria | 3353 |
| 430 | nmdc:mga0qj67_740_c1 | 3300050509 | Bacteria | 22151 |
| 431 | nmdc:mga06r32_2241_c1 | 3300050510 | Bacteria | 17309 |
| 432 | nmdc:mga08y16_27884_c1 | 3300050511 | Bacteria | 5954 |
| 433 | nmdc:mga08y16_6707_c1 | 3300050511 | Bacteria | 12072 |
| 434 | nmdc:mga0n895_258674_c1 | 3300050512 | Bacteria | 1767 |
| 435 | nmdc:mga0n895_26762_c1 | 3300050512 | Bacteria | 5469 |
| 436 | nmdc:mga0n895_37609_c1 | 3300050512 | Bacteria | 4684 |
| 437 | nmdc:mga0n895_39167_c1 | 3300050512 | Bacteria | 4597 |
| 438 | nmdc:mga0n895_42377_c1 | 3300050512 | Bacteria | 4428 |
| 439 | nmdc:mga0n895_924_c1 | 3300050512 | Bacteria | 21172 |
| 440 | nmdc:mga0rr50_118081_c1 | 3300050513 | Bacteria | 2107 |
| 441 | nmdc:mga0rr50_13072_c1 | 3300050513 | Bacteria | 5390 |
| 442 | nmdc:mga0rr50_1686_c1 | 3300050513 | Bacteria | 12197 |
| 443 | nmdc:mga0rr50_31547_c1 | 3300050513 | Bacteria | 3764 |
| 444 | nmdc:mga0rr50_31752_c1 | 3300050513 | Bacteria | 3756 |
| 445 | nmdc:mga08x19_22448_c1 | 3300050514 | Bacteria | 3909 |
| 446 | nmdc:mga08x19_834_c1 | 3300050514 | Bacteria | 19567 |
| 447 | nmdc:mga0a205_10857_c1 | 3300050515 | Bacteria | 8378 |
| 448 | nmdc:mga0a205_121786_c1 | 3300050515 | Bacteria | 2508 |
| 449 | nmdc:mga0a205_236717_c1 | 3300050515 | Bacteria | 1708 |
| 450 | nmdc:mga0a205_268935_c1 | 3300050515 | Bacteria | 1582 |
| 451 | nmdc:mga0a205_28573_c1 | 3300050515 | Bacteria | 5333 |
| 452 | nmdc:mga0a205_45087_c1 | 3300050515 | Bacteria | 4252 |
| 453 | nmdc:mga0a205_72547_c1 | 3300050515 | Bacteria | 3326 |
| 454 | nmdc:mga0a205_821_c1 | 3300050515 | Bacteria | 25293 |
| 455 | Ga0495595_0044077 | 3300053084 | Bacteria | 2049 |
| 456 | Ga0501084_0095082 | 3300054114 | Bacteria | 2502 |
| 457 | Ga0501084_0126519 | 3300054114 | Bacteria | 2150 |
| 458 | Ga0501084_0236428 | 3300054114 | Viruses | 1542 |
| 459 | Ga0501082_0015226 | 3300060353 | Bacteria | 6624 |
| 460 | Ga0501082_0040627 | 3300060353 | Bacteria | 4011 |
| 461 | Ga0501082_0422247 | 3300060353 | Bacteria | 1164 |
| 462 | Ga0530510_0000042 | 3300061734 | Bacteria | 58436 |
| 463 | Ga0530510_0014848 | 3300061734 | Bacteria | 5499 |
| 464 | Ga0530510_0195608 | 3300061734 | Bacteria | 1501 |
| 465 | 2691511806 | 2690315906 | Bacteria | 4517044 |
| 466 | 2808829001 | 2808606357 | Bacteria | 4466944 |
| 467 | 2808850224 | 2808606360 | Bacteria | 4404006 |
| 468 | 2808877223 | 2808606366 | Bacteria | 4415912 |
| 469 | 2808893238 | 2808606370 | Bacteria | 4942454 |
| 470 | 2808898681 | 2808606371 | Bacteria | 4251511 |
| 471 | 2812319264 | 2811994871 | Bacteria | 4497550 |
| 472 | 2857744841 | 2857740372 | Bacteria | 4782044 |
| 473 | 2904499135 | 2904497146 | Bacteria | 4731781 |
