F454053

General Info

Members Datasets Scaffolds Average Seq Length
491 237 983 241

Family's Representative Sequence

Representative Sequence 3300005336|Ga0070680_100026482|Ga0070680_1000264824
Length 240
Sequence MTKLSVNINKIATLRNSRGGNNPDVIKAAIDIQNFGAEGITVHPRPDERHIRYADVYALKKIITTEFNIEGNPKEQKFVDLVLANKPDQVTLVPDAEGQITSDHGWDTKKNRDYLIEIISVFQKANIRVSIFVDPDIDMVIGAKETGTDRIELYTEGYTKKYATGNKQSAIQEYILAAKKANELNLGINAGHDLDLTNLKYFAQNIPELLEVSIGHALISDALYFGLENAVQLYKRQLLM

Samples

Sample ID Description Type Environment
1 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
58 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
64 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
68 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
69 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
70 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
82 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
83 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
84 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
85 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
92 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
93 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
94 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
95 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
96 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
97 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
143 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
147 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
148 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
149 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
150 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
151 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
152 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
153 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
154 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
155 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
156 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
157 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
158 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
159 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
160 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
161 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
162 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
163 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
164 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
165 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
166 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
167 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
168 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
169 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
170 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
171 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
172 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
173 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
174 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
175 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
176 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
177 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
178 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
179 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
180 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
181 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
182 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
183 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
184 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
185 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
186 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
187 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
188 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
189 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
190 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
191 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
192 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
203 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
204 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
205 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
206 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
207 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
208 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
209 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
210 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
211 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
214 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
215 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
216 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
217 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
218 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
219 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
220 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
221 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
222 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
223 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
224 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
225 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
226 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
