metagRoot

F454058

General Info

Members	Datasets	Scaffolds	Average Seq Length
491	235	483	312

Family's Representative Sequence

Representative Sequence	3300005366\|Ga0070659_100015370\|Ga0070659_1000153706
Length	364
Sequence	MPKGFFSYYIFRLRSKISKLKIPSLVEKNIFLRSATNGFYYLQNFIRTFASYFINMNSIIFPDQTDFYKGKVRDVYTINDRLLVMIASNRISAFDVILPKPIPNKGQVLNQVAAHMLNATKDICKNWLLTTPAPNVSIGKKCDPFKVEMVVRGNVTGHAWRTYSSGEKILCGVKMPEGLRENDYFPEPIITPSTKAAEGHDEDISKEEIIRRKIVGKEDYEQLEKYALKLFARGKELAAKRGLILVDTKYEFGKLGDEIILIDEIHTPDSSRYFYADGFEKRQSKGEKQKQLSKEFVREWLIENNFMGKENQHVPEMSDEWISVIRNRYIELYEKLIGEKFVPQTLSDEETKERIIASLNDLKM

Samples

	Sample ID	Description	Type	Environment
1	2162886007	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1	Metagenome	Rhizosphere
2	2818991442	Chitinophaga pinensis 1204	Isolate	Unclassified
3	2818991444	Filimonas endophytica 3197	Isolate	Unclassified
4	2818991460	Chitinophaga polysaccharea 1209	Isolate	Unclassified
5	2881955468	Edaphocola flava HME-24	Isolate	Rhizosphere
6	2884791551	Chitinophaga oryzae 1310	Isolate	Unclassified
7	2896085136	Chitinophaga alhagiae T22	Isolate	Unclassified
8	2914759650	Rhizosphaericola mali	Isolate	Rhizosphere
9	2929921140	Chitinophaga sp. R-72609 Hybrid assembly	Isolate	Unclassified
10	3300001979	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6	Metagenome	Rhizosphere
11	3300001989	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5	Metagenome	Rhizosphere
12	3300002459	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6	Metagenome	Rhizosphere
13	3300003203	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
14	3300003322	Sugarcane root Sample L2	Metagenome	Unclassified
15	3300003323	Sugarcane root Sample H1	Metagenome	Unclassified
16	3300003354	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS	Metagenome	Endosphere
17	3300003771	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2	Metagenome	Endosphere
18	3300003790	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2	Metagenome	Endosphere
19	3300003791	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2	Metagenome	Endosphere
20	3300003794	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2	Metagenome	Endosphere
21	3300005262	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3)	Metagenome	Endosphere
22	3300005289	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2)	Metagenome	Rhizosphere
23	3300005290	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3)	Metagenome	Rhizosphere
24	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
25	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
26	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
27	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
28	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
29	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
30	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
31	3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Metagenome	Rhizosphere
32	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
33	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
34	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
35	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
36	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
37	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
38	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
39	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
40	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
41	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
42	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
43	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
44	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
45	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
46	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
47	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
48	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
49	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
50	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
51	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
52	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
53	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
54	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
55	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
56	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
57	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
58	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
59	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
60	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
61	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
62	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
63	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
64	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
65	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
66	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
67	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
68	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
69	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
70	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
71	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
72	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
73	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
74	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
75	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
76	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
77	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
78	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
79	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
80	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
81	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
82	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
83	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
84	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
85	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
86	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
87	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
88	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
89	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
90	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
91	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
92	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
93	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
94	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
95	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
96	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
97	3300015265	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG	Metagenome	Rhizosphere
98	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
99	3300025208	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2)	Metagenome	Endosphere
100	3300025273	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3)	Metagenome	Endosphere
101	3300025295	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3)	Metagenome	Endosphere
102	3300025297	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2)	Metagenome	Endosphere
103	3300025298	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
104	3300025302	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
105	3300025304	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
106	3300025893	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
107	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
108	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
109	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
110	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
111	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
112	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
113	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
114	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
115	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
116	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
117	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
118	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
119	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
120	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
121	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
122	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
123	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
124	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
126	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
127	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
128	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
129	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
130	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
131	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
132	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
133	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
134	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
135	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
136	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
137	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
138	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
139	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
140	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
141	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
142	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
143	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
144	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
145	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
146	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
147	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
148	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
149	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
150	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
151	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
152	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
153	3300028573	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG	Metagenome	Rhizosphere
154	3300028800	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG	Metagenome	Rhizosphere
155	3300031250	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG	Metagenome	Rhizosphere
156	3300031251	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG	Metagenome	Rhizosphere
157	3300031711	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG	Metagenome	Rhizosphere
158	3300031727	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5	Metagenome	Rhizosphere
159	3300033180	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM	Metagenome	Unclassified
160	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
161	3300037312	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2	Metagenome	Rhizosphere
162	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
163	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
164	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
165	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
166	3300039093	Seagrass microbial communities from Seahorse Key, FL, USA - TH0818	Metagenome	Unclassified
167	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
168	3300041413	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839	Metagenome	Rhizosphere
169	3300041443	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG	Metagenome	Rhizoplane
170	3300041456	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG	Metagenome	Rhizoplane
171	3300041491	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG	Metagenome	Unclassified
172	3300041511	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG	Metagenome	Unclassified
173	3300041997	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607	Metagenome	Rhizosphere
174	3300042004	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619	Metagenome	Rhizosphere
175	3300042876	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED	Metagenome	Rhizosphere
176	3300044656	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R	Metagenome	Rhizosphere
177	3300044658	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R	Metagenome	Rhizosphere
178	3300044673	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED	Metagenome	Rhizosphere
179	3300044683	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R	Metagenome	Rhizosphere
180	3300044684	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R	Metagenome	Rhizosphere
181	3300044712	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED	Metagenome	Rhizosphere
182	3300044735	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R	Metagenome	Rhizosphere
183	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
184	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
185	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
186	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
187	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
188	3300047318	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere	Metagenome	Rhizosphere
189	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
190	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
191	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
192	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
193	3300049521	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought	Metagenome	Rhizosphere
194	3300049522	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control	Metagenome	Rhizosphere
195	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
196	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
197	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
198	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
199	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
200	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
201	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
202	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
203	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
204	3300049651	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought	Metagenome	Rhizosphere
205	3300049652	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought	Metagenome	Rhizosphere
206	3300049661	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control	Metagenome	Rhizosphere
207	3300049662	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control	Metagenome	Rhizosphere
208	3300049664	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought	Metagenome	Rhizosphere
209	3300049666	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control	Metagenome	Rhizosphere
210	3300049669	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought	Metagenome	Rhizosphere
211	3300049675	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control	Metagenome	Rhizosphere
212	3300049686	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control	Metagenome	Rhizosphere
213	3300049688	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought	Metagenome	Rhizosphere
214	3300049690	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought	Metagenome	Rhizosphere
215	3300049703	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control	Metagenome	Rhizosphere
216	3300049704	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control	Metagenome	Rhizosphere
217	3300049705	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought	Metagenome	Rhizosphere
218	3300049758	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought	Metagenome	Rhizosphere
219	3300049767	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought	Metagenome	Rhizosphere
220	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
221	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
222	3300049851	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought	Metagenome	Rhizosphere
223	3300050005	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought	Metagenome	Rhizosphere
224	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
225	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
226	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
227	3300053086	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere	Metagenome	Endosphere
228	3300053092	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere	Metagenome	Endosphere
229	3300053109	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere	Metagenome	Endosphere
230	3300053111	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere	Metagenome	Endosphere
231	3300053131	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere	Metagenome	Endosphere
232	3300053134	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere	Metagenome	Endosphere
233	3300053139	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere	Metagenome	Endosphere
234	3300053142	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere	Metagenome	Endosphere
235	3300053163	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere	Metagenome	Endosphere

Type Distribution

Type	Percentage (%)
Metagenomes	98.37
Metatranscriptomes	0
Isolates	1.63

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	5.5
Nodule	0
Rhizoplane	1.02
Rhizosphere	89.61
Stem	0
Stem Tuber	0
Unclassified	3.87