| 474 | 2904780616 | 2904776348 | Bacteria | 4658726 |
| 475 | 2910811363 | 2910809715 | Bacteria | 4982797 |
| 476 | 2919039114 | 2919034639 | Bacteria | 4763403 |
| 477 | 2919060884 | 2919059106 | Bacteria | 4991624 |
| 478 | 2919395637 | 2919391150 | Bacteria | 4884741 |
| 479 | 2919541309 | 2919538618 | Bacteria | 4677069 |
| 480 | 2932430188 | 2932426870 | Bacteria | 4547726 |
| 481 | 2939602395 | 2939598168 | Bacteria | 4687164 |
| 482 | 2939651255 | 2939647034 | Bacteria | 4681660 |
| 483 | 2939678941 | 2939674588 | Bacteria | 4844420 |
| 484 | 2945917017 | 2945916053 | Bacteria | 4555517 |
| 485 | 2945945493 | 2945941187 | Bacteria | 4682474 |
| 486 | 2945956198 | 2945956166 | Bacteria | 5110334 |
| 487 | 2946041584 | 2946037020 | Bacteria | 4900426 |
| 488 | 2946060847 | 2946059875 | Bacteria | 4386623 |
| 489 | 2954002782 | 2953998280 | Bacteria | 4812144 |
| 490 | 2974305020 | 2974302888 | Bacteria | 4369871 |
| 491 | 8054112029 | 8054107350 | Bacteria | 5022511 |
| 492 | LJQas_1000586 | |||
| 493 | rootH2_10130506 | |||
| 494 | rootH2_10144228 | |||
| 495 | Ga0070670_100024368 | |||
| 496 | Ga0070677_10026182 | |||
| 497 | Ga0068869_100005227 | |||
| 498 | Ga0070666_10048583 | |||
| 499 | Ga0070680_100001936 | |||
| 500 | Ga0070682_100001084 | |||
| 501 | Ga0068868_100003103 | |||
| 502 | Ga0070689_100000317 | |||
| 503 | Ga0070689_100124432 | |||
| 504 | Ga0070691_10000355 | |||
| 505 | Ga0070687_100000251 | |||
| 506 | Ga0070692_10019493 | |||
| 507 | Ga0070675_100157289 | |||
| 508 | Ga0070671_100269501 | |||
| 509 | Ga0070667_100097731 | |||
| 510 | Ga0070703_10012155 | |||
| 511 | Ga0070701_10000853 | |||
| 512 | Ga0070705_100000115 | |||
| 513 | Ga0070700_100000903 | |||
| 514 | Ga0070694_100000066 | |||
| 515 | Ga0070694_100064230 | |||
| 516 | Ga0070694_100160928 | |||
| 517 | Ga0070708_100002210 | |||
| 518 | Ga0070708_100008673 | |||
| 519 | Ga0070708_100032831 | |||
| 520 | Ga0070708_100278160 | |||
| 521 | Ga0070678_100056995 | |||
| 522 | Ga0068867_100000422 | |||
| 523 | Ga0070706_100000036 | |||
| 524 | Ga0070706_100040024 | |||
| 525 | Ga0070706_100085561 | |||
| 526 | Ga0070707_100008469 | |||
| 527 | Ga0070707_100027499 | |||
| 528 | Ga0070707_100093590 | |||
| 529 | Ga0070707_100402173 | |||
| 530 | Ga0070707_100423806 | |||
| 531 | Ga0070698_100000198 | |||
| 532 | Ga0070698_100038027 | |||
| 533 | Ga0070699_100000052 | |||
| 534 | Ga0070679_100041110 | |||
| 535 | Ga0070697_100008358 | |||
| 536 | Ga0070697_100008599 | |||
| 537 | Ga0070697_100011227 | |||
| 538 | Ga0070697_100017456 | |||
| 539 | Ga0070697_100084088 | |||
| 540 | Ga0070697_100179746 | |||
| 541 | Ga0070672_100101753 | |||
| 542 | Ga0070686_100000167 | |||