227 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
228 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
229 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
230 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
231 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
232 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
233 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
234 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
235 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
236 2738541278 Niastella sp. CF465 Isolate Unclassified
237 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.59
Metatranscriptomes 0
Isolates 0.41

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.87
Nodule 0
Rhizoplane 0.81
Rhizosphere 91.24
Stem 0
Stem Tuber 0
Unclassified 7.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070680_100026482 3300005336 Bacteria 4638
2 MBSR1b_contig_11194412 2162886012 Bacteria 1343
3 MBSR1b_contig_993991 2162886012 Bacteria 1343
4 JGI25406J46586_10040429 3300003203 Bacteria 1653
5 rootH1_10016176 3300003316 Bacteria 26999
6 rootH1_10016176 3300003323 Bacteria 2806
7 rootH2_10014715 3300003320 Bacteria 11737
8 rootL2_10127900 3300003322 Bacteria 3763
9 rootL2_10180833 3300003322 Unclassified 3621
10 rootH1_10047229 3300003323 Bacteria 4124
11 rootH1_10092516 3300003323 Unclassified 1338
12 rootH1_10181683 3300003323 Bacteria 3608
13 Ga0065712_10239225 3300005290 Bacteria 976
14 Ga0065715_10033795 3300005293 Bacteria 1264
15 Ga0065707_10091965 3300005295 Bacteria 3851
16 Ga0065707_10198086 3300005295 Bacteria 1325
17 Ga0070658_10009494 3300005327 Bacteria 7819
18 Ga0070676_10008172 3300005328 Bacteria 5630
19 Ga0070676_10059395 3300005328 Bacteria 2268
20 Ga0070676_10069916 3300005328 Bacteria 2105
21 Ga0070683_100006986 3300005329 Bacteria 9499
22 Ga0070683_100409143 3300005329 Bacteria 1294
23 Ga0070690_100006303 3300005330 Bacteria 6726
24 Ga0070690_100177839 3300005330 Bacteria 1469
25 Ga0070670_100243454 3300005331 Bacteria 1566
26 Ga0070677_10048053 3300005333 Bacteria 1712
27 Ga0068869_100008744 3300005334 Bacteria 6541
28 Ga0068869_100011711 3300005334 Bacteria 5764
29 Ga0068869_100017642 3300005334 Bacteria 4843
30 Ga0068869_100041124 3300005334 Bacteria 3309
31 Ga0068869_100072513 3300005334 Bacteria 2551
32 Ga0068869_100087984 3300005334 Bacteria 2331
33 Ga0068869_100203118 3300005334 Bacteria 1563
34 Ga0070666_10025373 3300005335 Bacteria 3864
35 Ga0070666_10030159 3300005335 Bacteria 3571
36 Ga0070682_100000060 3300005337 Bacteria 105136
37 Ga0068868_100008427 3300005338 Bacteria 7382
38 Ga0068868_100034694 3300005338 Bacteria 3896
39 Ga0068868_100181261 3300005338 Bacteria 1747
40 Ga0070689_100005879 3300005340 Bacteria 8432
41 Ga0070689_100225913 3300005340 Bacteria 1537
42 Ga0070661_100002662 3300005344 Bacteria 12227
43 Ga0070661_100018099 3300005344 Bacteria 5005
44 Ga0070661_100199346 3300005344 Bacteria 1529
45 Ga0070668_100024630 3300005347 Bacteria 4560
46 Ga0070668_100027619 3300005347 Bacteria 4309
47 Ga0070668_100031183 3300005347 Unclassified 4055
48 Ga0070669_100024003 3300005353 Bacteria 4369
49 Ga0070675_100001080 3300005354 Bacteria 19673
50 Ga0070675_100018497 3300005354 Bacteria 5548
51 Ga0070675_100384957 3300005354 Bacteria 1249
52 Ga0070675_100398307 3300005354 Bacteria 1228
53 Ga0070671_100191238 3300005355 Bacteria 1735
54 Ga0070671_100314553 3300005355 Bacteria 1334
55 Ga0070671_100429164 3300005355 Bacteria 1132
56 Ga0070674_100491637 3300005356 Bacteria 1020
57 Ga0070673_100019624 3300005364 Bacteria 4856
58 Ga0070673_100021448 3300005364 Bacteria 4684
59 Ga0070673_100096124 3300005364 Bacteria 2431
60 Ga0070673_100121058 3300005364 Bacteria 2183
61 Ga0070673_100295853 3300005364 Bacteria 1424
62 Ga0070673_100415886 3300005364 Bacteria 1205
63 Ga0070688_100005132 3300005365 Bacteria 6867
64 Ga0070688_100010004 3300005365 Bacteria 5210
65 Ga0070688_100048232 3300005365 Bacteria 2646
66 Ga0070688_100059275 3300005365 Bacteria 2413
67 Ga0070659_100036280 3300005366 Bacteria 3843
68 Ga0070667_100027322 3300005367 Bacteria 4747
69 Ga0070667_100129541 3300005367 Bacteria 2201
70 Ga0070701_10169171 3300005438 Bacteria 1271
71 Ga0070700_100037485 3300005441 Bacteria 2949
72 Ga0070663_100355506 3300005455 Unclassified 1187
73 Ga0070663_100366877 3300005455 Bacteria 1169
74 Ga0070678_100011522 3300005456 Bacteria 5462
75 Ga0070678_100031734 3300005456 Bacteria 3649
76 Ga0070678_100054184 3300005456 Bacteria 2921
77 Ga0070662_100002753 3300005457 Bacteria 10874
78 Ga0070662_100023515 3300005457 Bacteria 4234
79 Ga0070681_10136234 3300005458 Bacteria 2386
80 Ga0068867_100031909 3300005459 Bacteria 3806
81 Ga0068867_100098577 3300005459 Bacteria 2229
82 Ga0068867_100190445 3300005459 Bacteria 1636
83 Ga0070685_10050704 3300005466 Unclassified 2398
84 Ga0070685_10064140 3300005466 Bacteria 2159
85 Ga0070685_10313108 3300005466 Bacteria 1061
86 Ga0070707_100104556 3300005468 Bacteria 2745
87 Ga0070698_100000392 3300005471 Bacteria 46091
88 Ga0070698_100018803 3300005471 Bacteria 7270
89 Ga0070698_100208592 3300005471 Bacteria 1889
90 Ga0070679_100224166 3300005530 Unclassified 1840
91 Ga0070684_100003098 3300005535 Bacteria 12410
92 Ga0070684_100013922 3300005535 Bacteria 6499
93 Ga0070684_100573722 3300005535 Bacteria 1048
94 Ga0068853_100011236 3300005539 Bacteria 7267
95 Ga0068853_100032494 3300005539 Bacteria 4421