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	SwRhRL2b_contig_1762647	2162886007	Bacteria	207340
2	JGI24740J21852_10006389	3300001979	Bacteria	4886
3	JGI24739J22299_10055840	3300001989	Bacteria	1261
4	JGI24751J29686_10006201	3300002459	Unclassified	2436
5	JGI25406J46586_10007985	3300003203	Bacteria	4812
6	rootL2_10027437	3300003322	Unclassified	2318
7	rootL2_10036715	3300003322	Bacteria	8207
8	rootL2_10331046	3300003322	Unclassified	1341
9	rootH1_10029767	3300003323	Bacteria	13135
10	rootH1_10046815	3300003323	Bacteria	11279
11	rootH1_10081256	3300003323	Bacteria	9212
12	rootH1_10115930	3300003323	Bacteria	8260
13	JGI25160J50197_1003536	3300003354	Bacteria	6963
14	JGI25160J50197_1005975	3300003354	Bacteria	4996
15	Ga0055526_1017447	3300003771	Bacteria	2739
16	Ga0055528_1003719	3300003790	Bacteria	7539
17	Ga0055530_10000583	3300003791	Bacteria	31527
18	Ga0055531_10049635	3300003794	Bacteria	1119
19	Ga0065165_1000657	3300005262	Bacteria	49860
20	Ga0065704_10070151	3300005289	Bacteria	259038
21	Ga0065704_10078469	3300005289	Bacteria	4419
22	Ga0065712_10128342	3300005290	Bacteria	1575
23	Ga0070683_100132515	3300005329	Unclassified	2359
24	Ga0070683_100235937	3300005329	Bacteria	1739
25	Ga0070670_100013660	3300005331	Bacteria	6960
26	Ga0070670_100025054	3300005331	Bacteria	5133
27	Ga0070670_100030103	3300005331	Bacteria	4675
28	Ga0070670_100104998	3300005331	Bacteria	2434
29	Ga0070670_100162100	3300005331	Bacteria	1938
30	Ga0068869_100002043	3300005334	Bacteria	12130
31	Ga0068869_100059139	3300005334	Bacteria	2805
32	Ga0070680_100056959	3300005336	Bacteria	3194
33	Ga0068868_100025038	3300005338	Bacteria	4533
34	Ga0068868_100060148	3300005338	Bacteria	3007
35	Ga0068868_100114319	3300005338	Bacteria	2196
36	Ga0068868_100413854	3300005338	Bacteria	1166
37	Ga0070660_100008582	3300005339	Bacteria	7155
38	Ga0070660_100010817	3300005339	Bacteria	6459
39	Ga0070660_100110870	3300005339	Bacteria	2183
40	Ga0070660_100264885	3300005339	Bacteria	1404
41	Ga0070660_100318208	3300005339	Bacteria	1278
42	Ga0070689_100002230	3300005340	Bacteria	12582
43	Ga0070689_100020658	3300005340	Bacteria	4889
44	Ga0070689_100022104	3300005340	Bacteria	4747
45	Ga0070687_100027377	3300005343	Bacteria	2754
46	Ga0070661_100016397	3300005344	Bacteria	5237
47	Ga0070661_100043146	3300005344	Unclassified	3294
48	Ga0070668_100008360	3300005347	Bacteria	7686
49	Ga0070675_100004073	3300005354	Bacteria	11096
50	Ga0070675_100115560	3300005354	Bacteria	2275
51	Ga0070674_100161600	3300005356	Bacteria	1700
52	Ga0070673_100004376	3300005364	Bacteria	8920
53	Ga0070673_100014656	3300005364	Bacteria	5472
54	Ga0070673_100028374	3300005364	Bacteria	4162
55	Ga0070673_100061505	3300005364	Bacteria	2979
56	Ga0070673_100128200	3300005364	Bacteria	2125
57	Ga0070673_100380768	3300005364	Bacteria	1258
58	Ga0070688_100043238	3300005365	Bacteria	2775
59	Ga0070688_100050404	3300005365	Bacteria	2593
60	Ga0070688_100080749	3300005365	Bacteria	2104
61	Ga0070659_100002698	3300005366	Bacteria	12622
62	Ga0070659_100015370	3300005366	Bacteria	5733
63	Ga0070659_100071524	3300005366	Unclassified	2758
64	Ga0070667_100104542	3300005367	Bacteria	2449
65	Ga0070663_100068810	3300005455	Unclassified	2570
66	Ga0070678_100050085	3300005456	Unclassified	3019
67	Ga0070662_100135747	3300005457	Bacteria	1902
68	Ga0070681_10033300	3300005458	Bacteria	5173
69	Ga0070681_10046548	3300005458	Bacteria	4337
70	Ga0070681_10131224	3300005458	Bacteria	2438
71	Ga0070681_10242119	3300005458	Bacteria	1717
72	Ga0068867_100014573	3300005459	Bacteria	5571
73	Ga0068867_100037650	3300005459	Unclassified	3516
74	Ga0070685_10033505	3300005466	Bacteria	2887
75	Ga0070685_10057301	3300005466	Bacteria	2267
76	Ga0070679_100005166	3300005530	Bacteria	12080
77	Ga0070679_100013309	3300005530	Bacteria	7876
78	Ga0070679_100060943	3300005530	Bacteria	3761
79	Ga0070679_100104569	3300005530	Bacteria	2818
80	Ga0070679_100298976	3300005530	Bacteria	1560
81	Ga0068853_100051252	3300005539	Bacteria	3552
82	Ga0068853_100098011	3300005539	Bacteria	2589
83	Ga0070672_100065720	3300005543	Bacteria	2870
84	Ga0070686_100005927	3300005544	Bacteria	6775
85	Ga0070686_100298531	3300005544	Bacteria	1194
86	Ga0070665_100124213	3300005548	Bacteria	2583
87	Ga0068855_100000454	3300005563	Bacteria	50341
88	Ga0068855_100005142	3300005563	Bacteria	15957
89	Ga0068855_100047499	3300005563	Bacteria	5071
90	Ga0068855_100048054	3300005563	Bacteria	5037
91	Ga0068855_100134778	3300005563	Bacteria	2818
92	Ga0070664_100193221	3300005564	Bacteria	1814
93	Ga0068857_100105633	3300005577	Bacteria	2528
94	Ga0068857_100184401	3300005577	Bacteria	1899
95	Ga0068857_100421867	3300005577	Bacteria	1244
96	Ga0068854_100063389	3300005578	Bacteria	2683
97	Ga0068854_100125930	3300005578	Bacteria	1951
98	Ga0068856_100038663	3300005614	Bacteria	4684
99	Ga0068856_100124363	3300005614	Bacteria	2582
100	Ga0068856_100279363	3300005614	Bacteria	1686
101	Ga0068852_100011063	3300005616	Bacteria	6775
102	Ga0068852_100078707	3300005616	Bacteria	2917
103	Ga0068859_100017814	3300005617	Bacteria	7140
104	Ga0068859_100051471	3300005617	Unclassified	4140
105	Ga0068859_100360016	3300005617	Bacteria	1550
106	Ga0068859_100443041	3300005617	Bacteria	1395
107	Ga0068864_100039378	3300005618	Bacteria	4041
108	Ga0068864_100097022	3300005618	Bacteria	2609
109	Ga0068864_100168436	3300005618	Bacteria	1996
110	Ga0068861_100001097	3300005719	Bacteria	16748
111	Ga0068861_100088162	3300005719	Unclassified	2443
112	Ga0068851_10097028	3300005834	Bacteria	1559
113	Ga0068863_100092283	3300005841	Bacteria	2873
114	Ga0068863_100153112	3300005841	Bacteria	2207
115	Ga0068863_100424227	3300005841	Bacteria	1303
116	Ga0068858_100442914	3300005842	Unclassified	1251
117	Ga0068858_100510792	3300005842	Bacteria	1161
118	Ga0068860_100004295	3300005843	Bacteria	14565
119	Ga0068860_100016616	3300005843	Bacteria	7177
120	Ga0068860_100056518	3300005843	Bacteria	3730
121	Ga0068862_100036131	3300005844	Bacteria	4186
122	Ga0068862_100200796	3300005844	Bacteria	1798
123	Ga0081539_10001220	3300005985	Bacteria	45919
124	Ga0097621_100162380	3300006237	Unclassified	1921
125	Ga0097621_100278162	3300006237	Bacteria	1473
126	Ga0097621_100309597	3300006237	Unclassified	1397
127	Ga0075428_100018437	3300006844	Bacteria	7717
128	Ga0075428_100041851	3300006844	Bacteria	5037
129	Ga0075430_100135164	3300006846	Unclassified	2055
130	Ga0075431_100023784	3300006847	Bacteria	6271
131	Ga0075429_100004950	3300006880	Bacteria	11474
132	Ga0075429_100235970	3300006880	Bacteria	1602
133	Ga0075429_100313074	3300006880	Bacteria	1374
134	Ga0068865_100030544	3300006881	Bacteria	3585
135	Ga0097620_100002930	3300006931	Bacteria	17331
136	Ga0097620_100017814	3300006931	Bacteria	7140
137	Ga0097620_100051471	3300006931	Unclassified	4140
138	Ga0097620_100094936	3300006931	Bacteria	3035
139	Ga0097620_100360007	3300006931	Bacteria	1550
140	Ga0097620_100442995	3300006931	Bacteria	1395
141	Ga0105240_10019673	3300009093	Bacteria	9017
142	Ga0105240_10044686	3300009093	Bacteria	5626
143	Ga0105240_10060066	3300009093	Bacteria	4741
144	Ga0105240_10060871	3300009093	Bacteria	4706
145	Ga0111539_10036535	3300009094	Bacteria	5937
146	Ga0111539_10303914	3300009094	Bacteria	1856
147	Ga0111539_10437031	3300009094	Bacteria	1524
148	Ga0114129_10334743	3300009147	Bacteria	2009
149	Ga0105241_10004396	3300009174	Bacteria	10420
150	Ga0105242_10031023	3300009176	Unclassified	4267
151	Ga0105242_10060912	3300009176	Bacteria	3103
152	Ga0105242_10120592	3300009176	Bacteria	2250
153	Ga0105242_10135015	3300009176	Bacteria	2134
154	Ga0105248_10106170	3300009177	Bacteria	3166
155	Ga0105248_10499059	3300009177	Bacteria	1372
156	Ga0105237_10009302	3300009545	Bacteria	10530
157	Ga0105237_10027081	3300009545	Bacteria	5855
158	Ga0105237_10078748	3300009545	Bacteria	3285
159	Ga0105237_10146114	3300009545	Bacteria	2359