| 543 | Ga0070695_100000164 | |||
| 544 | Ga0070695_100007139 | |||
| 545 | Ga0070695_100078205 | |||
| 546 | Ga0070696_100000739 | |||
| 547 | Ga0070696_100000933 | |||
| 548 | Ga0070693_100000323 | |||
| 549 | Ga0070704_100000093 | |||
| 550 | Ga0068855_100005066 | |||
| 551 | Ga0068854_100025736 | |||
| 552 | Ga0070702_100003437 | |||
| 553 | Ga0068859_100013618 | |||
| 554 | Ga0068859_100070993 | |||
| 555 | Ga0068864_100011897 | |||
| 556 | Ga0068858_100005171 | |||
| 557 | Ga0068860_100003453 | |||
| 558 | Ga0068862_100001425 | |||
| 559 | Ga0081455_10042572 | |||
| 560 | Ga0081538_10005326 | |||
| 561 | Ga0070717_10000105 | |||
| 562 | Ga0070717_10042070 | |||
| 563 | Ga0075365_10008218 | |||
| 564 | Ga0075432_10018835 | |||
| 565 | Ga0070716_100034944 | |||
| 566 | Ga0097621_100003699 | |||
| 567 | Ga0068871_100000965 | |||
| 568 | Ga0075428_100000502 | |||
| 569 | Ga0075428_100071259 | |||
| 570 | Ga0075428_100141150 | |||
| 571 | Ga0075428_100336606 | |||
| 572 | Ga0075430_100000620 | |||
| 573 | Ga0075430_100008701 | |||
| 574 | Ga0075430_100053261 | |||
| 575 | Ga0075431_100007715 | |||
| 576 | Ga0075431_100220054 | |||
| 577 | Ga0075433_10000611 | |||
| 578 | Ga0075433_10008931 | |||
| 579 | Ga0075433_10015296 | |||
| 580 | Ga0075433_10068436 | |||
| 581 | Ga0075433_10248490 | |||
| 582 | Ga0075433_10343031 | |||
| 583 | Ga0075434_100000406 | |||
| 584 | Ga0075434_100000420 | |||
| 585 | Ga0075434_100001960 | |||
| 586 | Ga0075434_100004191 | |||
| 587 | Ga0075434_100037772 | |||
| 588 | Ga0075434_100154967 | |||
| 589 | Ga0075434_100156318 | |||
| 590 | Ga0075429_100006458 | |||
| 591 | Ga0068865_100000043 | |||
| 592 | Ga0075436_100000513 | |||
| 593 | Ga0075436_100251135 | |||
| 594 | Ga0097620_100013618 | |||
| 595 | Ga0097620_100070993 | |||
| 596 | Ga0075435_100000668 | |||
| 597 | Ga0075435_100022097 | |||
| 598 | Ga0075435_100023865 | |||
| 599 | Ga0075435_100025101 | |||
| 600 | Ga0075435_100059147 | |||
| 601 | Ga0075435_100088147 | |||
| 602 | Ga0105251_10057927 | |||
| 603 | Ga0105244_10011440 | |||
| 604 | Ga0111539_10025953 | |||
| 605 | Ga0111539_10033795 | |||
| 606 | Ga0105245_10002730 | |||
| 607 | Ga0105245_10021533 | |||
| 608 | Ga0114129_10000393 | |||
| 609 | Ga0114129_10017768 | |||
| 610 | Ga0114129_10101226 | |||
| 611 | Ga0114129_10102635 | |||
| 612 | Ga0114129_10666112 | |||
| 613 | Ga0105243_10002483 | |||
| 614 | Ga0105243_10066999 | |||
| 615 | Ga0105243_10086908 | |||
| 616 | Ga0105241_10060798 | |||
| 617 | Ga0105242_10000296 | |||
| 618 | Ga0105248_10058291 | |||
| 619 | Ga0105248_10155338 | |||
| 620 | Ga0105249_10013242 | |||
| 621 | Ga0105239_10100776 | |||
| 622 | Ga0105246_10012860 | |||