96 Ga0068853_100039849 3300005539 Bacteria 4007
97 Ga0070672_100129121 3300005543 Bacteria 2076
98 Ga0070672_100363316 3300005543 Bacteria 1236
99 Ga0070672_100570597 3300005543 Bacteria 984
100 Ga0070686_100336390 3300005544 Bacteria 1130
101 Ga0068855_100004630 3300005563 Bacteria 16786
102 Ga0068855_100126797 3300005563 Bacteria 2918
103 Ga0068855_100350853 3300005563 Bacteria 1625
104 Ga0070664_100011313 3300005564 Bacteria 7238
105 Ga0070664_100048452 3300005564 Bacteria 3591
106 Ga0070664_100169239 3300005564 Bacteria 1938
107 Ga0068857_100010396 3300005577 Bacteria 8087
108 Ga0068857_100010473 3300005577 Bacteria 8059
109 Ga0068857_100024908 3300005577 Bacteria 5270
110 Ga0068857_100074551 3300005577 Bacteria 3024
111 Ga0068857_100090270 3300005577 Bacteria 2742
112 Ga0068854_100053359 3300005578 Bacteria 2903
113 Ga0068854_100256641 3300005578 Bacteria 1398
114 Ga0068854_100632857 3300005578 Bacteria 917
115 Ga0068856_100046072 3300005614 Bacteria 4295
116 Ga0068852_100025327 3300005616 Bacteria 4806
117 Ga0068852_100043927 3300005616 Bacteria 3792
118 Ga0068852_100580865 3300005616 Bacteria 1123
119 Ga0068852_100751663 3300005616 Bacteria 987
120 Ga0068859_100006185 3300005617 Bacteria 12165
121 Ga0068859_100026306 3300005617 Bacteria 5833
122 Ga0068859_100070267 3300005617 Bacteria 3537
123 Ga0068859_100112412 3300005617 Bacteria 2787
124 Ga0068859_100598314 3300005617 Bacteria 1196
125 Ga0068859_100631535 3300005617 Bacteria 1163
126 Ga0068864_100013924 3300005618 Bacteria 6667
127 Ga0068864_100058315 3300005618 Bacteria 3336
128 Ga0068864_100313625 3300005618 Bacteria 1471
129 Ga0068866_10011165 3300005718 Bacteria 3876
130 Ga0068866_10300198 3300005718 Bacteria 1003
131 Ga0068866_10384637 3300005718 Bacteria 901
132 Ga0068866_10472733 3300005718 Unclassified 824
133 Ga0068861_100029586 3300005719 Bacteria 4008
134 Ga0068861_100180936 3300005719 Bacteria 1755
135 Ga0068861_100213166 3300005719 Bacteria 1628
136 Ga0068861_100402601 3300005719 Bacteria 1215
137 Ga0068851_10322816 3300005834 Unclassified 892
138 Ga0068870_10004910 3300005840 Bacteria 5789
139 Ga0068863_100009683 3300005841 Bacteria 9401
140 Ga0068863_100087180 3300005841 Bacteria 2958
141 Ga0068858_100084749 3300005842 Bacteria 2948
142 Ga0068858_100169770 3300005842 Bacteria 2056
143 Ga0068858_100359416 3300005842 Unclassified 1396
144 Ga0068860_100044525 3300005843 Bacteria 4230
145 Ga0068860_100045683 3300005843 Bacteria 4176
146 Ga0068860_100114124 3300005843 Bacteria 2583
147 Ga0068860_100270994 3300005843 Bacteria 1657
148 Ga0068862_100010136 3300005844 Bacteria 7779
149 Ga0068862_100419440 3300005844 Bacteria 1256
150 Ga0068862_100888758 3300005844 Unclassified 875
151 Ga0081539_10025801 3300005985 Unclassified 3769
152 Ga0075366_10104598 3300006195 Bacteria 1701
153 Ga0075366_10237898 3300006195 Unclassified 1110
154 Ga0097621_100040839 3300006237 Bacteria 3731
155 Ga0097621_100097104 3300006237 Bacteria 2473
156 Ga0097621_100481540 3300006237 Bacteria 1122
157 Ga0097621_100594684 3300006237 Bacteria 1011
158 Ga0068871_100002623 3300006358 Bacteria 12276
159 Ga0068871_100113554 3300006358 Bacteria 2281
160 Ga0068871_100117365 3300006358 Bacteria 2244
161 Ga0068871_100118650 3300006358 Unclassified 2232
162 Ga0075428_100009075 3300006844 Bacteria 11037
163 Ga0075428_100138857 3300006844 Bacteria 2642
164 Ga0075428_100323200 3300006844 Bacteria 1658
165 Ga0075428_100600372 3300006844 Bacteria 1176
166 Ga0075430_100013464 3300006846 Bacteria 6972
167 Ga0075431_100031956 3300006847 Bacteria 5423
168 Ga0075429_100002343 3300006880 Bacteria 15928
169 Ga0075429_100023258 3300006880 Bacteria 5375
170 Ga0068865_100046602 3300006881 Bacteria 2975
171 Ga0068865_100247449 3300006881 Bacteria 1405
172 Ga0068865_100381431 3300006881 Bacteria 1150
173 Ga0097620_100006185 3300006931 Bacteria 12165
174 Ga0097620_100026306 3300006931 Bacteria 5833
175 Ga0097620_100070270 3300006931 Bacteria 3537
176 Ga0097620_100112414 3300006931 Bacteria 2787
177 Ga0097620_100598273 3300006931 Bacteria 1196
178 Ga0097620_100631585 3300006931 Bacteria 1163
179 Ga0111539_10008708 3300009094 Bacteria 12873
180 Ga0111539_10174847 3300009094 Bacteria 2508
181 Ga0111539_10298322 3300009094 Bacteria 1876
182 Ga0114129_10020916 3300009147 Bacteria 9296
183 Ga0114129_10040254 3300009147 Bacteria 6588
184 Ga0114129_10451245 3300009147 Bacteria 1686
185 Ga0114129_10957913 3300009147 Bacteria 1080
186 Ga0105241_10010003 3300009174 Bacteria 6965
187 Ga0105241_10365016 3300009174 Bacteria 1257
188 Ga0105242_10008487 3300009176 Bacteria 7891
189 Ga0105248_10668845 3300009177 Bacteria 1171
190 Ga0105249_10000793 3300009553 Bacteria 28356
191 Ga0105249_10001595 3300009553 Bacteria 19863
192 Ga0105249_10015473 3300009553 Bacteria 6752
193 Ga0105249_10341725 3300009553 Bacteria 1514
194 Ga0105249_11004454 3300009553 Bacteria 903
195 Ga0105239_10000785 3300010375 Bacteria 45044
196 Ga0105239_10526741 3300010375 Bacteria 1345
197 Ga0105246_10083774 3300011119 Bacteria 2279
198 Ga0157373_10056381 3300013100 Bacteria 2791
199 Ga0157371_10089683 3300013102 Bacteria 2178
200 Ga0157371_10322382 3300013102 Bacteria 1121
201 Ga0157370_10066503 3300013104 Bacteria 3409
202 Ga0157369_10182144 3300013105 Bacteria 2210
203 Ga0157369_10272418 3300013105 Bacteria 1764
204 Ga0157374_10003864 3300013296 Bacteria 12575
205 Ga0157374_10006076 3300013296 Bacteria 10220