160	Ga0105238_10108616	3300009551	Bacteria	2755
161	Ga0105249_10012020	3300009553	Bacteria	7618
162	Ga0105249_10014397	3300009553	Bacteria	6993
163	Ga0105239_10005001	3300010375	Bacteria	15651
164	Ga0105239_10011812	3300010375	Bacteria	9746
165	Ga0105239_10012617	3300010375	Bacteria	9403
166	Ga0105239_10024882	3300010375	Bacteria	6593
167	Ga0105239_10030625	3300010375	Bacteria	5918
168	Ga0105239_10048628	3300010375	Bacteria	4650
169	Ga0105239_10219494	3300010375	Bacteria	2132
170	Ga0157373_10007196	3300013100	Bacteria	8299
171	Ga0157373_10035115	3300013100	Bacteria	3600
172	Ga0157373_10161653	3300013100	Bacteria	1576
173	Ga0157371_10000596	3300013102	Bacteria	43030
174	Ga0157371_10002123	3300013102	Bacteria	19298
175	Ga0157371_10002924	3300013102	Bacteria	15952
176	Ga0157371_10008508	3300013102	Bacteria	8167
177	Ga0157371_10014887	3300013102	Bacteria	5854
178	Ga0157371_10021886	3300013102	Bacteria	4691
179	Ga0157371_10026759	3300013102	Bacteria	4189
180	Ga0157371_10029167	3300013102	Bacteria	3994
181	Ga0157371_10029962	3300013102	Bacteria	3928
182	Ga0157371_10030732	3300013102	Bacteria	3873
183	Ga0157371_10139498	3300013102	Bacteria	1727
184	Ga0157371_10155575	3300013102	Unclassified	1631
185	Ga0157370_10000795	3300013104	Bacteria	39727
186	Ga0157370_10001240	3300013104	Bacteria	31893
187	Ga0157370_10002386	3300013104	Bacteria	22657
188	Ga0157370_10007153	3300013104	Bacteria	12177
189	Ga0157370_10019578	3300013104	Bacteria	6783
190	Ga0157369_10010751	3300013105	Bacteria	10420
191	Ga0157369_10015466	3300013105	Bacteria	8598
192	Ga0157369_10044911	3300013105	Bacteria	4807
193	Ga0157369_10068407	3300013105	Bacteria	3815
194	Ga0157369_10090334	3300013105	Bacteria	3270
195	Ga0157369_10262077	3300013105	Bacteria	1803
196	Ga0157374_10046150	3300013296	Bacteria	4034
197	Ga0157374_10059556	3300013296	Bacteria	3571
198	Ga0157378_10004750	3300013297	Bacteria	11909
199	Ga0157378_10006518	3300013297	Bacteria	10203
200	Ga0157378_10008259	3300013297	Bacteria	9076
201	Ga0157378_10064856	3300013297	Unclassified	3268
202	Ga0157378_10065912	3300013297	Bacteria	3242
203	Ga0163162_10000531	3300013306	Bacteria	35292
204	Ga0163162_10024316	3300013306	Bacteria	5978
205	Ga0163162_10029614	3300013306	Bacteria	5419
206	Ga0163162_10198148	3300013306	Unclassified	2137
207	Ga0157372_10000891	3300013307	Bacteria	32419
208	Ga0157372_10002466	3300013307	Bacteria	20053
209	Ga0157372_10013318	3300013307	Bacteria	8778
210	Ga0157372_10015360	3300013307	Bacteria	8205
211	Ga0157372_10025864	3300013307	Bacteria	6383
212	Ga0157372_10066036	3300013307	Bacteria	4064
213	Ga0157372_10087961	3300013307	Bacteria	3526
214	Ga0157372_10113387	3300013307	Bacteria	3107
215	Ga0157372_10154508	3300013307	Bacteria	2650
216	Ga0157372_10160838	3300013307	Unclassified	2595
217	Ga0157372_10292473	3300013307	Bacteria	1894
218	Ga0157372_10303658	3300013307	Unclassified	1857
219	Ga0157372_10326623	3300013307	Bacteria	1786
220	Ga0157372_10385123	3300013307	Bacteria	1634
221	Ga0157372_10482626	3300013307	Bacteria	1445
222	Ga0157375_10000230	3300013308	Bacteria	52234
223	Ga0157375_10131387	3300013308	Bacteria	2623
224	Ga0157375_10564857	3300013308	Unclassified	1299
225	Ga0157375_11013161	3300013308	Bacteria	970
226	Ga0163163_10066149	3300014325	Bacteria	3589
227	Ga0163163_10311187	3300014325	Unclassified	1628
228	Ga0157380_10074391	3300014326	Bacteria	2758
229	Ga0157380_10081873	3300014326	Unclassified	2641
230	Ga0157377_10007825	3300014745	Bacteria	5179
231	Ga0157377_10018018	3300014745	Bacteria	3664
232	Ga0157377_10050481	3300014745	Bacteria	2343
233	Ga0157379_10068374	3300014968	Bacteria	3176
234	Ga0157379_10156111	3300014968	Bacteria	2059
235	Ga0157376_10000514	3300014969	Bacteria	24959
236	Ga0157376_10106073	3300014969	Bacteria	2465
237	Ga0157376_10149134	3300014969	Bacteria	2107
238	Ga0157376_10160294	3300014969	Bacteria	2038
239	Ga0157376_10472780	3300014969	Bacteria	1227
240	Ga0182005_1000087	3300015265	Bacteria	70160
241	Ga0163161_10004873	3300017792	Bacteria	9350
242	Ga0209436_104610	3300025208	Bacteria	3368
243	Ga0209673_1000263	3300025273	Bacteria	99337
244	Ga0209564_1013346	3300025295	Bacteria	3500
245	Ga0209564_1032861	3300025295	Bacteria	1553
246	Ga0209758_1030248	3300025297	Bacteria	2246
247	Ga0209050_1000323	3300025298	Bacteria	96020
248	Ga0207426_1000002	3300025302	Bacteria	1249660
249	Ga0207426_1000137	3300025302	Bacteria	199010
250	Ga0207426_1000363	3300025302	Bacteria	81330
251	Ga0207426_1001254	3300025302	Bacteria	22188
252	Ga0209257_1001211	3300025304	Bacteria	32394
253	Ga0207682_10052557	3300025893	Bacteria	1688
254	Ga0207647_10001835	3300025904	Bacteria	16292
255	Ga0207647_10059735	3300025904	Bacteria	2332
256	Ga0207647_10134387	3300025904	Bacteria	1452
257	Ga0207645_10008336	3300025907	Bacteria	7236
258	Ga0207705_10016899	3300025909	Bacteria	5226
259	Ga0207705_10136577	3300025909	Bacteria	1828
260	Ga0207654_10028106	3300025911	Bacteria	3064
261	Ga0207654_10060332	3300025911	Bacteria	2215
262	Ga0207654_10321994	3300025911	Bacteria	1057
263	Ga0207707_10046295	3300025912	Bacteria	3788
264	Ga0207707_10081061	3300025912	Bacteria	2833
265	Ga0207695_10000073	3300025913	Bacteria	312565
266	Ga0207695_10000092	3300025913	Bacteria	270514
267	Ga0207695_10016776	3300025913	Bacteria	8550
268	Ga0207695_10023267	3300025913	Bacteria	7007
269	Ga0207695_10034212	3300025913	Bacteria	5531
270	Ga0207671_10158650	3300025914	Bacteria	1751
271	Ga0207671_10365823	3300025914	Bacteria	1145
272	Ga0207660_10006054	3300025917	Bacteria	7850
273	Ga0207660_10061598	3300025917	Bacteria	2700
274	Ga0207662_10029338	3300025918	Bacteria	3187
275	Ga0207662_10124422	3300025918	Bacteria	1620
276	Ga0207657_10012812	3300025919	Bacteria	8253
277	Ga0207657_10025421	3300025919	Bacteria	5462
278	Ga0207657_10047995	3300025919	Bacteria	3729
279	Ga0207657_10139413	3300025919	Bacteria	1982
280	Ga0207657_10215962	3300025919	Bacteria	1538
281	Ga0207652_10000387	3300025921	Bacteria	45946
282	Ga0207652_10000831	3300025921	Bacteria	29402
283	Ga0207681_10008917	3300025923	Bacteria	6123
284	Ga0207681_10059815	3300025923	Bacteria	2613
285	Ga0207681_10128372	3300025923	Bacteria	1871
286	Ga0207650_10012075	3300025925	Bacteria	5955
287	Ga0207650_10020414	3300025925	Bacteria	4672
288	Ga0207650_10024000	3300025925	Unclassified	4330
289	Ga0207650_10356106	3300025925	Bacteria	1205
290	Ga0207659_10238754	3300025926	Bacteria	1469
291	Ga0207644_10037808	3300025931	Bacteria	3398
292	Ga0207644_10084977	3300025931	Bacteria	2347
293	Ga0207690_10106819	3300025932	Unclassified	2009
294	Ga0207690_10422220	3300025932	Bacteria	1067
295	Ga0207706_10010460	3300025933	Bacteria	8477
296	Ga0207706_10041973	3300025933	Bacteria	4053
297	Ga0207706_10188883	3300025933	Unclassified	1809
298	Ga0207686_10000632	3300025934	Bacteria	21858
299	Ga0207686_10058104	3300025934	Unclassified	2437
300	Ga0207686_10108311	3300025934	Bacteria	1869
301	Ga0207670_10072721	3300025936	Bacteria	2382
302	Ga0207669_10355607	3300025937	Bacteria	1133
303	Ga0207691_10041333	3300025940	Bacteria	4257
304	Ga0207711_10081611	3300025941	Bacteria	2826
305	Ga0207689_10016483	3300025942	Bacteria	6254
306	Ga0207689_10030945	3300025942	Unclassified	4459
307	Ga0207689_10034308	3300025942	Bacteria	4215
308	Ga0207689_10060518	3300025942	Bacteria	3114
309	Ga0207689_10078116	3300025942	Bacteria	2720
310	Ga0207661_10047778	3300025944	Bacteria	3399
311	Ga0207661_10149027	3300025944	Bacteria	2021
312	Ga0207679_10065341	3300025945	Bacteria	2722
313	Ga0207667_10000745	3300025949	Bacteria	42269
314	Ga0207667_10001687	3300025949	Bacteria	27830
315	Ga0207667_10005165	3300025949	Bacteria	15949
316	Ga0207667_10005263	3300025949	Bacteria	15781
317	Ga0207651_10043115	3300025960	Bacteria	3009
318	Ga0207651_10056194	3300025960	Unclassified	2708
319	Ga0207651_10121115	3300025960	Bacteria	1984
320	Ga0207712_10007819	3300025961	Bacteria	6756