| 623 | Ga0105246_10013182 | |||
| 624 | Ga0157371_10042930 | |||
| 625 | Ga0157369_10118773 | |||
| 626 | Ga0157369_10151684 | |||
| 627 | Ga0157378_10000140 | |||
| 628 | Ga0157378_10065443 | |||
| 629 | Ga0163162_10034362 | |||
| 630 | Ga0157375_10148212 | |||
| 631 | Ga0163163_10092245 | |||
| 632 | Ga0163163_10167940 | |||
| 633 | Ga0157379_10136603 | |||
| 634 | Ga0157376_10001393 | |||
| 635 | Ga0209051_1008918 | |||
| 636 | Ga0207697_10001206 | |||
| 637 | Ga0207697_10006018 | |||
| 638 | Ga0207655_1013460 | |||
| 639 | Ga0207655_1036831 | |||
| 640 | Ga0207655_1040046 | |||
| 641 | Ga0207653_10004260 | |||
| 642 | Ga0207682_10000126 | |||
| 643 | Ga0207642_10002243 | |||
| 644 | Ga0207680_10104690 | |||
| 645 | Ga0207645_10008636 | |||
| 646 | Ga0207643_10077588 | |||
| 647 | Ga0207684_10000020 | |||
| 648 | Ga0207684_10000441 | |||
| 649 | Ga0207684_10007210 | |||
| 650 | Ga0207684_10017186 | |||
| 651 | Ga0207662_10000024 | |||
| 652 | Ga0207652_10029903 | |||
| 653 | Ga0207646_10001140 | |||
| 654 | Ga0207646_10002272 | |||
| 655 | Ga0207646_10003775 | |||
| 656 | Ga0207646_10034128 | |||
| 657 | Ga0207650_10004213 | |||
| 658 | Ga0207659_10014866 | |||
| 659 | Ga0207687_10026914 | |||
| 660 | Ga0207700_10165307 | |||
| 661 | Ga0207686_10001122 | |||
| 662 | Ga0207709_10006556 | |||
| 663 | Ga0207670_10080441 | |||
| 664 | Ga0207704_10058283 | |||
| 665 | Ga0207665_10028280 | |||
| 666 | Ga0207691_10115023 | |||
| 667 | Ga0207711_10281591 | |||
| 668 | Ga0207689_10000162 | |||
| 669 | Ga0207689_10019504 | |||
| 670 | Ga0207667_10005789 | |||
| 671 | Ga0207651_10012861 | |||
| 672 | Ga0207651_10171775 | |||
| 673 | Ga0207640_10018355 | |||
| 674 | Ga0207677_10000875 | |||
| 675 | Ga0207703_10029263 | |||
| 676 | Ga0207708_10001467 | |||
| 677 | Ga0207702_10127613 | |||
| 678 | Ga0207702_10374748 | |||
| 679 | Ga0207648_10000147 | |||
| 680 | Ga0207676_10094070 | |||
| 681 | Ga0207676_10194056 | |||
| 682 | Ga0207675_100000104 | |||
| 683 | Ga0207675_100005042 | |||
| 684 | Ga0207683_10003489 | |||
| 685 | Ga0207428_10000591 | |||
| 686 | Ga0207428_10009302 | |||
| 687 | Ga0207428_10019358 | |||
| 688 | Ga0268265_10000875 | |||
| 689 | Ga0268264_10000841 | |||
| 690 | Ga0265319_1003152 | |||
| 691 | Ga0265334_10016102 | |||
| 692 | Ga0265324_10042953 | |||
| 693 | Ga0265320_10011874 | |||
| 694 | Ga0265340_10015242 | |||
| 695 | Ga0265316_10011245 | |||
| 696 | Ga0307408_100021476 | |||
| 697 | Ga0307408_100039793 | |||
| 698 | Ga0307408_100170101 | |||
| 699 | Ga0265314_10045828 | |||
| 700 | Ga0307405_10008040 | |||
| 701 | Ga0307405_10013234 | |||
| 702 | Ga0307405_10014199 | |||
| 703 | Ga0307405_10120341 | |||
| 704 | Ga0307413_10038462 | |||