206 Ga0157378_10028805 3300013297 Bacteria 4903
207 Ga0157378_10205313 3300013297 Bacteria 1866
208 Ga0157378_10276665 3300013297 Bacteria 1616
209 Ga0157378_10296957 3300013297 Bacteria 1562
210 Ga0163162_10004527 3300013306 Bacteria 13386
211 Ga0163162_10196836 3300013306 Bacteria 2144
212 Ga0163162_10359361 3300013306 Unclassified 1589
213 Ga0163162_10395657 3300013306 Bacteria 1514
214 Ga0163162_10850270 3300013306 Bacteria 1028
215 Ga0163162_10899325 3300013306 Unclassified 999
216 Ga0157372_10024406 3300013307 Bacteria 6567
217 Ga0157372_10814454 3300013307 Unclassified 1084
218 Ga0157375_10002993 3300013308 Bacteria 14676
219 Ga0157375_10012293 3300013308 Bacteria 7591
220 Ga0157375_10156603 3300013308 Bacteria 2417
221 Ga0163163_10000638 3300014325 Bacteria 30140
222 Ga0163163_10090458 3300014325 Bacteria 3074
223 Ga0163163_10090723 3300014325 Bacteria 3069
224 Ga0163163_10093509 3300014325 Bacteria 3023
225 Ga0163163_10215604 3300014325 Bacteria 1968
226 Ga0163163_10395553 3300014325 Bacteria 1440
227 Ga0163163_10426028 3300014325 Bacteria 1386
228 Ga0157380_10226212 3300014326 Bacteria 1677
229 Ga0157380_10517368 3300014326 Bacteria 1163
230 Ga0157380_10584643 3300014326 Bacteria 1102
231 Ga0157377_10001241 3300014745 Bacteria 10911
232 Ga0157377_10041975 3300014745 Bacteria 2539
233 Ga0157377_10046112 3300014745 Bacteria 2436
234 Ga0157377_10150419 3300014745 Bacteria 1439
235 Ga0157377_10199259 3300014745 Bacteria 1270
236 Ga0157376_10016277 3300014969 Bacteria 5640
237 Ga0157376_10923147 3300014969 Bacteria 892
238 Ga0163161_10023022 3300017792 Bacteria 4390
239 Ga0163161_10074768 3300017792 Bacteria 2485
240 Ga0163161_10120304 3300017792 Bacteria 1972
241 Ga0163161_10216896 3300017792 Unclassified 1480
242 Ga0163161_10289823 3300017792 Bacteria 1286
243 Ga0163161_10359525 3300017792 Bacteria 1159
244 Ga0209646_1000823 3300025246 Bacteria 10466
245 Ga0209026_1004756 3300025250 Bacteria 3905
246 Ga0207697_10150784 3300025315 Bacteria 1011
247 Ga0207642_10049775 3300025899 Bacteria 1886
248 Ga0207642_10128071 3300025899 Bacteria 1320
249 Ga0207688_10053395 3300025901 Bacteria 2266
250 Ga0207645_10000198 3300025907 Bacteria 49061
251 Ga0207645_10068874 3300025907 Bacteria 2263
252 Ga0207645_10118678 3300025907 Bacteria 1716
253 Ga0207643_10092232 3300025908 Bacteria 1767
254 Ga0207705_10147429 3300025909 Bacteria 1761
255 Ga0207705_10170554 3300025909 Bacteria 1638
256 Ga0207654_10038120 3300025911 Bacteria 2695
257 Ga0207707_10125598 3300025912 Bacteria 2243
258 Ga0207695_10307006 3300025913 Bacteria 1477
259 Ga0207660_10029928 3300025917 Bacteria 3740
260 Ga0207662_10038858 3300025918 Bacteria 2790
261 Ga0207657_10010433 3300025919 Bacteria 9272
262 Ga0207657_10277320 3300025919 Bacteria 1332
263 Ga0207657_10424867 3300025919 Bacteria 1044
264 Ga0207649_10003693 3300025920 Bacteria 8353
265 Ga0207649_10167968 3300025920 Bacteria 1526
266 Ga0207681_10238112 3300025923 Bacteria 1415
267 Ga0207650_10368072 3300025925 Bacteria 1185
268 Ga0207659_10110475 3300025926 Bacteria 2089
269 Ga0207659_10120810 3300025926 Bacteria 2007
270 Ga0207659_10489076 3300025926 Bacteria 1040
271 Ga0207644_10055200 3300025931 Bacteria 2863
272 Ga0207644_10225925 3300025931 Bacteria 1486
273 Ga0207644_10520047 3300025931 Bacteria 983
274 Ga0207690_10256751 3300025932 Unclassified 1352
275 Ga0207706_10016717 3300025933 Bacteria 6622
276 Ga0207706_10025224 3300025933 Bacteria 5329
277 Ga0207706_10033849 3300025933 Bacteria 4548
278 Ga0207686_10016163 3300025934 Bacteria 4183
279 Ga0207686_10099879 3300025934 Bacteria 1935
280 Ga0207686_10232918 3300025934 Bacteria 1336
281 Ga0207670_10537656 3300025936 Bacteria 953
282 Ga0207669_10407207 3300025937 Bacteria 1067
283 Ga0207704_10073019 3300025938 Bacteria 2183
284 Ga0207704_10118008 3300025938 Bacteria 1809
285 Ga0207691_10007801 3300025940 Bacteria 10305
286 Ga0207691_10019046 3300025940 Bacteria 6500
287 Ga0207691_10124504 3300025940 Bacteria 2282
288 Ga0207691_10299346 3300025940 Bacteria 1382
289 Ga0207691_10362465 3300025940 Bacteria 1239
290 Ga0207691_10373189 3300025940 Unclassified 1218
291 Ga0207689_10002649 3300025942 Bacteria 16555
292 Ga0207689_10026003 3300025942 Bacteria 4901
293 Ga0207689_10027272 3300025942 Bacteria 4782
294 Ga0207689_10030256 3300025942 Bacteria 4512
295 Ga0207689_10040088 3300025942 Bacteria 3877
296 Ga0207689_10046577 3300025942 Bacteria 3583
297 Ga0207689_10074631 3300025942 Bacteria 2786
298 Ga0207689_10194399 3300025942 Bacteria 1674
299 Ga0207661_10005964 3300025944 Bacteria 8602
300 Ga0207679_10001246 3300025945 Bacteria 16165
301 Ga0207679_10139399 3300025945 Bacteria 1958
302 Ga0207679_10333463 3300025945 Unclassified 1317
303 Ga0207679_10421305 3300025945 Bacteria 1178
304 Ga0207667_10050436 3300025949 Bacteria 4391
305 Ga0207667_10488840 3300025949 Bacteria 1249
306 Ga0207651_10035923 3300025960 Bacteria 3229
307 Ga0207651_10056188 3300025960 Bacteria 2708
308 Ga0207651_10663211 3300025960 Bacteria 916
309 Ga0207712_10001144 3300025961 Bacteria 18474
310 Ga0207712_10056695 3300025961 Bacteria 2761
311 Ga0207712_10342812 3300025961 Bacteria 1240
312 Ga0207668_10092153 3300025972 Bacteria 2229
313 Ga0207668_10092222 3300025972 Bacteria 2229
314 Ga0207668_10365428 3300025972 Bacteria 1210
315 Ga0207640_10053554 3300025981 Bacteria 2634
316 Ga0207640_10084206 3300025981 Bacteria 2183
317 Ga0207658_10020456 3300025986 Bacteria 4582