321	Ga0207712_10011087	3300025961	Bacteria	5740
322	Ga0207712_10154546	3300025961	Bacteria	1776
323	Ga0207712_10161131	3300025961	Bacteria	1743
324	Ga0207712_10376044	3300025961	Bacteria	1187
325	Ga0207668_10032885	3300025972	Bacteria	3433
326	Ga0207640_10018181	3300025981	Bacteria	4126
327	Ga0207640_10109934	3300025981	Bacteria	1951
328	Ga0207658_10110943	3300025986	Bacteria	2168
329	Ga0207677_10018538	3300026023	Bacteria	4179
330	Ga0207677_10023583	3300026023	Bacteria	3805
331	Ga0207677_10043218	3300026023	Bacteria	2994
332	Ga0207703_10168064	3300026035	Bacteria	1927
333	Ga0207703_10329820	3300026035	Unclassified	1400
334	Ga0207639_10020142	3300026041	Bacteria	4773
335	Ga0207639_10127081	3300026041	Bacteria	2104
336	Ga0207639_10180101	3300026041	Bacteria	1797
337	Ga0207678_10016122	3300026067	Bacteria	6562
338	Ga0207708_10359468	3300026075	Bacteria	1196
339	Ga0207702_10096111	3300026078	Bacteria	2605
340	Ga0207641_10011172	3300026088	Bacteria	7365
341	Ga0207641_10533190	3300026088	Bacteria	1143
342	Ga0207648_10003269	3300026089	Bacteria	17039
343	Ga0207648_10089373	3300026089	Bacteria	2691
344	Ga0207648_10354945	3300026089	Bacteria	1322
345	Ga0207676_10099996	3300026095	Bacteria	2402
346	Ga0207676_10145314	3300026095	Bacteria	2036
347	Ga0207674_10023595	3300026116	Bacteria	6587
348	Ga0207674_10144684	3300026116	Bacteria	2336
349	Ga0207674_10209109	3300026116	Bacteria	1900
350	Ga0207674_10215160	3300026116	Unclassified	1870
351	Ga0207674_10387523	3300026116	Bacteria	1351
352	Ga0207675_100003516	3300026118	Bacteria	15294
353	Ga0207683_10062922	3300026121	Bacteria	3268
354	Ga0207683_10131343	3300026121	Bacteria	2253
355	Ga0207698_10173897	3300026142	Bacteria	1899
356	Ga0207698_10390872	3300026142	Bacteria	1326
357	Ga0207428_10069060	3300027907	Bacteria	2778
358	Ga0268264_10008752	3300028381	Bacteria	8402
359	Ga0268264_10043067	3300028381	Bacteria	3739
360	Ga0268264_10046039	3300028381	Bacteria	3623
361	Ga0268264_10050791	3300028381	Bacteria	3454
362	Ga0265334_10014652	3300028573	Bacteria	3266
363	Ga0265334_10056852	3300028573	Bacteria	1484
364	Ga0265338_10168926	3300028800	Unclassified	1680
365	Ga0265331_10029109	3300031250	Bacteria	2759
366	Ga0265327_10000084	3300031251	Bacteria	204433
367	Ga0265327_10000648	3300031251	Bacteria	56244
368	Ga0265314_10088089	3300031711	Bacteria	2028
369	Ga0316576_10021669	3300031727	Bacteria	4449
370	Ga0307510_10004045	3300033180	Bacteria	17204
371	Ga0373937_0235574	3300036401	Unclassified	1724
372	Ga0395899_0000174	3300037312	Bacteria	96065
373	Ga0395899_0009618	3300037312	Bacteria	7419
374	Ga0395899_0010967	3300037312	Bacteria	6941
375	Ga0395899_0023199	3300037312	Bacteria	4703
376	Ga0395899_0055696	3300037312	Bacteria	2924
377	Ga0395899_0062082	3300037312	Bacteria	2751
378	Ga0395900_0000203	3300037418	Bacteria	93536
379	Ga0395900_0027824	3300037418	Bacteria	5792
380	Ga0395900_0043373	3300037418	Bacteria	4636
381	Ga0395900_0142991	3300037418	Unclassified	2448
382	Ga0395900_0166306	3300037418	Bacteria	2247
383	Ga0395900_0195286	3300037418	Bacteria	2051
384	Ga0395898_0001285	3300037466	Bacteria	36916
385	Ga0395898_0011961	3300037466	Bacteria	8983
386	Ga0395898_0015964	3300037466	Bacteria	7694
387	Ga0395905_0000208	3300037471	Bacteria	91236
388	Ga0395905_0257780	3300037471	Bacteria	1628
389	Ga0395901_0002230	3300038443	Bacteria	19784
390	Ga0395901_0002261	3300038443	Bacteria	19652
391	Ga0395901_0053672	3300038443	Bacteria	4188
392	Ga0395901_0277921	3300038443	Bacteria	1740
393	Ga0400489_42594	3300039093	Unclassified	2084
394	Ga0436365_0716887	3300039437	Bacteria	1974
395	Ga0436365_1892627	3300039437	Bacteria	12715
396	Ga0439465_0022841	3300041413	Bacteria	1966
397	Ga0451789_0642936	3300041443	Bacteria	1844
398	Ga0451795_0891554	3300041456	Bacteria	1463
399	Ga0451833_0468790	3300041491	Bacteria	1018
400	Ga0451855_1562750	3300041511	Bacteria	1201
401	Ga0439431_0023155	3300041997	Bacteria	1501
402	Ga0439431_0028214	3300041997	Bacteria	1382
403	Ga0439445_0031379	3300042004	Bacteria	1381
404	Ga0451577_0000169	3300042876	Bacteria	144088
405	Ga0451577_0027013	3300042876	Bacteria	5196
406	Ga0451577_0135639	3300042876	Bacteria	2210
407	Ga0451577_0267255	3300042876	Bacteria	1549
408	Ga0466969_0000167	3300044656	Bacteria	35385
409	Ga0466972_0011666	3300044658	Bacteria	4413
410	Ga0453683_0000217	3300044673	Bacteria	76362
411	Ga0466965_0118520	3300044683	Bacteria	1365
412	Ga0466966_0000161	3300044684	Bacteria	43671
413	Ga0453684_0000536	3300044712	Bacteria	144088
414	Ga0453684_0000651	3300044712	Bacteria	125123
415	Ga0453684_0039344	3300044712	Bacteria	6447
416	Ga0453684_0689092	3300044712	Bacteria	1111
417	Ga0466968_0057674	3300044735	Bacteria	1670
418	Ga0466957_0000551	3300044842	Bacteria	18906
419	Ga0466959_0000005	3300045049	Bacteria	213958
420	Ga0451576_0000080	3300045051	Bacteria	242782
421	Ga0451576_0000215	3300045051	Bacteria	144088
422	Ga0451576_0031321	3300045051	Bacteria	5672
423	Ga0495606_0008239	3300046507	Bacteria	9104
424	Ga0495668_0002821	3300046616	Bacteria	13817
425	Ga0495636_0000095	3300047318	Bacteria	37484
426	Ga0495674_0162379	3300047319	Bacteria	1869
427	Ga0496100_0011901	3300048903	Bacteria	4969
428	Ga0496101_0016539	3300048904	Bacteria	4987
429	Ga0496114_0009383	3300048917	Bacteria	7770
430	Ga0501298_002337	3300049521	Bacteria	2859
431	Ga0501299_010541	3300049522	Bacteria	1545
432	Ga0501033_0022261	3300049570	Bacteria	4783
433	Ga0501033_0246928	3300049570	Bacteria	1266
434	Ga0501034_0000043	3300049571	Bacteria	229049
435	Ga0501034_0078283	3300049571	Bacteria	3311
436	Ga0501036_0085222	3300049572	Bacteria	2671
437	Ga0501037_0156892	3300049573	Bacteria	1624
438	Ga0501037_0193763	3300049573	Bacteria	1438
439	Ga0501038_0115207	3300049574	Bacteria	2222
440	Ga0501043_0028370	3300049579	Bacteria	4394
441	Ga0501047_0098606	3300049581	Bacteria	2800
442	Ga0501070_0014249	3300049586	Bacteria	6691
443	Ga0501074_0003119	3300049590	Bacteria	11685
444	Ga0501201_000180	3300049651	Bacteria	5586
445	Ga0501202_003943	3300049652	Bacteria	2570
446	Ga0501217_003838	3300049661	Unclassified	3057
447	Ga0501217_010701	3300049661	Bacteria	2015
448	Ga0501222_000476	3300049662	Bacteria	5975
449	Ga0501224_002165	3300049664	Bacteria	2664
450	Ga0501228_001449	3300049666	Bacteria	1734
451	Ga0501235_002557	3300049669	Bacteria	3916
452	Ga0501243_004021	3300049675	Bacteria	2196
453	Ga0501257_036371	3300049686	Bacteria	1199
454	Ga0501259_000937	3300049688	Bacteria	4806
455	Ga0501261_002640	3300049690	Bacteria	2200
456	Ga0501219_000530	3300049703	Bacteria	5702
457	Ga0501221_000102	3300049704	Bacteria	10239
458	Ga0501225_0000356	3300049705	Bacteria	14440
459	Ga0501225_0012028	3300049705	Unclassified	2432
460	Ga0501241_000187	3300049758	Bacteria	13984
461	Ga0501270_009581	3300049767	Unclassified	1255
462	Ga0501035_0007663	3300049822	Bacteria	10086
463	Ga0501035_0061821	3300049822	Bacteria	3332
464	Ga0501044_0032934	3300049823	Bacteria	5447
465	Ga0501044_0042192	3300049823	Bacteria	4747
466	Ga0501044_0084640	3300049823	Bacteria	3205
467	Ga0501212_007011	3300049851	Bacteria	1534
468	Ga0501284_00003	3300050005	Bacteria	212116
469	nmdc:mga09592_227112_c1	3300050508	Bacteria	1617
470	nmdc:mga09592_59541_c1	3300050508	Unclassified	3229
471	nmdc:mga09592_65655_c1	3300050508	Unclassified	3075
472	nmdc:mga0qj67_110865_c1	3300050509	Unclassified	2215
473	nmdc:mga08y16_104765_c1	3300050511	Bacteria	2944
474	nmdc:mga08y16_50484_c1	3300050511	Unclassified	4353
475	Ga0500578_0000718	3300053086	Bacteria	39295
476	Ga0500583_0042277	3300053092	Bacteria	2076
477	Ga0500569_000201	3300053109	Bacteria	9511
478	Ga0500572_009594	3300053111	Bacteria	2293
479	Ga0500652_000995	3300053131	Bacteria	9286
480	Ga0500658_0003388	3300053134	Bacteria	6030
481	Ga0500568_0087758	3300053139	Bacteria	1175
482	Ga0500577_0003024	3300053142	Bacteria	4342
483	Ga0500639_069663	3300053163	Bacteria	1795