| 705 | Ga0307413_10041989 | |||
| 706 | Ga0307413_10068560 | |||
| 707 | Ga0307413_10119284 | |||
| 708 | Ga0307413_10151139 | |||
| 709 | Ga0307410_10033515 | |||
| 710 | Ga0307410_10045226 | |||
| 711 | Ga0307410_10056489 | |||
| 712 | Ga0307410_10115872 | |||
| 713 | Ga0307410_10137383 | |||
| 714 | Ga0307410_10151640 | |||
| 715 | Ga0307406_10026807 | |||
| 716 | Ga0307406_10034961 | |||
| 717 | Ga0307406_10046104 | |||
| 718 | Ga0307406_10234931 | |||
| 719 | Ga0307407_10016419 | |||
| 720 | Ga0307407_10043578 | |||
| 721 | Ga0307407_10076792 | |||
| 722 | Ga0307412_10048946 | |||
| 723 | Ga0307412_10069772 | |||
| 724 | Ga0307412_10087338 | |||
| 725 | Ga0307409_100038141 | |||
| 726 | Ga0307416_100005550 | |||
| 727 | Ga0307416_100162820 | |||
| 728 | Ga0307416_100218289 | |||
| 729 | Ga0307416_100249971 | |||
| 730 | Ga0307416_100255894 | |||
| 731 | Ga0307416_100294042 | |||
| 732 | Ga0307416_100335649 | |||
| 733 | Ga0307414_10192179 | |||
| 734 | Ga0307414_10264215 | |||
| 735 | Ga0307411_10029162 | |||
| 736 | Ga0307415_100068238 | |||
| 737 | Ga0307415_100378542 | |||
| 738 | Ga0373948_0004509 | |||
| 739 | Ga0373926_0000374 | |||
| 740 | Ga0373928_0001441 | |||
| 741 | Ga0373940_0008080 | |||
| 742 | Ga0373952_0003435 | |||
| 743 | Ga0373932_0002228 | |||
| 744 | Ga0373939_0000980 | |||
| 745 | Ga0373941_0040190 | |||
| 746 | Ga0373946_0057869 | |||
| 747 | Ga0373961_0022590 | |||
| 748 | Ga0373962_0003422 | |||
| 749 | Ga0373931_0000177 | |||
| 750 | Ga0373927_0019415 | |||
| 751 | Ga0373925_0072097 | |||
| 752 | Ga0395899_0001483 | |||
| 753 | Ga0395899_0013365 | |||
| 754 | Ga0395899_0103433 | |||
| 755 | Ga0395900_0056857 | |||
| 756 | Ga0395898_0075975 | |||
| 757 | Ga0395898_0245901 | |||
| 758 | Ga0395905_0250671 | |||
| 759 | Ga0395901_0008604 | |||
| 760 | Ga0395901_0321686 | |||
| 761 | Ga0436363_1309023 | |||
| 762 | Ga0436362_0909728 | |||
| 763 | Ga0439436_0004373 | |||
| 764 | Ga0439438_024979 | |||
| 765 | Ga0439439_0007543 | |||
| 766 | Ga0439461_0000481 | |||
| 767 | Ga0439466_0002744 | |||
| 768 | Ga0439466_0041154 | |||
| 769 | Ga0439433_0004374 | |||
| 770 | Ga0439433_0041875 | |||
| 771 | Ga0439441_009392 | |||
| 772 | Ga0439442_001374 | |||
| 773 | Ga0439442_002583 | |||
| 774 | Ga0439449_0001865 | |||
| 775 | Ga0439462_0016256 | |||
| 776 | Ga0450920_000526 | |||
| 777 | Ga0450920_003839 | |||
| 778 | Ga0450920_012382 | |||
| 779 | Ga0450907_000584 | |||
| 780 | Ga0450910_001694 | |||
| 781 | Ga0439434_0009163 | |||
| 782 | Ga0439434_0016708 | |||
| 783 | Ga0439435_0001815 | |||
| 784 | Ga0450918_001097 | |||
| 785 | Ga0466963_0022653 | |||
| 786 | Ga0451576_0009298 | |||
| 787 | Ga0451576_0020809 | |||