318 Ga0207658_10450203 3300025986 Bacteria 1140
319 Ga0207677_10103453 3300026023 Bacteria 2102
320 Ga0207703_10142805 3300026035 Bacteria 2079
321 Ga0207703_10438414 3300026035 Bacteria 1218
322 Ga0207639_10015785 3300026041 Bacteria 5331
323 Ga0207639_10017081 3300026041 Bacteria 5141
324 Ga0207639_10148431 3300026041 Bacteria 1961
325 Ga0207639_10293370 3300026041 Bacteria 1435
326 Ga0207678_10131081 3300026067 Unclassified 2138
327 Ga0207708_10029692 3300026075 Bacteria 4144
328 Ga0207708_10245116 3300026075 Bacteria 1442
329 Ga0207641_10001688 3300026088 Bacteria 21481
330 Ga0207641_10046151 3300026088 Bacteria 3671
331 Ga0207641_10076449 3300026088 Bacteria 2895
332 Ga0207641_10105993 3300026088 Unclassified 2484
333 Ga0207641_10329503 3300026088 Bacteria 1450
334 Ga0207641_10658136 3300026088 Bacteria 1029
335 Ga0207648_10001098 3300026089 Bacteria 30333
336 Ga0207648_10001588 3300026089 Bacteria 24911
337 Ga0207648_10061867 3300026089 Bacteria 3264
338 Ga0207648_10506948 3300026089 Bacteria 1105
339 Ga0207676_10001837 3300026095 Bacteria 15555
340 Ga0207676_10119282 3300026095 Bacteria 2222
341 Ga0207676_10176207 3300026095 Bacteria 1868
342 Ga0207676_10316765 3300026095 Bacteria 1430
343 Ga0207676_10475564 3300026095 Bacteria 1182
344 Ga0207674_10003775 3300026116 Bacteria 18479
345 Ga0207674_10009770 3300026116 Bacteria 10929
346 Ga0207674_10103276 3300026116 Bacteria 2830
347 Ga0207674_10127926 3300026116 Bacteria 2505
348 Ga0207674_10130640 3300026116 Bacteria 2475
349 Ga0207675_100168857 3300026118 Bacteria 2090
350 Ga0207675_100190721 3300026118 Bacteria 1966
351 Ga0207675_100208540 3300026118 Bacteria 1879
352 Ga0207675_100424578 3300026118 Bacteria 1313
353 Ga0207675_100480643 3300026118 Bacteria 1235
354 Ga0207683_10005504 3300026121 Bacteria 10855
355 Ga0207683_10005521 3300026121 Bacteria 10838
356 Ga0207683_10075759 3300026121 Bacteria 2979
357 Ga0207698_10030889 3300026142 Bacteria 3859
358 Ga0207698_10476962 3300026142 Bacteria 1209
359 Ga0207428_10302274 3300027907 Bacteria 1184
360 Ga0207428_10326595 3300027907 Bacteria 1132
361 Ga0268266_10090429 3300028379 Bacteria 2683
362 Ga0268265_10008645 3300028380 Bacteria 6883
363 Ga0268265_10057422 3300028380 Bacteria 2966
364 Ga0268265_10109219 3300028380 Bacteria 2254
365 Ga0268265_10614846 3300028380 Bacteria 1040
366 Ga0268265_10818015 3300028380 Unclassified 909
367 Ga0268264_10026700 3300028381 Bacteria 4718
368 Ga0268264_10045548 3300028381 Unclassified 3642
369 Ga0268264_10259270 3300028381 Bacteria 1619
370 Ga0268264_10331458 3300028381 Unclassified 1442
371 Ga0268264_10589985 3300028381 Bacteria 1094
372 Ga0265336_10012725 3300028666 Bacteria 2824
373 Ga0307515_10000001 3300028794 Bacteria 4259510
374 Ga0316181_1260784 3300030744 Bacteria 3122
375 Ga0265327_10000653 3300031251 Bacteria 55957
376 Ga0265327_10102114 3300031251 Bacteria 1382
377 Ga0307513_10234576 3300031456 Bacteria 1645
378 Ga0307513_10549165 3300031456 Bacteria 868
379 Ga0307509_10046016 3300031507 Bacteria 4700
380 Ga0307414_10006832 3300032004 Bacteria 6383
381 Ga0307414_10516085 3300032004 Bacteria 1060
382 Ga0307414_10859528 3300032004 Bacteria 830
383 Ga0307415_100509900 3300032126 Bacteria 1053
384 Ga0373924_0049645 3300035410 Bacteria 1737
385 Ga0395905_0000001 3300037471 Bacteria 2037079
386 Ga0400483_030081 3300039062 Bacteria 20143
387 Ga0400487_59732 3300039110 Bacteria 1191
388 Ga0436365_1363765 3300039437 Unclassified 1278
389 Ga0439436_0009050 3300041404 Bacteria 3054
390 Ga0439439_0056775 3300041406 Bacteria 1035
391 Ga0439466_0083064 3300041411 Bacteria 1009
392 Ga0451807_0660225 3300041486 Bacteria 708
393 Ga0451841_0873702 3300041498 Bacteria 1573
394 Ga0451853_1953455 3300041512 Bacteria 2063
395 Ga0439431_0013647 3300041997 Bacteria 1876
396 Ga0439449_0016656 3300042007 Bacteria 2761
397 Ga0439434_0022189 3300042435 Bacteria 1908
398 Ga0450893_0019352 3300042532 Unclassified 1165
399 Ga0466969_0000584 3300044656 Bacteria 19813
400 Ga0466969_0145033 3300044656 Bacteria 1096
401 Ga0466972_0000002 3300044658 Bacteria 408005
402 Ga0466972_0000207 3300044658 Bacteria 42277
403 Ga0466972_0022051 3300044658 Bacteria 3171
404 Ga0466966_0001667 3300044684 Bacteria 14318
405 Ga0466968_0072569 3300044735 Bacteria 1501
406 Ga0466968_0167652 3300044735 Unclassified 1016
407 Ga0466970_0004535 3300044765 Bacteria 6851
408 Ga0466957_0015206 3300044842 Bacteria 4493
409 Ga0466959_0000002 3300045049 Bacteria 362671
410 Ga0495629_0280345 3300046459 Unclassified 1144
411 Ga0495638_0060598 3300046460 Bacteria 2340
412 Ga0495580_0177631 3300046472 Bacteria 1471
413 Ga0495594_0215566 3300046499 Bacteria 1095
414 Ga0495608_0074134 3300046511 Bacteria 2219
415 Ga0495654_0002245 3300046530 Bacteria 12513
416 Ga0495621_0043287 3300046539 Unclassified 1588
417 Ga0495621_0164247 3300046539 Bacteria 880
418 Ga0495667_0253000 3300046559 Bacteria 1121
419 Ga0495635_0299290 3300046663 Bacteria 1079
420 Ga0495657_0137581 3300046675 Bacteria 1525
421 Ga0495613_0384172 3300046689 Bacteria 960
422 Ga0495604_0339234 3300047317 Bacteria 1001
423 Ga0495672_0012314 3300047320 Bacteria 5977
424 Ga0496111_0449648 3300048914 Unclassified 951
425 Ga0496112_0790736 3300048915 Bacteria 874
426 Ga0496112_0885699 3300048915 Bacteria 815
427 Ga0501298_009609 3300049521 Bacteria 1649
428 Ga0501031_0078352 3300049568 Bacteria 2153
429 Ga0501032_0048820 3300049569 Bacteria 2857