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300025961	Ga0207712_10376044	Ga0207712_103760441	291
2	3300045051	Ga0451576_0031321	Ga0451576_0031321_657_1610	298
3	3300037471	Ga0395905_0000208	Ga0395905_0000208_30585_31547	299
4	3300042876	Ga0451577_0267255	Ga0451577_0267255_48_980	299
5	3300013104	Ga0157370_10000795	Ga0157370_100007956	303
6	3300025933	Ga0207706_10188883	Ga0207706_101888832	303
7	iso_pu_bacteria	2881955468	2881957781	303
8	3300003322	rootL2_10036715	rootL2_100367156	305
9	3300003323	rootH1_10029767	rootH1_100297674	305
10	3300003323	rootH1_10081256	rootH1_100812568	305
11	3300003354	JGI25160J50197_1003536	JGI25160J50197_10035367	305
12	3300003354	JGI25160J50197_1005975	JGI25160J50197_10059752	305
13	3300003771	Ga0055526_1017447	Ga0055526_10174472	305
14	3300003790	Ga0055528_1003719	Ga0055528_10037195	305
15	3300003791	Ga0055530_10000583	Ga0055530_100005835	305
16	3300003794	Ga0055531_10049635	Ga0055531_100496351	305
17	3300005262	Ga0065165_1000657	Ga0065165_100065719	305
18	3300005289	Ga0065704_10078469	Ga0065704_100784692	305
19	3300005329	Ga0070683_100132515	Ga0070683_1001325152	305
20	3300005331	Ga0070670_100162100	Ga0070670_1001621001	305
21	3300005459	Ga0068867_100037650	Ga0068867_1000376504	305
22	3300006237	Ga0097621_100278162	Ga0097621_1002781621	305
23	3300006237	Ga0097621_100309597	Ga0097621_1003095972	305
24	3300006881	Ga0068865_100030544	Ga0068865_1000305442	305
25	3300009176	Ga0105242_10031023	Ga0105242_100310234	305
26	3300010375	Ga0105239_10048628	Ga0105239_100486283	305
27	3300014969	Ga0157376_10149134	Ga0157376_101491342	305
28	3300014969	Ga0157376_10160294	Ga0157376_101602942	305
29	3300015265	Ga0182005_1000087	Ga0182005_100008734	305
30	3300025208	Ga0209436_104610	Ga0209436_1046102	305
31	3300025273	Ga0209673_1000263	Ga0209673_100026365	305
32	3300025295	Ga0209564_1032861	Ga0209564_10328612	305
33	3300025297	Ga0209758_1030248	Ga0209758_10302482	305
34	3300025298	Ga0209050_1000323	Ga0209050_100032339	305
35	3300025302	Ga0207426_1000137	Ga0207426_1000137162	305
36	3300025302	Ga0207426_1000363	Ga0207426_100036327	305
37	3300025302	Ga0207426_1001254	Ga0207426_10012543	305
38	3300025304	Ga0209257_1001211	Ga0209257_100121115	305
39	3300025904	Ga0207647_10134387	Ga0207647_101343872	305
40	3300025925	Ga0207650_10356106	Ga0207650_103561061	305
41	3300025934	Ga0207686_10058104	Ga0207686_100581043	305
42	3300026041	Ga0207639_10020142	Ga0207639_100201423	305
43	3300028573	Ga0265334_10056852	Ga0265334_100568522	305
44	3300037418	Ga0395900_0195286	Ga0395900_0195286_303_1223	305
45	3300039093	Ga0400489_42594	Ga0400489_42594_739_1686	305
46	3300041413	Ga0439465_0022841	Ga0439465_0022841_996_1925	305
47	3300041443	Ga0451789_0642936	Ga0451789_0642936_725_1654	305
48	3300041491	Ga0451833_0468790	Ga0451833_0468790_65_994	305
49	3300041997	Ga0439431_0028214	Ga0439431_0028214_406_1335	305
50	3300042876	Ga0451577_0000169	Ga0451577_0000169_59833_60780	305
51	3300042876	Ga0451577_0027013	Ga0451577_0027013_3468_4415	305
52	3300042876	Ga0451577_0135639	Ga0451577_0135639_755_1702	305
53	3300044658	Ga0466972_0011666	Ga0466972_0011666_3402_4370	305
54	3300044673	Ga0453683_0000217	Ga0453683_0000217_65228_66175	305
55	3300044712	Ga0453684_0000536	Ga0453684_0000536_59833_60780	305
56	3300044712	Ga0453684_0000651	Ga0453684_0000651_110200_111147	305
57	3300045051	Ga0451576_0000080	Ga0451576_0000080_129247_130194	305
58	3300045051	Ga0451576_0000215	Ga0451576_0000215_83309_84256	305
59	3300049573	Ga0501037_0193763	Ga0501037_0193763_227_1156	305
60	3300049758	Ga0501241_000187	Ga0501241_000187_1254_2183	305
61	3300049823	Ga0501044_0042192	Ga0501044_0042192_899_1828	305
62	3300053092	Ga0500583_0042277	Ga0500583_0042277_176_1105	305
63	3300053109	Ga0500569_000201	Ga0500569_000201_2557_3486	305
64	3300053134	Ga0500658_0003388	Ga0500658_0003388_3854_4783	305
65	3300053142	Ga0500577_0003024	Ga0500577_0003024_2788_3717	305
66	iso_pu_bacteria	2818991442	2819575624	305
67	iso_pu_bacteria	2818991444	2819588751	305
68	iso_pu_bacteria	2818991460	2819678382	305
69	iso_pu_bacteria	2884791551	2884793168	305
70	iso_pu_bacteria	2896085136	2896089689	305
71	iso_pu_bacteria	2914759650	2914763832	305
72	iso_pu_bacteria	2929921140	2929925510	305
73	3300001989	JGI24739J22299_10055840	JGI24739J22299_100558401	306
74	3300003322	rootL2_10331046	rootL2_103310461	306
75	3300003323	rootH1_10115930	rootH1_101159303	306
76	3300005329	Ga0070683_100235937	Ga0070683_1002359372	306
77	3300005331	Ga0070670_100025054	Ga0070670_1000250541	306
78	3300005331	Ga0070670_100104998	Ga0070670_1001049982	306
79	3300005334	Ga0068869_100059139	Ga0068869_1000591392	306
80	3300005336	Ga0070680_100056959	Ga0070680_1000569591	306
81	3300005338	Ga0068868_100060148	Ga0068868_1000601481	306
82	3300005338	Ga0068868_100413854	Ga0068868_1004138541	306
83	3300005339	Ga0070660_100010817	Ga0070660_1000108172	306
84	3300005339	Ga0070660_100318208	Ga0070660_1003182081	306
85	3300005340	Ga0070689_100022104	Ga0070689_1000221043	306
86	3300005344	Ga0070661_100016397	Ga0070661_1000163972	306
87	3300005347	Ga0070668_100008360	Ga0070668_1000083605	306
88	3300005354	Ga0070675_100004073	Ga0070675_1000040738	306
89	3300005364	Ga0070673_100128200	Ga0070673_1001282001	306
90	3300005455	Ga0070663_100068810	Ga0070663_1000688103	306
91	3300005458	Ga0070681_10046548	Ga0070681_100465482	306
92	3300005459	Ga0068867_100014573	Ga0068867_1000145732	306
93	3300005466	Ga0070685_10033505	Ga0070685_100335052	306
94	3300005530	Ga0070679_100104569	Ga0070679_1001045691	306
95	3300005530	Ga0070679_100298976	Ga0070679_1002989761	306
96	3300005539	Ga0068853_100051252	Ga0068853_1000512522	306
97	3300005563	Ga0068855_100000454	Ga0068855_10000045420	306
98	3300005563	Ga0068855_100047499	Ga0068855_1000474993	306
99	3300005563	Ga0068855_100134778	Ga0068855_1001347782	306
100	3300005577	Ga0068857_100421867	Ga0068857_1004218672	306
101	3300005614	Ga0068856_100038663	Ga0068856_1000386632	306
102	3300005614	Ga0068856_100279363	Ga0068856_1002793632	306
103	3300005616	Ga0068852_100011063	Ga0068852_1000110633	306
104	3300005617	Ga0068859_100017814	Ga0068859_1000178143	306
105	3300005719	Ga0068861_100001097	Ga0068861_10000109714	306
106	3300005834	Ga0068851_10097028	Ga0068851_100970282	306
107	3300005841	Ga0068863_100153112	Ga0068863_1001531122	306
108	3300005842	Ga0068858_100442914	Ga0068858_1004429142	306
109	3300005843	Ga0068860_100004295	Ga0068860_1000042956	306
110	3300005843	Ga0068860_100016616	Ga0068860_1000166163	306
111	3300005843	Ga0068860_100056518	Ga0068860_1000565182	306
112	3300006237	Ga0097621_100162380	Ga0097621_1001623802	306
113	3300006931	Ga0097620_100017814	Ga0097620_1000178143	306
114	3300006931	Ga0097620_100094936	Ga0097620_1000949362	306
115	3300009093	Ga0105240_10019673	Ga0105240_100196735	306
116	3300009093	Ga0105240_10044686	Ga0105240_100446862	306
117	3300009093	Ga0105240_10060066	Ga0105240_100600661	306
118	3300009093	Ga0105240_10060871	Ga0105240_100608713	306
119	3300009094	Ga0111539_10036535	Ga0111539_100365355	306
120	3300009094	Ga0111539_10437031	Ga0111539_104370311	306
121	3300009174	Ga0105241_10004396	Ga0105241_100043963	306
122	3300009176	Ga0105242_10060912	Ga0105242_100609122	306
123	3300009545	Ga0105237_10009302	Ga0105237_100093028	306
124	3300010375	Ga0105239_10011812	Ga0105239_100118122	306
125	3300010375	Ga0105239_10012617	Ga0105239_100126177	306
126	3300010375	Ga0105239_10030625	Ga0105239_100306255	306
127	3300010375	Ga0105239_10219494	Ga0105239_102194942	306
128	3300013100	Ga0157373_10007196	Ga0157373_100071962	306
129	3300013102	Ga0157371_10014887	Ga0157371_100148874	306
130	3300013102	Ga0157371_10021886	Ga0157371_100218862	306
131	3300013102	Ga0157371_10029962	Ga0157371_100299622	306
132	3300013104	Ga0157370_10007153	Ga0157370_100071532	306
133	3300013104	Ga0157370_10019578	Ga0157370_100195784	306
134	3300013105	Ga0157369_10010751	Ga0157369_100107518	306
135	3300013105	Ga0157369_10015466	Ga0157369_100154664	306
136	3300013105	Ga0157369_10090334	Ga0157369_100903342	306
137	3300013105	Ga0157369_10262077	Ga0157369_102620772	306
138	3300013296	Ga0157374_10059556	Ga0157374_100595562	306
139	3300013297	Ga0157378_10004750	Ga0157378_100047501	306
140	3300013306	Ga0163162_10198148	Ga0163162_101981482	306
141	3300013307	Ga0157372_10025864	Ga0157372_100258643	306
142	3300013307	Ga0157372_10066036	Ga0157372_100660363	306
143	3300013307	Ga0157372_10154508	Ga0157372_101545081	306
144	3300013307	Ga0157372_10160838	Ga0157372_101608383	306
145	3300013307	Ga0157372_10292473	Ga0157372_102924732	306
146	3300013307	Ga0157372_10326623	Ga0157372_103266232	306
147	3300013307	Ga0157372_10385123	Ga0157372_103851231	306
148	3300013308	Ga0157375_10564857	Ga0157375_105648572	306
149	3300013308	Ga0157375_11013161	Ga0157375_110131611	306
150	3300014325	Ga0163163_10311187	Ga0163163_103111872	306
151	3300014326	Ga0157380_10081873	Ga0157380_100818731	306
152	3300014745	Ga0157377_10007825	Ga0157377_100078253	306
153	3300014968	Ga0157379_10156111	Ga0157379_101561112	306
154	3300025295	Ga0209564_1013346	Ga0209564_10133463	306
155	3300025904	Ga0207647_10001835	Ga0207647_1000183516	306
156	3300025904	Ga0207647_10059735	Ga0207647_100597352	306
157	3300025909	Ga0207705_10016899	Ga0207705_100168992	306
158	3300025911	Ga0207654_10028106	Ga0207654_100281063	306
159	3300025911	Ga0207654_10060332	Ga0207654_100603321	306
160	3300025911	Ga0207654_10321994	Ga0207654_103219941	306
161	3300025912	Ga0207707_10046295	Ga0207707_100462955	306
162	3300025913	Ga0207695_10000073	Ga0207695_10000073244	306
163	3300025913	Ga0207695_10016776	Ga0207695_100167765	306
164	3300025913	Ga0207695_10023267	Ga0207695_100232673	306
165	3300025913	Ga0207695_10034212	Ga0207695_100342122	306
166	3300025914	Ga0207671_10158650	Ga0207671_101586502	306
167	3300025917	Ga0207660_10061598	Ga0207660_100615982	306