| 788 | Ga0451576_0047301 | |||
| 789 | Ga0466967_0109340 | |||
| 790 | Ga0495653_0009296 | |||
| 791 | Ga0495580_0008764 | |||
| 792 | Ga0495582_0019386 | |||
| 793 | Ga0495639_0014771 | |||
| 794 | Ga0495639_0028944 | |||
| 795 | Ga0495662_0002526 | |||
| 796 | Ga0495594_0064603 | |||
| 797 | Ga0495630_0016327 | |||
| 798 | Ga0495631_0030681 | |||
| 799 | Ga0495643_0071739 | |||
| 800 | Ga0495666_0007281 | |||
| 801 | Ga0495642_0055796 | |||
| 802 | Ga0495654_0079682 | |||
| 803 | Ga0495665_0000983 | |||
| 804 | Ga0495665_0069990 | |||
| 805 | Ga0495586_0004594 | |||
| 806 | Ga0495586_0018559 | |||
| 807 | Ga0495586_0033812 | |||
| 808 | Ga0495586_0052936 | |||
| 809 | Ga0495587_0001116 | |||
| 810 | Ga0495598_0008773 | |||
| 811 | Ga0495633_0046004 | |||
| 812 | Ga0495667_0002674 | |||
| 813 | Ga0495656_0004238 | |||
| 814 | Ga0495635_0053108 | |||
| 815 | Ga0495659_0010181 | |||
| 816 | Ga0495588_0017710 | |||
| 817 | Ga0495588_0040433 | |||
| 818 | Ga0495588_0099094 | |||
| 819 | Ga0495657_0061571 | |||
| 820 | Ga0495623_0023875 | |||
| 821 | Ga0495647_0001798 | |||
| 822 | Ga0495658_0025915 | |||
| 823 | Ga0495613_0216083 | |||
| 824 | Ga0495670_0000338 | |||
| 825 | Ga0495670_0062159 | |||
| 826 | Ga0495670_0067613 | |||
| 827 | Ga0495600_0128663 | |||
| 828 | Ga0495600_0171866 | |||
| 829 | Ga0495581_0002780 | |||
| 830 | Ga0495604_0087319 | |||
| 831 | Ga0495636_0005293 | |||
| 832 | Ga0495636_0030359 | |||
| 833 | Ga0495680_0007190 | |||
| 834 | Ga0495675_0012523 | |||
| 835 | Ga0495681_0037248 | |||
| 836 | Ga0495684_0055510 | |||
| 837 | Ga0495593_0009654 | |||
| 838 | Ga0496100_0003367 | |||
| 839 | Ga0496102_0077871 | |||
| 840 | Ga0496102_0083209 | |||
| 841 | Ga0496102_0537528 | |||
| 842 | Ga0496103_0010898 | |||
| 843 | Ga0496103_0017766 | |||
| 844 | Ga0496103_0160284 | |||
| 845 | Ga0496104_0008368 | |||
| 846 | Ga0496104_0080987 | |||
| 847 | Ga0496105_0002859 | |||
| 848 | Ga0496106_0004267 | |||
| 849 | Ga0496106_0010677 | |||
| 850 | Ga0496107_0000513 | |||
| 851 | Ga0496107_0028931 | |||
| 852 | Ga0496107_0048708 | |||
| 853 | Ga0496107_0136431 | |||
| 854 | Ga0496108_0000674 | |||
| 855 | Ga0496108_0196963 | |||
| 856 | Ga0496109_0015359 | |||
| 857 | Ga0496109_0118589 | |||
| 858 | Ga0496110_0006729 | |||
| 859 | Ga0496110_0072716 | |||
| 860 | Ga0496110_0340159 | |||
| 861 | Ga0496111_0049095 | |||
| 862 | Ga0496112_0047202 | |||
| 863 | Ga0496112_0369677 | |||
| 864 | Ga0496113_0259648 | |||
| 865 | Ga0501031_0074093 | |||
| 866 | Ga0501032_0007511 | |||
| 867 | Ga0501032_0033530 | |||
| 868 | Ga0501034_0001687 | |||
| 869 | Ga0501036_0182535 | |||
| 870 | Ga0501037_0005772 | |||
| 871 | Ga0501037_0016066 | |||
| 872 | Ga0501037_0170685 | |||