430 Ga0501034_0000373 3300049571 Bacteria 76337
431 Ga0501034_0003972 3300049571 Bacteria 16617
432 Ga0501034_0201661 3300049571 Bacteria 1947
433 Ga0501034_0747329 3300049571 Bacteria 874
434 Ga0501036_0033100 3300049572 Bacteria 4371
435 Ga0501036_0112705 3300049572 Bacteria 2298
436 Ga0501037_0034422 3300049573 Bacteria 3738
437 Ga0501038_0071340 3300049574 Bacteria 2946
438 Ga0501039_0067294 3300049575 Bacteria 2781
439 Ga0501039_0245348 3300049575 Bacteria 1408
440 Ga0501043_0011803 3300049579 Bacteria 6842
441 Ga0501043_0026367 3300049579 Bacteria 4559
442 Ga0501043_0281803 3300049579 Bacteria 1274
443 Ga0501046_0013494 3300049580 Bacteria 6916
444 Ga0501047_0066203 3300049581 Bacteria 3482
445 Ga0501047_0089459 3300049581 Bacteria 2956
446 Ga0501047_0240460 3300049581 Bacteria 1661
447 Ga0501047_0633617 3300049581 Unclassified 889
448 Ga0501068_0440697 3300049584 Bacteria 842
449 Ga0501070_0051022 3300049586 Bacteria 3434
450 Ga0501073_0020586 3300049589 Bacteria 4757
451 Ga0501074_0032382 3300049590 Bacteria 3787
452 Ga0501202_003845 3300049652 Bacteria 2593
453 Ga0501207_018775 3300049654 Bacteria 1090
454 Ga0501209_056665 3300049656 Bacteria 1083
455 Ga0501245_004029 3300049708 Bacteria 2010
456 Ga0501080_0409265 3300049742 Bacteria 1219
457 Ga0501035_0073516 3300049822 Unclassified 3025
458 Ga0501035_0081536 3300049822 Bacteria 2855
459 Ga0501035_0606598 3300049822 Unclassified 891
460 Ga0501044_0004343 3300049823 Bacteria 15878
461 Ga0501044_0014178 3300049823 Bacteria 8607
462 Ga0501044_0041422 3300049823 Bacteria 4794
463 Ga0501045_0185754 3300049824 Bacteria 1549
464 nmdc:mga0k408_369285_c1 3300050493 Unclassified 855
465 nmdc:mga05p37_1116023_c1 3300050507 Bacteria 824
466 nmdc:mga05p37_5498_c1 3300050507 Bacteria 14884
467 nmdc:mga05p37_74163_c1 3300050507 Bacteria 4188
468 nmdc:mga09592_3240_c1 3300050508 Bacteria 13165
469 nmdc:mga0qj67_396353_c1 3300050509 Bacteria 1114
470 nmdc:mga0qj67_5946_c1 3300050509 Bacteria 8940
471 nmdc:mga06r32_9171_c1 3300050510 Bacteria 8917
472 nmdc:mga08y16_189393_c1 3300050511 Bacteria 2134
473 nmdc:mga08y16_9431_c1 3300050511 Bacteria 10235
474 nmdc:mga0n895_31242_c1 3300050512 Bacteria 5097
475 Ga0500578_0000694 3300053086 Bacteria 40191
476 Ga0500644_0007384 3300053088 Bacteria 2861
477 Ga0500646_0003559 3300053090 Bacteria 3988
478 Ga0500646_0074546 3300053090 Bacteria 1024
479 Ga0500583_0000059 3300053092 Bacteria 68222
480 Ga0500650_0162679 3300053098 Bacteria 1029
481 Ga0500562_000050 3300053108 Bacteria 60058
482 Ga0500594_0022262 3300053118 Bacteria 1597
483 Ga0500652_006834 3300053131 Bacteria 3698
484 Ga0500568_0001817 3300053139 Bacteria 13149
485 Ga0500622_0000369 3300053156 Bacteria 43342
486 Ga0500639_153539 3300053163 Bacteria 1058
487 Ga0500636_0052089 3300053177 Bacteria 2405
488 Ga0500611_000034 3300053727 Bacteria 78957
489 Ga0500645_074947 3300053730 Bacteria 969
490 Ga0500661_002599 3300055283 Bacteria 3411
491 2738727055 2738541278 Bacteria 9755573
492 2929157408 2929154850 Bacteria 6753285
493 Ga0070680_100026482
494 MBSR1b_contig_11194412
495 MBSR1b_contig_993991
496 JGI25406J46586_10040429
497 rootH1_10016176
498 rootH2_10014715
499 rootL2_10127900
500 rootL2_10180833
501 rootH1_10047229
502 rootH1_10092516
503 rootH1_10181683
504 Ga0065712_10239225
505 Ga0065715_10033795
506 Ga0065707_10091965
507 Ga0065707_10198086
508 Ga0070658_10009494
509 Ga0070676_10008172
510 Ga0070676_10059395
511 Ga0070676_10069916
512 Ga0070683_100006986
513 Ga0070683_100409143
514 Ga0070690_100006303
515 Ga0070690_100177839
516 Ga0070670_100243454
517 Ga0070677_10048053
518 Ga0068869_100008744
519 Ga0068869_100011711
520 Ga0068869_100017642
521 Ga0068869_100041124
522 Ga0068869_100072513
523 Ga0068869_100087984
524 Ga0068869_100203118
525 Ga0070666_10025373
526 Ga0070666_10030159
527 Ga0070682_100000060
528 Ga0068868_100008427
529 Ga0068868_100034694
530 Ga0068868_100181261
531 Ga0070689_100005879
532 Ga0070689_100225913
533 Ga0070661_100002662
534 Ga0070661_100018099
535 Ga0070661_100199346
536 Ga0070668_100024630
537 Ga0070668_100027619
538 Ga0070668_100031183
539 Ga0070669_100024003
540 Ga0070675_100001080
541 Ga0070675_100018497
542 Ga0070675_100384957
543 Ga0070675_100398307
544 Ga0070671_100191238
545 Ga0070671_100314553
546 Ga0070671_100429164
547 Ga0070674_100491637
548 Ga0070673_100019624
549 Ga0070673_100021448
550 Ga0070673_100096124
551 Ga0070673_100121058
552 Ga0070673_100295853
553 Ga0070673_100415886
554 Ga0070688_100005132
555 Ga0070688_100010004
556 Ga0070688_100048232
557 Ga0070688_100059275
558 Ga0070659_100036280
559 Ga0070667_100027322
560 Ga0070667_100129541
561 Ga0070701_10169171
562 Ga0070700_100037485
563 Ga0070663_100355506
564 Ga0070663_100366877
565 Ga0070678_100011522
566 Ga0070678_100031734
567 Ga0070678_100054184
568 Ga0070662_100002753
569 Ga0070662_100023515
570 Ga0070681_10136234
571 Ga0068867_100031909
572 Ga0068867_100098577
573 Ga0068867_100190445
574 Ga0070685_10050704
575 Ga0070685_10064140
576 Ga0070685_10313108
577 Ga0070707_100104556
578 Ga0070698_100000392
579 Ga0070698_100018803
580 Ga0070698_100208592
581 Ga0070679_100224166
582 Ga0070684_100003098
583 Ga0070684_100013922
584 Ga0070684_100573722
585 Ga0068853_100011236
586 Ga0068853_100032494
587 Ga0068853_100039849
588 Ga0070672_100129121
589 Ga0070672_100363316
590 Ga0070672_100570597
591 Ga0070686_100336390
592 Ga0068855_100004630
593 Ga0068855_100126797