168	3300025919	Ga0207657_10047995	Ga0207657_100479954	306
169	3300025919	Ga0207657_10215962	Ga0207657_102159622	306
170	3300025921	Ga0207652_10000387	Ga0207652_1000038710	306
171	3300025923	Ga0207681_10008917	Ga0207681_100089176	306
172	3300025931	Ga0207644_10037808	Ga0207644_100378082	306
173	3300025931	Ga0207644_10084977	Ga0207644_100849772	306
174	3300025932	Ga0207690_10422220	Ga0207690_104222201	306
175	3300025934	Ga0207686_10108311	Ga0207686_101083112	306
176	3300025942	Ga0207689_10030945	Ga0207689_100309451	306
177	3300025942	Ga0207689_10060518	Ga0207689_100605182	306
178	3300025944	Ga0207661_10047778	Ga0207661_100477781	306
179	3300025944	Ga0207661_10149027	Ga0207661_101490272	306
180	3300025949	Ga0207667_10000745	Ga0207667_1000074511	306
181	3300025949	Ga0207667_10005165	Ga0207667_1000516513	306
182	3300025960	Ga0207651_10056194	Ga0207651_100561942	306
183	3300025972	Ga0207668_10032885	Ga0207668_100328852	306
184	3300025981	Ga0207640_10018181	Ga0207640_100181813	306
185	3300026023	Ga0207677_10043218	Ga0207677_100432182	306
186	3300026035	Ga0207703_10329820	Ga0207703_103298202	306
187	3300026067	Ga0207678_10016122	Ga0207678_100161222	306
188	3300026075	Ga0207708_10359468	Ga0207708_103594682	306
189	3300026089	Ga0207648_10003269	Ga0207648_1000326914	306
190	3300026116	Ga0207674_10023595	Ga0207674_100235952	306
191	3300026116	Ga0207674_10209109	Ga0207674_102091092	306
192	3300026118	Ga0207675_100003516	Ga0207675_1000035163	306
193	3300026142	Ga0207698_10173897	Ga0207698_101738972	306
194	3300026142	Ga0207698_10390872	Ga0207698_103908721	306
195	3300027907	Ga0207428_10069060	Ga0207428_100690603	306
196	3300028381	Ga0268264_10008752	Ga0268264_100087524	306
197	3300028381	Ga0268264_10043067	Ga0268264_100430672	306
198	3300028381	Ga0268264_10046039	Ga0268264_100460392	306
199	3300028381	Ga0268264_10050791	Ga0268264_100507912	306
200	3300028573	Ga0265334_10014652	Ga0265334_100146522	306
201	3300028800	Ga0265338_10168926	Ga0265338_101689262	306
202	3300031250	Ga0265331_10029109	Ga0265331_100291092	306
203	3300031711	Ga0265314_10088089	Ga0265314_100880892	306
204	3300031727	Ga0316576_10021669	Ga0316576_100216692	306
205	3300033180	Ga0307510_10004045	Ga0307510_100040458	306
206	3300037312	Ga0395899_0000174	Ga0395899_0000174_74686_75636	306
207	3300037312	Ga0395899_0010967	Ga0395899_0010967_5978_6904	306
208	3300037312	Ga0395899_0055696	Ga0395899_0055696_1233_2159	306
209	3300037418	Ga0395900_0043373	Ga0395900_0043373_890_1816	306
210	3300037466	Ga0395898_0011961	Ga0395898_0011961_5829_6755	306
211	3300038443	Ga0395901_0053672	Ga0395901_0053672_757_1683	306
212	3300039437	Ga0436365_0716887	Ga0436365_0716887_909_1841	306
213	3300041456	Ga0451795_0891554	Ga0451795_0891554_150_1100	306
214	3300041511	Ga0451855_1562750	Ga0451855_1562750_225_1166	306
215	3300041997	Ga0439431_0023155	Ga0439431_0023155_463_1395	306
216	3300042004	Ga0439445_0031379	Ga0439445_0031379_353_1285	306
217	3300044656	Ga0466969_0000167	Ga0466969_0000167_11974_12900	306
218	3300044683	Ga0466965_0118520	Ga0466965_0118520_27_959	306
219	3300044684	Ga0466966_0000161	Ga0466966_0000161_17358_18284	306
220	3300044712	Ga0453684_0689092	Ga0453684_0689092_89_1039	306
221	3300044842	Ga0466957_0000551	Ga0466957_0000551_39_965	306
222	3300045049	Ga0466959_0000005	Ga0466959_0000005_39892_40818	306
223	3300046507	Ga0495606_0008239	Ga0495606_0008239_5447_6373	306
224	3300049521	Ga0501298_002337	Ga0501298_002337_423_1349	306
225	3300049522	Ga0501299_010541	Ga0501299_010541_45_971	306
226	3300049586	Ga0501070_0014249	Ga0501070_0014249_2823_3749	306
227	3300049590	Ga0501074_0003119	Ga0501074_0003119_5269_6195	306
228	3300049651	Ga0501201_000180	Ga0501201_000180_3917_4843	306
229	3300049652	Ga0501202_003943	Ga0501202_003943_795_1721	306
230	3300049661	Ga0501217_010701	Ga0501217_010701_25_951	306
231	3300049662	Ga0501222_000476	Ga0501222_000476_1345_2271	306
232	3300049664	Ga0501224_002165	Ga0501224_002165_43_969	306
233	3300049666	Ga0501228_001449	Ga0501228_001449_794_1720	306
234	3300049669	Ga0501235_002557	Ga0501235_002557_889_1815	306
235	3300049675	Ga0501243_004021	Ga0501243_004021_889_1815	306
236	3300049686	Ga0501257_036371	Ga0501257_036371_204_1130	306
237	3300049688	Ga0501259_000937	Ga0501259_000937_2648_3574	306
238	3300049690	Ga0501261_002640	Ga0501261_002640_899_1825	306
239	3300049703	Ga0501219_000530	Ga0501219_000530_164_1090	306
240	3300049704	Ga0501221_000102	Ga0501221_000102_8204_9130	306
241	3300049705	Ga0501225_0000356	Ga0501225_0000356_4703_5629	306
242	3300049823	Ga0501044_0084640	Ga0501044_0084640_804_1736	306
243	3300049851	Ga0501212_007011	Ga0501212_007011_186_1112	306
244	3300050005	Ga0501284_00003	Ga0501284_00003_233_1159	306
245	3300053086	Ga0500578_0000718	Ga0500578_0000718_37277_38203	306
246	3300053111	Ga0500572_009594	Ga0500572_009594_1251_2177	306
247	3300053131	Ga0500652_000995	Ga0500652_000995_3459_4391	306
248	3300053139	Ga0500568_0087758	Ga0500568_0087758_173_1105	306
249	3300005290	Ga0065712_10128342	Ga0065712_101283422	307
250	3300005331	Ga0070670_100030103	Ga0070670_1000301034	307
251	3300005339	Ga0070660_100008582	Ga0070660_1000085826	307
252	3300005339	Ga0070660_100110870	Ga0070660_1001108702	307
253	3300005339	Ga0070660_100264885	Ga0070660_1002648851	307
254	3300005340	Ga0070689_100002230	Ga0070689_1000022302	307
255	3300005343	Ga0070687_100027377	Ga0070687_1000273772	307
256	3300005356	Ga0070674_100161600	Ga0070674_1001616002	307
257	3300005364	Ga0070673_100004376	Ga0070673_1000043765	307
258	3300005364	Ga0070673_100061505	Ga0070673_1000615053	307
259	3300005364	Ga0070673_100380768	Ga0070673_1003807681	307
260	3300005365	Ga0070688_100043238	Ga0070688_1000432382	307
261	3300005365	Ga0070688_100050404	Ga0070688_1000504042	307
262	3300005366	Ga0070659_100002698	Ga0070659_1000026988	307
263	3300005366	Ga0070659_100015370	Ga0070659_1000153706	307
264	3300005458	Ga0070681_10131224	Ga0070681_101312243	307
265	3300005466	Ga0070685_10057301	Ga0070685_100573011	307
266	3300005530	Ga0070679_100005166	Ga0070679_1000051665	307
267	3300005530	Ga0070679_100013309	Ga0070679_1000133092	307
268	3300005530	Ga0070679_100060943	Ga0070679_1000609434	307
269	3300005539	Ga0068853_100098011	Ga0068853_1000980112	307
270	3300005543	Ga0070672_100065720	Ga0070672_1000657202	307
271	3300005563	Ga0068855_100048054	Ga0068855_1000480544	307
272	3300005578	Ga0068854_100125930	Ga0068854_1001259302	307
273	3300005616	Ga0068852_100078707	Ga0068852_1000787073	307
274	3300005841	Ga0068863_100424227	Ga0068863_1004242272	307
275	3300005842	Ga0068858_100510792	Ga0068858_1005107921	307
276	3300005844	Ga0068862_100036131	Ga0068862_1000361313	307
277	3300005844	Ga0068862_100200796	Ga0068862_1002007962	307
278	3300009176	Ga0105242_10120592	Ga0105242_101205922	307
279	3300009177	Ga0105248_10499059	Ga0105248_104990591	307
280	3300009545	Ga0105237_10078748	Ga0105237_100787482	307
281	3300009551	Ga0105238_10108616	Ga0105238_101086162	307
282	3300009553	Ga0105249_10014397	Ga0105249_100143973	307
283	3300010375	Ga0105239_10005001	Ga0105239_100050018	307
284	3300013100	Ga0157373_10035115	Ga0157373_100351153	307
285	3300013100	Ga0157373_10161653	Ga0157373_101616532	307
286	3300013102	Ga0157371_10002123	Ga0157371_1000212312	307
287	3300013102	Ga0157371_10002924	Ga0157371_1000292414	307
288	3300013102	Ga0157371_10030732	Ga0157371_100307324	307
289	3300013102	Ga0157371_10139498	Ga0157371_101394982	307
290	3300013102	Ga0157371_10155575	Ga0157371_101555752	307
291	3300013104	Ga0157370_10002386	Ga0157370_1000238611	307
292	3300013297	Ga0157378_10065912	Ga0157378_100659122	307
293	3300013307	Ga0157372_10000891	Ga0157372_1000089117	307
294	3300013307	Ga0157372_10013318	Ga0157372_100133183	307
295	3300013307	Ga0157372_10015360	Ga0157372_100153605	307
296	3300014745	Ga0157377_10050481	Ga0157377_100504812	307
297	3300025893	Ga0207682_10052557	Ga0207682_100525572	307
298	3300025913	Ga0207695_10000092	Ga0207695_1000009255	307
299	3300025914	Ga0207671_10365823	Ga0207671_103658231	307
300	3300025917	Ga0207660_10006054	Ga0207660_100060548	307
301	3300025918	Ga0207662_10029338	Ga0207662_100293382	307
302	3300025918	Ga0207662_10124422	Ga0207662_101244222	307
303	3300025919	Ga0207657_10025421	Ga0207657_100254212	307
304	3300025919	Ga0207657_10139413	Ga0207657_101394132	307
305	3300025921	Ga0207652_10000831	Ga0207652_1000083122	307
306	3300025923	Ga0207681_10128372	Ga0207681_101283723	307
307	3300025925	Ga0207650_10020414	Ga0207650_100204142	307
308	3300025926	Ga0207659_10238754	Ga0207659_102387541	307
309	3300025940	Ga0207691_10041333	Ga0207691_100413333	307
310	3300025942	Ga0207689_10078116	Ga0207689_100781161	307
311	3300025945	Ga0207679_10065341	Ga0207679_100653412	307
312	3300025949	Ga0207667_10001687	Ga0207667_100016873	307
313	3300025960	Ga0207651_10043115	Ga0207651_100431152	307
314	3300025961	Ga0207712_10154546	Ga0207712_101545461	307
315	3300025961	Ga0207712_10161131	Ga0207712_101611312	307
316	3300025981	Ga0207640_10109934	Ga0207640_101099342	307
317	3300026035	Ga0207703_10168064	Ga0207703_101680642	307
318	3300026088	Ga0207641_10533190	Ga0207641_105331901	307
319	3300026116	Ga0207674_10144684	Ga0207674_101446842	307
320	3300031251	Ga0265327_10000648	Ga0265327_100006489	307
321	3300036401	Ga0373937_0235574	Ga0373937_0235574_442_1434	307
322	3300037312	Ga0395899_0009618	Ga0395899_0009618_4084_5013	307
323	3300037418	Ga0395900_0000203	Ga0395900_0000203_41026_41955	307
324	3300037418	Ga0395900_0027824	Ga0395900_0027824_1603_2532	307
325	3300037466	Ga0395898_0001285	Ga0395898_0001285_18161_19090	307
326	3300038443	Ga0395901_0002230	Ga0395901_0002230_15156_16085	307
327	3300044735	Ga0466968_0057674	Ga0466968_0057674_461_1390	307
328	3300046616	Ga0495668_0002821	Ga0495668_0002821_11393_12322	307
329	3300047318	Ga0495636_0000095	Ga0495636_0000095_5211_6134	307
330	3300049570	Ga0501033_0246928	Ga0501033_0246928_263_1192	307