| 873 | Ga0501037_0207075 | |||
| 874 | Ga0501038_0005777 | |||
| 875 | Ga0501038_0012593 | |||
| 876 | Ga0501038_0022914 | |||
| 877 | Ga0501039_0006182 | |||
| 878 | Ga0501039_0022288 | |||
| 879 | Ga0501039_0031851 | |||
| 880 | Ga0501040_0014901 | |||
| 881 | Ga0501040_0051796 | |||
| 882 | Ga0501041_0016627 | |||
| 883 | Ga0501041_0022257 | |||
| 884 | Ga0501041_0090146 | |||
| 885 | Ga0501041_0125289 | |||
| 886 | Ga0501042_0011314 | |||
| 887 | Ga0501043_0080907 | |||
| 888 | Ga0501046_0035200 | |||
| 889 | Ga0501070_0076389 | |||
| 890 | Ga0501070_0088447 | |||
| 891 | Ga0501071_0159674 | |||
| 892 | Ga0501072_0000720 | |||
| 893 | Ga0501072_0022288 | |||
| 894 | Ga0501072_0104297 | |||
| 895 | Ga0501073_0011928 | |||
| 896 | Ga0501074_0098925 | |||
| 897 | Ga0501075_0016542 | |||
| 898 | Ga0501075_0060226 | |||
| 899 | Ga0501075_0149405 | |||
| 900 | Ga0501075_0195336 | |||
| 901 | Ga0501076_0003881 | |||
| 902 | Ga0501076_0014654 | |||
| 903 | Ga0501077_0021673 | |||
| 904 | Ga0501077_0024362 | |||
| 905 | Ga0501079_0006150 | |||
| 906 | Ga0501079_0018197 | |||
| 907 | Ga0501080_0022576 | |||
| 908 | Ga0501080_0030502 | |||
| 909 | Ga0501081_0026187 | |||
| 910 | Ga0501081_0141851 | |||
| 911 | Ga0501279_002083 | |||
| 912 | Ga0501045_0010278 | |||
| 913 | Ga0501045_0097276 | |||
| 914 | nmdc:mga05p37_105338_c1 | |||
| 915 | nmdc:mga05p37_10710_c1 | |||
| 916 | nmdc:mga05p37_382184_c1 | |||
| 917 | nmdc:mga05p37_775_c1 | |||
| 918 | nmdc:mga09592_148_c1 | |||
| 919 | nmdc:mga0qj67_315226_c1 | |||
| 920 | nmdc:mga0qj67_48546_c1 | |||
| 921 | nmdc:mga0qj67_740_c1 | |||
| 922 | nmdc:mga06r32_2241_c1 | |||
| 923 | nmdc:mga08y16_27884_c1 | |||
| 924 | nmdc:mga08y16_6707_c1 | |||
| 925 | nmdc:mga0n895_258674_c1 | |||
| 926 | nmdc:mga0n895_26762_c1 | |||
| 927 | nmdc:mga0n895_37609_c1 | |||
| 928 | nmdc:mga0n895_39167_c1 | |||
| 929 | nmdc:mga0n895_42377_c1 | |||
| 930 | nmdc:mga0n895_924_c1 | |||
| 931 | nmdc:mga0rr50_118081_c1 | |||
| 932 | nmdc:mga0rr50_13072_c1 | |||
| 933 | nmdc:mga0rr50_1686_c1 | |||
| 934 | nmdc:mga0rr50_31547_c1 | |||
| 935 | nmdc:mga0rr50_31752_c1 | |||
| 936 | nmdc:mga08x19_22448_c1 | |||
| 937 | nmdc:mga08x19_834_c1 | |||
| 938 | nmdc:mga0a205_10857_c1 | |||
| 939 | nmdc:mga0a205_121786_c1 | |||
| 940 | nmdc:mga0a205_236717_c1 | |||
| 941 | nmdc:mga0a205_268935_c1 | |||
| 942 | nmdc:mga0a205_28573_c1 | |||
| 943 | nmdc:mga0a205_45087_c1 | |||
| 944 | nmdc:mga0a205_72547_c1 | |||
| 945 | nmdc:mga0a205_821_c1 | |||
| 946 | Ga0495595_0044077 | |||
| 947 | Ga0501084_0095082 | |||
| 948 | Ga0501084_0126519 | |||
| 949 | Ga0501084_0236428 | |||
| 950 | Ga0501082_0015226 | |||
| 951 | Ga0501082_0040627 | |||