594 Ga0068855_100350853
595 Ga0070664_100011313
596 Ga0070664_100048452
597 Ga0070664_100169239
598 Ga0068857_100010396
599 Ga0068857_100010473
600 Ga0068857_100024908
601 Ga0068857_100074551
602 Ga0068857_100090270
603 Ga0068854_100053359
604 Ga0068854_100256641
605 Ga0068854_100632857
606 Ga0068856_100046072
607 Ga0068852_100025327
608 Ga0068852_100043927
609 Ga0068852_100580865
610 Ga0068852_100751663
611 Ga0068859_100006185
612 Ga0068859_100026306
613 Ga0068859_100070267
614 Ga0068859_100112412
615 Ga0068859_100598314
616 Ga0068859_100631535
617 Ga0068864_100013924
618 Ga0068864_100058315
619 Ga0068864_100313625
620 Ga0068866_10011165
621 Ga0068866_10300198
622 Ga0068866_10384637
623 Ga0068866_10472733
624 Ga0068861_100029586
625 Ga0068861_100180936
626 Ga0068861_100213166
627 Ga0068861_100402601
628 Ga0068851_10322816
629 Ga0068870_10004910
630 Ga0068863_100009683
631 Ga0068863_100087180
632 Ga0068858_100084749
633 Ga0068858_100169770
634 Ga0068858_100359416
635 Ga0068860_100044525
636 Ga0068860_100045683
637 Ga0068860_100114124
638 Ga0068860_100270994
639 Ga0068862_100010136
640 Ga0068862_100419440
641 Ga0068862_100888758
642 Ga0081539_10025801
643 Ga0075366_10104598
644 Ga0075366_10237898
645 Ga0097621_100040839
646 Ga0097621_100097104
647 Ga0097621_100481540
648 Ga0097621_100594684
649 Ga0068871_100002623
650 Ga0068871_100113554
651 Ga0068871_100117365
652 Ga0068871_100118650
653 Ga0075428_100009075
654 Ga0075428_100138857
655 Ga0075428_100323200
656 Ga0075428_100600372
657 Ga0075430_100013464
658 Ga0075431_100031956
659 Ga0075429_100002343
660 Ga0075429_100023258
661 Ga0068865_100046602
662 Ga0068865_100247449
663 Ga0068865_100381431
664 Ga0097620_100006185
665 Ga0097620_100026306
666 Ga0097620_100070270
667 Ga0097620_100112414
668 Ga0097620_100598273
669 Ga0097620_100631585
670 Ga0111539_10008708
671 Ga0111539_10174847
672 Ga0111539_10298322
673 Ga0114129_10020916
674 Ga0114129_10040254
675 Ga0114129_10451245
676 Ga0114129_10957913
677 Ga0105241_10010003
678 Ga0105241_10365016
679 Ga0105242_10008487
680 Ga0105248_10668845
681 Ga0105249_10000793
682 Ga0105249_10001595
683 Ga0105249_10015473
684 Ga0105249_10341725
685 Ga0105249_11004454
686 Ga0105239_10000785
687 Ga0105239_10526741
688 Ga0105246_10083774
689 Ga0157373_10056381
690 Ga0157371_10089683
691 Ga0157371_10322382
692 Ga0157370_10066503
693 Ga0157369_10182144
694 Ga0157369_10272418
695 Ga0157374_10003864
696 Ga0157374_10006076
697 Ga0157378_10028805
698 Ga0157378_10205313
699 Ga0157378_10276665
700 Ga0157378_10296957
701 Ga0163162_10004527
702 Ga0163162_10196836
703 Ga0163162_10359361
704 Ga0163162_10395657
705 Ga0163162_10850270
706 Ga0163162_10899325
707 Ga0157372_10024406
708 Ga0157372_10814454
709 Ga0157375_10002993
710 Ga0157375_10012293
711 Ga0157375_10156603
712 Ga0163163_10000638
713 Ga0163163_10090458
714 Ga0163163_10090723
715 Ga0163163_10093509
716 Ga0163163_10215604
717 Ga0163163_10395553
718 Ga0163163_10426028
719 Ga0157380_10226212
720 Ga0157380_10517368
721 Ga0157380_10584643
722 Ga0157377_10001241
723 Ga0157377_10041975
724 Ga0157377_10046112
725 Ga0157377_10150419
726 Ga0157377_10199259
727 Ga0157376_10016277
728 Ga0157376_10923147
729 Ga0163161_10023022
730 Ga0163161_10074768
731 Ga0163161_10120304
732 Ga0163161_10216896
733 Ga0163161_10289823
734 Ga0163161_10359525
735 Ga0209646_1000823
736 Ga0209026_1004756
737 Ga0207697_10150784
738 Ga0207642_10049775
739 Ga0207642_10128071
740 Ga0207688_10053395
741 Ga0207645_10000198
742 Ga0207645_10068874
743 Ga0207645_10118678
744 Ga0207643_10092232
745 Ga0207705_10147429
746 Ga0207705_10170554
747 Ga0207654_10038120
748 Ga0207707_10125598
749 Ga0207695_10307006
750 Ga0207660_10029928
751 Ga0207662_10038858
752 Ga0207657_10010433
753 Ga0207657_10277320
754 Ga0207657_10424867
755 Ga0207649_10003693
756 Ga0207649_10167968
757 Ga0207681_10238112
758 Ga0207650_10368072
759 Ga0207659_10110475
760 Ga0207659_10120810
761 Ga0207659_10489076
762 Ga0207644_10055200
763 Ga0207644_10225925
764 Ga0207644_10520047
765 Ga0207690_10256751
766 Ga0207706_10016717
767 Ga0207706_10025224
768 Ga0207706_10033849
769 Ga0207686_10016163
770 Ga0207686_10099879
771 Ga0207686_10232918
772 Ga0207670_10537656
773 Ga0207669_10407207
774 Ga0207704_10073019
775 Ga0207704_10118008
776 Ga0207691_10007801
777 Ga0207691_10019046
778 Ga0207691_10124504
779 Ga0207691_10299346
780 Ga0207691_10362465
781 Ga0207691_10373189
782 Ga0207689_10002649
783 Ga0207689_10026003
784 Ga0207689_10027272
785 Ga0207689_10030256
786 Ga0207689_10040088
787 Ga0207689_10046577
788 Ga0207689_10074631
789 Ga0207689_10194399
790 Ga0207661_10005964
791 Ga0207679_10001246
792 Ga0207679_10139399
793 Ga0207679_10333463
794 Ga0207679_10421305
795 Ga0207667_10050436
796 Ga0207667_10488840
797 Ga0207651_10035923
798 Ga0207651_10056188
799 Ga0207651_10663211
800 Ga0207712_10001144
801 Ga0207712_10056695
802 Ga0207712_10342812
803 Ga0207668_10092153
804 Ga0207668_10092222
805 Ga0207668_10365428
806 Ga0207640_10053554
807 Ga0207640_10084206
808 Ga0207658_10020456
809 Ga0207658_10450203
810 Ga0207677_10103453
811 Ga0207703_10142805
812 Ga0207703_10438414
813 Ga0207639_10015785
814 Ga0207639_10017081
815 Ga0207639_10148431
816 Ga0207639_10293370
817 Ga0207678_10131081
818 Ga0207708_10029692
819 Ga0207708_10245116
820 Ga0207641_10001688
821 Ga0207641_10046151
822 Ga0207641_10076449
823 Ga0207641_10105993
824 Ga0207641_10329503
825 Ga0207641_10658136