331	3300049571	Ga0501034_0078283	Ga0501034_0078283_228_1157	307
332	3300049767	Ga0501270_009581	Ga0501270_009581_291_1220	307
333	3300049822	Ga0501035_0007663	Ga0501035_0007663_3960_4889	307
334	3300050511	nmdc:mga08y16_50484_c1	nmdc:mga08y16_50484_c1_3355_4320	307
335	3300053163	Ga0500639_069663	Ga0500639_069663_297_1226	307
336	3300002459	JGI24751J29686_10006201	JGI24751J29686_100062012	308
337	3300005331	Ga0070670_100013660	Ga0070670_1000136602	308
338	3300005334	Ga0068869_100002043	Ga0068869_1000020434	308
339	3300005338	Ga0068868_100025038	Ga0068868_1000250382	308
340	3300005338	Ga0068868_100114319	Ga0068868_1001143192	308
341	3300005340	Ga0070689_100020658	Ga0070689_1000206583	308
342	3300005344	Ga0070661_100043146	Ga0070661_1000431463	308
343	3300005354	Ga0070675_100115560	Ga0070675_1001155602	308
344	3300005364	Ga0070673_100028374	Ga0070673_1000283743	308
345	3300005365	Ga0070688_100080749	Ga0070688_1000807493	308
346	3300005367	Ga0070667_100104542	Ga0070667_1001045421	308
347	3300005457	Ga0070662_100135747	Ga0070662_1001357472	308
348	3300005458	Ga0070681_10033300	Ga0070681_100333005	308
349	3300005458	Ga0070681_10242119	Ga0070681_102421191	308
350	3300005544	Ga0070686_100298531	Ga0070686_1002985311	308
351	3300005548	Ga0070665_100124213	Ga0070665_1001242133	308
352	3300005563	Ga0068855_100005142	Ga0068855_10000514212	308
353	3300005564	Ga0070664_100193221	Ga0070664_1001932211	308
354	3300005577	Ga0068857_100105633	Ga0068857_1001056333	308
355	3300005578	Ga0068854_100063389	Ga0068854_1000633892	308
356	3300005617	Ga0068859_100051471	Ga0068859_1000514712	308
357	3300005617	Ga0068859_100443041	Ga0068859_1004430412	308
358	3300005618	Ga0068864_100039378	Ga0068864_1000393782	308
359	3300005618	Ga0068864_100097022	Ga0068864_1000970221	308
360	3300005719	Ga0068861_100088162	Ga0068861_1000881621	308
361	3300005841	Ga0068863_100092283	Ga0068863_1000922833	308
362	3300006844	Ga0075428_100018437	Ga0075428_1000184378	308
363	3300006844	Ga0075428_100041851	Ga0075428_1000418514	308
364	3300006846	Ga0075430_100135164	Ga0075430_1001351642	308
365	3300006847	Ga0075431_100023784	Ga0075431_1000237843	308
366	3300006880	Ga0075429_100004950	Ga0075429_1000049509	308
367	3300006880	Ga0075429_100313074	Ga0075429_1003130741	308
368	3300006931	Ga0097620_100051471	Ga0097620_1000514713	308
369	3300006931	Ga0097620_100442995	Ga0097620_1004429952	308
370	3300009094	Ga0111539_10303914	Ga0111539_103039143	308
371	3300009147	Ga0114129_10334743	Ga0114129_103347433	308
372	3300009176	Ga0105242_10135015	Ga0105242_101350152	308
373	3300009545	Ga0105237_10146114	Ga0105237_101461143	308
374	3300009553	Ga0105249_10012020	Ga0105249_100120202	308
375	3300013102	Ga0157371_10000596	Ga0157371_1000059632	308
376	3300013102	Ga0157371_10008508	Ga0157371_100085084	308
377	3300013102	Ga0157371_10026759	Ga0157371_100267593	308
378	3300013102	Ga0157371_10029167	Ga0157371_100291672	308
379	3300013104	Ga0157370_10001240	Ga0157370_1000124018	308
380	3300013105	Ga0157369_10044911	Ga0157369_100449115	308
381	3300013105	Ga0157369_10068407	Ga0157369_100684072	308
382	3300013296	Ga0157374_10046150	Ga0157374_100461505	308
383	3300013297	Ga0157378_10064856	Ga0157378_100648563	308
384	3300013306	Ga0163162_10024316	Ga0163162_100243165	308
385	3300013306	Ga0163162_10029614	Ga0163162_100296144	308
386	3300013307	Ga0157372_10002466	Ga0157372_1000246619	308
387	3300013307	Ga0157372_10087961	Ga0157372_100879612	308
388	3300013307	Ga0157372_10113387	Ga0157372_101133874	308
389	3300013307	Ga0157372_10303658	Ga0157372_103036583	308
390	3300013308	Ga0157375_10131387	Ga0157375_101313872	308
391	3300014326	Ga0157380_10074391	Ga0157380_100743914	308
392	3300014745	Ga0157377_10018018	Ga0157377_100180182	308
393	3300014969	Ga0157376_10106073	Ga0157376_101060732	308
394	3300014969	Ga0157376_10472780	Ga0157376_104727802	308
395	3300025907	Ga0207645_10008336	Ga0207645_100083364	308
396	3300025909	Ga0207705_10136577	Ga0207705_101365772	308
397	3300025919	Ga0207657_10012812	Ga0207657_100128128	308
398	3300025923	Ga0207681_10059815	Ga0207681_100598152	308
399	3300025925	Ga0207650_10024000	Ga0207650_100240004	308
400	3300025933	Ga0207706_10010460	Ga0207706_100104602	308
401	3300025933	Ga0207706_10041973	Ga0207706_100419735	308
402	3300025934	Ga0207686_10000632	Ga0207686_100006325	308
403	3300025936	Ga0207670_10072721	Ga0207670_100727211	308
404	3300025942	Ga0207689_10016483	Ga0207689_100164832	308
405	3300025942	Ga0207689_10034308	Ga0207689_100343084	308
406	3300025949	Ga0207667_10005263	Ga0207667_100052639	308
407	3300025961	Ga0207712_10011087	Ga0207712_100110872	308
408	3300026023	Ga0207677_10018538	Ga0207677_100185382	308
409	3300026041	Ga0207639_10180101	Ga0207639_101801013	308
410	3300026088	Ga0207641_10011172	Ga0207641_100111722	308
411	3300026089	Ga0207648_10089373	Ga0207648_100893733	308
412	3300026089	Ga0207648_10354945	Ga0207648_103549452	308
413	3300026116	Ga0207674_10215160	Ga0207674_102151602	308
414	3300026116	Ga0207674_10387523	Ga0207674_103875231	308
415	3300031251	Ga0265327_10000084	Ga0265327_10000084188	308
416	3300037312	Ga0395899_0023199	Ga0395899_0023199_3072_4004	308
417	3300037418	Ga0395900_0142991	Ga0395900_0142991_699_1631	308
418	3300037466	Ga0395898_0015964	Ga0395898_0015964_3071_4003	308
419	3300038443	Ga0395901_0002261	Ga0395901_0002261_16333_17265	308
420	3300049661	Ga0501217_003838	Ga0501217_003838_2088_3014	308
421	3300049705	Ga0501225_0012028	Ga0501225_0012028_631_1557	308
422	3300050508	nmdc:mga09592_59541_c1	nmdc:mga09592_59541_c1_2152_3084	308
423	3300050508	nmdc:mga09592_65655_c1	nmdc:mga09592_65655_c1_1817_2749	308
424	3300050509	nmdc:mga0qj67_110865_c1	nmdc:mga0qj67_110865_c1_245_1177	308
425	3300050511	nmdc:mga08y16_104765_c1	nmdc:mga08y16_104765_c1_937_1869	308
426	3300001979	JGI24740J21852_10006389	JGI24740J21852_100063892	309
427	3300003203	JGI25406J46586_10007985	JGI25406J46586_100079851	309
428	3300003322	rootL2_10027437	rootL2_100274372	309
429	3300003323	rootH1_10046815	rootH1_100468154	309
430	3300005577	Ga0068857_100184401	Ga0068857_1001844012	309
431	3300005618	Ga0068864_100168436	Ga0068864_1001684362	309
432	3300005985	Ga0081539_10001220	Ga0081539_1000122014	309
433	3300006931	Ga0097620_100002930	Ga0097620_10000293010	309
434	3300009545	Ga0105237_10027081	Ga0105237_100270813	309
435	3300010375	Ga0105239_10024882	Ga0105239_100248823	309
436	3300026041	Ga0207639_10127081	Ga0207639_101270812	309
437	3300026095	Ga0207676_10145314	Ga0207676_101453142	309
438	3300037312	Ga0395899_0062082	Ga0395899_0062082_721_1656	309
439	3300037418	Ga0395900_0166306	Ga0395900_0166306_159_1157	309
440	3300037471	Ga0395905_0257780	Ga0395905_0257780_376_1311	309
441	3300038443	Ga0395901_0277921	Ga0395901_0277921_425_1423	309
442	3300039437	Ga0436365_1892627	Ga0436365_1892627_7748_8689	309
443	3300005364	Ga0070673_100014656	Ga0070673_1000146562	310
444	3300005366	Ga0070659_100071524	Ga0070659_1000715241	310
445	3300005456	Ga0070678_100050085	Ga0070678_1000500851	310
446	3300005544	Ga0070686_100005927	Ga0070686_1000059272	310
447	3300005614	Ga0068856_100124363	Ga0068856_1001243632	310
448	3300005617	Ga0068859_100360016	Ga0068859_1003600162	310
449	3300006931	Ga0097620_100360007	Ga0097620_1003600072	310
450	3300013297	Ga0157378_10006518	Ga0157378_100065184	310
451	3300013307	Ga0157372_10482626	Ga0157372_104826261	310
452	3300014325	Ga0163163_10066149	Ga0163163_100661494	310
453	3300014968	Ga0157379_10068374	Ga0157379_100683742	310
454	3300025302	Ga0207426_1000002	Ga0207426_1000002274	310
455	3300025925	Ga0207650_10012075	Ga0207650_100120752	310
456	3300025932	Ga0207690_10106819	Ga0207690_101068192	310
457	3300025960	Ga0207651_10121115	Ga0207651_101211151	310
458	3300026023	Ga0207677_10023583	Ga0207677_100235832	310
459	3300026078	Ga0207702_10096111	Ga0207702_100961112	310
460	3300026095	Ga0207676_10099996	Ga0207676_100999962	310
461	3300026121	Ga0207683_10062922	Ga0207683_100629222	310
462	3300006880	Ga0075429_100235970	Ga0075429_1002359702	311
463	3300009177	Ga0105248_10106170	Ga0105248_101061703	311
464	3300013297	Ga0157378_10008259	Ga0157378_100082597	311
465	3300013306	Ga0163162_10000531	Ga0163162_100005315	311
466	3300013308	Ga0157375_10000230	Ga0157375_100002309	311
467	3300014969	Ga0157376_10000514	Ga0157376_1000051417	311
468	3300017792	Ga0163161_10004873	Ga0163161_100048735	311
469	3300025912	Ga0207707_10081061	Ga0207707_100810611	311
470	3300025937	Ga0207669_10355607	Ga0207669_103556071	311
471	3300025941	Ga0207711_10081611	Ga0207711_100816112	311
472	3300025986	Ga0207658_10110943	Ga0207658_101109432	311
473	3300026121	Ga0207683_10131343	Ga0207683_101313432	311
474	3300044712	Ga0453684_0039344	Ga0453684_0039344_5186_6139	311
475	3300047319	Ga0495674_0162379	Ga0495674_0162379_480_1427	311
476	3300048903	Ga0496100_0011901	Ga0496100_0011901_826_1767	311
477	3300048904	Ga0496101_0016539	Ga0496101_0016539_1115_2056	311
478	3300048917	Ga0496114_0009383	Ga0496114_0009383_5556_6497	311
479	3300049570	Ga0501033_0022261	Ga0501033_0022261_2475_3416	311
480	3300049572	Ga0501036_0085222	Ga0501036_0085222_657_1598	311
481	3300049573	Ga0501037_0156892	Ga0501037_0156892_611_1552	311
482	3300049574	Ga0501038_0115207	Ga0501038_0115207_286_1227	311
483	3300049579	Ga0501043_0028370	Ga0501043_0028370_3405_4346	311
484	3300049581	Ga0501047_0098606	Ga0501047_0098606_544_1485	311
485	3300049822	Ga0501035_0061821	Ga0501035_0061821_1582_2523	311
486	3300049823	Ga0501044_0032934	Ga0501044_0032934_1577_2518	311
487	3300050508	nmdc:mga09592_227112_c1	nmdc:mga09592_227112_c1_510_1457	311
488	3300049571	Ga0501034_0000043	Ga0501034_0000043_145633_146577	312
489	2162886007	SwRhRL2b_contig_1762647	SwRhRL2b_0716.00003940	315
490	3300005289	Ga0065704_10070151	Ga0065704_1007015169	315
491	3300025961	Ga0207712_10007819	Ga0207712_100078195	315