| 952 | Ga0501082_0422247 | |||
| 953 | Ga0530510_0000042 | |||
| 954 | Ga0530510_0014848 | |||
| 955 | Ga0530510_0195608 | |||
| 956 | 2691511806 | |||
| 957 | 2808829001 | |||
| 958 | 2808850224 | |||
| 959 | 2808877223 | |||
| 960 | 2808893238 | |||
| 961 | 2808898681 | |||
| 962 | 2812319264 | |||
| 963 | 2857744841 | |||
| 964 | 2904499135 | |||
| 965 | 2904780616 | |||
| 966 | 2910811363 | |||
| 967 | 2919039114 | |||
| 968 | 2919060884 | |||
| 969 | 2919395637 | |||
| 970 | 2919541309 | |||
| 971 | 2932430188 | |||
| 972 | 2939602395 | |||
| 973 | 2939651255 | |||
| 974 | 2939678941 | |||
| 975 | 2945917017 | |||
| 976 | 2945945493 | |||
| 977 | 2945956198 | |||
| 978 | 2946041584 | |||
| 979 | 2946060847 | |||
| 980 | 2954002782 | |||
| 981 | 2974305020 | |||
| 982 | 8054112029 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2ca4-assembly1.cif.gz_A | sulfite dehydrogenase from starkeya novella mutant | 0.9199 | 73 | 405 |
| 2ca3-assembly1.cif.gz_A | sulfite dehydrogenase from starkeya novella r55m mutant | 0.9183 | 73 | 405 |
| 2c9x-assembly1.cif.gz_A | sulfite dehydrogenase from starkeya novella y236f mutant | 0.9181 | 73 | 405 |
| 2bpb-assembly1.cif.gz_A | sulfite dehydrogenase from starkeya novella | 0.9095 | 73 | 405 |
| 3r18-assembly1.cif.gz_A-2 | chicken sulfite oxidase double mutant with altered activity and substrate affinity | 0.8968 | 73 | 405 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_I1N786_1_262_3.90.420.10 | Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain | 0.9403 | 73 | 274 | 3.90.420.10 |
| 2ca4A01 | Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain | 0.9266 | 73 | 279 | 3.90.420.10 |
| af_P11035_116_359_3.90.420.10 | Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain | 0.9197 | 72 | 282 | 3.90.420.10 |
| af_Q54XJ8_10_262_3.90.420.10 | Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain | 0.9188 | 73 | 281 | 3.90.420.10 |
| 2biiB01 | Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain | 0.9122 | 71 | 276 | 3.90.420.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A538J6U1-F1-model_v4 | Sulfite oxidase | 0.9786 | 76 | 405 |
GO:0006790
GO:0008482 GO:0020037 GO:0030151 GO:0043546 |
| AF-A0A7W1HPM1-F1-model_v4 | Sulfite oxidase | 0.9715 | 85 | 405 |
GO:0006790
GO:0008482 GO:0020037 GO:0030151 GO:0043546 |
| AF-A0A536LKC0-F1-model_v4 | Sulfite oxidase | 0.9697 | 76 | 268 |
GO:0006790
GO:0008482 GO:0020037 GO:0043546 |
| AF-A0A538J6U1-F1-model_v4 | Sulfite oxidase | 0.9586 | 76 | 405 |
GO:0006790
GO:0008482 GO:0020037 GO:0030151 GO:0043546 |
| AF-A0A1W2C1P1-F1-model_v4 | Oxidoreductase molybdopterin binding domain-containing protein | 0.9553 | 163 | 271 |
GO:0006790
GO:0008482 GO:0020037 GO:0043546 |