826 Ga0207648_10001098
827 Ga0207648_10001588
828 Ga0207648_10061867
829 Ga0207648_10506948
830 Ga0207676_10001837
831 Ga0207676_10119282
832 Ga0207676_10176207
833 Ga0207676_10316765
834 Ga0207676_10475564
835 Ga0207674_10003775
836 Ga0207674_10009770
837 Ga0207674_10103276
838 Ga0207674_10127926
839 Ga0207674_10130640
840 Ga0207675_100168857
841 Ga0207675_100190721
842 Ga0207675_100208540
843 Ga0207675_100424578
844 Ga0207675_100480643
845 Ga0207683_10005504
846 Ga0207683_10005521
847 Ga0207683_10075759
848 Ga0207698_10030889
849 Ga0207698_10476962
850 Ga0207428_10302274
851 Ga0207428_10326595
852 Ga0268266_10090429
853 Ga0268265_10008645
854 Ga0268265_10057422
855 Ga0268265_10109219
856 Ga0268265_10614846
857 Ga0268265_10818015
858 Ga0268264_10026700
859 Ga0268264_10045548
860 Ga0268264_10259270
861 Ga0268264_10331458
862 Ga0268264_10589985
863 Ga0265336_10012725
864 Ga0307515_10000001
865 Ga0316181_1260784
866 Ga0265327_10000653
867 Ga0265327_10102114
868 Ga0307513_10234576
869 Ga0307513_10549165
870 Ga0307509_10046016
871 Ga0307414_10006832
872 Ga0307414_10516085
873 Ga0307414_10859528
874 Ga0307415_100509900
875 Ga0373924_0049645
876 Ga0395905_0000001
877 Ga0400483_030081
878 Ga0400487_59732
879 Ga0436365_1363765
880 Ga0439436_0009050
881 Ga0439439_0056775
882 Ga0439466_0083064
883 Ga0451807_0660225
884 Ga0451841_0873702
885 Ga0451853_1953455
886 Ga0439431_0013647
887 Ga0439449_0016656
888 Ga0439434_0022189
889 Ga0450893_0019352
890 Ga0466969_0000584
891 Ga0466969_0145033
892 Ga0466972_0000002
893 Ga0466972_0000207
894 Ga0466972_0022051
895 Ga0466966_0001667
896 Ga0466968_0072569
897 Ga0466968_0167652
898 Ga0466970_0004535
899 Ga0466957_0015206
900 Ga0466959_0000002
901 Ga0495629_0280345
902 Ga0495638_0060598
903 Ga0495580_0177631
904 Ga0495594_0215566
905 Ga0495608_0074134
906 Ga0495654_0002245
907 Ga0495621_0043287
908 Ga0495621_0164247
909 Ga0495667_0253000
910 Ga0495635_0299290
911 Ga0495657_0137581
912 Ga0495613_0384172
913 Ga0495604_0339234
914 Ga0495672_0012314
915 Ga0496111_0449648
916 Ga0496112_0790736
917 Ga0496112_0885699
918 Ga0501298_009609
919 Ga0501031_0078352
920 Ga0501032_0048820
921 Ga0501034_0000373
922 Ga0501034_0003972
923 Ga0501034_0201661
924 Ga0501034_0747329
925 Ga0501036_0033100
926 Ga0501036_0112705
927 Ga0501037_0034422
928 Ga0501038_0071340
929 Ga0501039_0067294
930 Ga0501039_0245348
931 Ga0501043_0011803
932 Ga0501043_0026367
933 Ga0501043_0281803
934 Ga0501046_0013494
935 Ga0501047_0066203
936 Ga0501047_0089459
937 Ga0501047_0240460
938 Ga0501047_0633617
939 Ga0501068_0440697
940 Ga0501070_0051022
941 Ga0501073_0020586
942 Ga0501074_0032382
943 Ga0501202_003845
944 Ga0501207_018775
945 Ga0501209_056665
946 Ga0501245_004029
947 Ga0501080_0409265
948 Ga0501035_0073516
949 Ga0501035_0081536
950 Ga0501035_0606598
951 Ga0501044_0004343
952 Ga0501044_0014178
953 Ga0501044_0041422
954 Ga0501045_0185754
955 nmdc:mga0k408_369285_c1
956 nmdc:mga05p37_1116023_c1
957 nmdc:mga05p37_5498_c1
958 nmdc:mga05p37_74163_c1
959 nmdc:mga09592_3240_c1
960 nmdc:mga0qj67_396353_c1
961 nmdc:mga0qj67_5946_c1
962 nmdc:mga06r32_9171_c1
963 nmdc:mga08y16_189393_c1
964 nmdc:mga08y16_9431_c1
965 nmdc:mga0n895_31242_c1
966 Ga0500578_0000694
967 Ga0500644_0007384
968 Ga0500646_0003559
969 Ga0500646_0074546
970 Ga0500583_0000059
971 Ga0500650_0162679
972 Ga0500562_000050
973 Ga0500594_0022262
974 Ga0500652_006834
975 Ga0500568_0001817
976 Ga0500622_0000369
977 Ga0500639_153539
978 Ga0500636_0052089
979 Ga0500611_000034
980 Ga0500645_074947
981 Ga0500661_002599
982 2738727055
983 2929157408

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03740

PdxJ

Pyridoxal phosphate biosynthesis protein PdxJ

3

238

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
6w6a-assembly1.cif.gz_A crystal structure of a pyridoxine 5'-phosphate synthease from stenotrophomonas maltophilia k279a 0.9661 1 237
1ixo-assembly3.cif.gz_A-2 enzyme-analogue substrate complex of pyridoxine 5'-phosphate synthase 0.9598 2 238
6w6a-assembly1.cif.gz_A crystal structure of a pyridoxine 5'-phosphate synthease from stenotrophomonas maltophilia k279a 0.9543 1 237
3f4n-assembly5.cif.gz_B crystal structure of pyridoxal phosphate biosynthetic protein pdxj from yersinia pestis 0.9507 1 238
6w6a-assembly1.cif.gz_B crystal structure of a pyridoxine 5'-phosphate synthease from stenotrophomonas maltophilia k279a 0.9435 1 237
ID Description Score Start End Superfamily
3gk0A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9411 2 238 3.20.20.70
3gk0A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9229 2 238 3.20.20.70
3o6cA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.887 1 239 3.20.20.70
3o6cA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8835 1 239 3.20.20.70
3t40A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8501 2 233 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A4Q5YDM7-F1-model_v4 Pyridoxine 5'-phosphate synthase (EC 2.6.99.2) 0.9962 1 161 GO:0005829
GO:0008615
GO:0033856
AF-A0A520D9Z4-F1-model_v4 Pyridoxine 5'-phosphate synthase (EC 2.6.99.2) 0.9929 1 155 GO:0005829
GO:0008615
GO:0033856
AF-A0A355IIC1-F1-model_v4 deleted 0.9913 1 237
AF-A0A644VIA1-F1-model_v4 Pyridoxine 5'-phosphate synthase (EC 2.6.99.2) 0.991 1 239 GO:0005829
GO:0008615
GO:0033856
AF-A0A0K8R1V2-F1-model_v4 Pyridoxine 5'-phosphate synthase (PNP synthase) (EC 2.6.99.2) 0.991 1 239 GO:0005829
GO:0008615
GO:0033856

Map