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01259

SAICAR_synt

SAICAR synthetase

66

315

0.93 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
3u54-assembly1.cif.gz_A	crystal structure (type-1) of saicar synthetase from pyrococcus horikoshii ot3	0.9053	16	285
2z02-assembly1.cif.gz_B	crystal structure of phosphoribosylaminoimidazolesuccinocarboxamide synthase wit atp from methanocaldococcus jannaschii	0.9045	11	281
2yzl-assembly1.cif.gz_A	crystal structure of phosphoribosylaminoimidazole-succinocarboxamide synthase with adp from methanocaldococcus jannaschii	0.8989	11	281
4o7n-assembly1.cif.gz_A	saicar synthetase (type-2) in complex with adp	0.896	9	285
3u54-assembly1.cif.gz_A	crystal structure (type-1) of saicar synthetase from pyrococcus horikoshii ot3	0.8939	16	285

ID	Description	Score	Start	End	Superfamily
af_P38025_185_330_3.30.470.20	Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain	0.9638	88	228	3.30.470.20
af_P38025_96_184_3.30.200.20	Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1	0.9427	5	86	3.30.200.20
af_P38025_185_330_3.30.470.20	Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain	0.9252	88	228	3.30.470.20
af_Q58987_12_90_3.30.200.20	Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1	0.9093	11	84	3.30.200.20
3r9rA02	Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain	0.906	86	219	3.30.470.20

ID	Description	Score	Start	End	GO Terms
AF-A0A258L8A8-F1-model_v4	phosphoribosylaminoimidazolesuccinocarboxamide synthase (EC 6.3.2.6)	0.9958	1	80	GO:0004639 GO:0005524 GO:0005737 GO:0006189
AF-A0A522DW44-F1-model_v4	phosphoribosylaminoimidazolesuccinocarboxamide synthase (EC 6.3.2.6)	0.9956	27	303	GO:0004639 GO:0005524 GO:0005737 GO:0006189
AF-A0A1J5SX90-F1-model_v4	phosphoribosylaminoimidazolesuccinocarboxamide synthase (EC 6.3.2.6)	0.995	1	305	GO:0004639 GO:0005524 GO:0005737 GO:0006189
AF-A0A662C9Y8-F1-model_v4	phosphoribosylaminoimidazolesuccinocarboxamide synthase (EC 6.3.2.6)	0.994	1	106	GO:0004639 GO:0005524 GO:0005737 GO:0006189
AF-A0A4Q5SW24-F1-model_v4	Phosphoribosylaminoimidazole-succinocarboxamide synthase (EC 6.3.2.6) (SAICAR synthetase)	0.9927	2	302	GO:0004639 GO:0005524 GO:0005737 GO:0006189

Feature Viewer

pLDDT	pTM	Quality
92.72	0.9	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F454058

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF01259

SAICAR_synt

SAICAR synthetase

66

315

0.93

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map