F454067

General Info

Members Datasets Scaffolds Average Seq Length
491 219 982 320

Family's Representative Sequence

Representative Sequence 3300005471|Ga0070698_100000645|Ga0070698_10000064520
Length 370
Sequence LREFSLKVEKNLLQNHFCYACDHINYLTDAAQDLINLSFAQTPEMIVDKYNRVHNYLRISLTDNCNLRCFYCMPEEEYEFTPASKLMQRGEIETLSKIFVDLGVNKIRLTGGEPLVRKDAGEIIRSLSKLPVKLTITTNGSRLHEFVDILEESGVRSLNISLDTLQSEKFQLITRRNQFEKVYENIQLLLKRDFHVKVNMVVMKGLNDNELNDFVEWTKEQPVHVRFIEFMPFTGNWWTSNKVFTMQQMLEVIEAKYKVERLQDEKHDTAKGYQVAGHRGTFAIISTMSANFCGDCNRMRLTADGKMKNCLFSEKETDLLSALRRGEDVVPLIHQSILSKAKELGGQFTTDFEHLHPEDIHNRSMITIGG

Samples

Sample ID Description Type Environment
1 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
4 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
9 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
11 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
12 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
25 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
68 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
69 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
84 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
85 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
93 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
96 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
97 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
98 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
99 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
100 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
102 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
103 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
154 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
157 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
158 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
159 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
160 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
161 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
162 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
163 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
164 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
165 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
166 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
167 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
168 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
169 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
170 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
171 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
172 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
173 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
174 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
175 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
176 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
177 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
178 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
179 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
188 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
191 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
192 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
193 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
194 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
195 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
196 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
197 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
198 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
199 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
200 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
201 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
202 2721755487 Sphingobacterium sp. B29 Isolate Rhizosphere
203 2738541302 Pedobacter sp. CF074 Isolate Unclassified
204 2739367651 Pedobacter sp. OK291 Isolate Unclassified
205 2739367656 Pedobacter sp. CF523 Isolate Unclassified
206 2739367663 Pedobacter sp. YR510 Isolate Unclassified
207 2818991437 Pedobacter terrae 518 Isolate Unclassified
208 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
209 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
210 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
211 2884634485 Algoriphagus kandeliae XY-J91 Isolate Unclassified
212 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
213 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
214 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
215 2977243572 Chryseobacterium sp. SORGH_AS 447 Isolate Unclassified
216 2984572630 Chryseobacterium sp. SORGH_AS909 Isolate Aerial Root
217 2984606641 Chryseobacterium sp. SORGH_AS1175 Isolate Aerial Root
218 2993480792 Chryseobacterium nepalense SLBN-92 Isolate Rhizosphere
219 3003233435 Sphingobacterium shayense CrR18 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.13
Metatranscriptomes 0
Isolates 3.87

Biome Distribution

Category Percentage (%)
Aerial Root 0.41
Bulb 0
Endosphere 3.87
Nodule 0
Rhizoplane 0.41
Rhizosphere 91.45
Stem 0
Stem Tuber 0
Unclassified 15.89

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070698_100000645 3300005471 Bacteria 37282
2 MBSR1b_contig_14105882 2162886012 Bacteria 1937
3 MBSR1b_contig_3801401 2162886012 Bacteria 937
4 JGI25150J39212_1000001 3300002774 Bacteria 1318726
5 JGI25151J46595_10000001 3300003187 Bacteria 887211
6 JGI25153J46596_10000001 3300003215 Bacteria 748985
7 rootH1_10037522 3300003316 Bacteria 3323
8 rootL2_10056263 3300003322 Bacteria 4847
9 rootL2_10068138 3300003322 Bacteria 2391
10 rootL2_10096312 3300003322 Bacteria 4770
11 Ga0055531_10000354 3300003794 Bacteria 44915
12 Ga0065714_10002190 3300005288 Bacteria 114819
13 Ga0065714_10073048 3300005288 Bacteria 3253
14 Ga0065704_10113599 3300005289 Bacteria 1896
15 Ga0065704_10127413 3300005289 Bacteria 1676
16 Ga0065704_10192477 3300005289 Bacteria 1183
17 Ga0065712_10075749 3300005290 Bacteria 3757
18 Ga0065712_10101011 3300005290 Bacteria 2047
19 Ga0065715_10228237 3300005293 Bacteria 1244
20 Ga0070676_10032698 3300005328 Archaea 2981
21 Ga0070676_10066248 3300005328 Bacteria 2158
22 Ga0070683_100002198 3300005329 Bacteria 15442
23 Ga0070683_100009990 3300005329 Bacteria 8138
24 Ga0070670_100064603 3300005331 Bacteria 3140
25 Ga0070670_100136570 3300005331 Bacteria 2119
26 Ga0070670_100214406 3300005331 Unclassified 1674
27 Ga0070677_10015462 3300005333 Unclassified 2704
28 Ga0070677_10023031 3300005333 Unclassified 2302
29 Ga0068869_100016079 3300005334 Bacteria 5037
30 Ga0068869_100016393 3300005334 Unclassified 4993
31 Ga0068869_100051048 3300005334 Bacteria 3000
32 Ga0068869_100103154 3300005334 Unclassified 2160
33 Ga0068869_100133213 3300005334 Unclassified 1912
34 Ga0068869_100160528 3300005334 Unclassified 1750
35 Ga0070666_10000050 3300005335 Bacteria 100280
36 Ga0070666_10103514 3300005335 Bacteria 1964
37 Ga0070680_100000914 3300005336 Bacteria 20881
38 Ga0070682_100002796 3300005337 Bacteria 9669
39 Ga0070682_100009802 3300005337 Bacteria 5423
40 Ga0068868_100001278 3300005338 Bacteria 17323
41 Ga0068868_100021695 3300005338 Bacteria 4838
42 Ga0068868_100089135 3300005338 Bacteria 2483
43 Ga0070660_100043327 3300005339 Bacteria 3439
44 Ga0070689_100003464 3300005340 Bacteria 10499
45 Ga0070689_100037229 3300005340 Bacteria 3721
46 Ga0070691_10001334 3300005341 Bacteria 10499
47 Ga0070687_100035931 3300005343 Bacteria 2465
48 Ga0070687_100055847 3300005343 Bacteria 2064
49 Ga0070661_100001199 3300005344 Bacteria 18295
50 Ga0070668_100028205 3300005347 Bacteria 4263
51 Ga0070668_100042416 3300005347 Unclassified 3487
52 Ga0070668_100074083 3300005347 Unclassified 2655
53 Ga0070669_100015785 3300005353 Bacteria 5386
54 Ga0070669_100076445 3300005353 Bacteria 2485
55 Ga0070675_100005613 3300005354 Bacteria 9606
56 Ga0070675_100050251 3300005354 Unclassified 3423
57 Ga0070675_100105349 3300005354 Bacteria 2379
58 Ga0070675_100142575 3300005354 Bacteria 2049
59 Ga0070675_100154998 3300005354 Bacteria 1966
60 Ga0070675_100197075 3300005354 Bacteria 1747
61 Ga0070671_100065142 3300005355 Bacteria 3035
62 Ga0070671_100136009 3300005355 Bacteria 2072
63 Ga0070671_100240452 3300005355 Bacteria 1537
64 Ga0070674_100370392 3300005356 Unclassified 1162
65 Ga0070673_100028180 3300005364 Bacteria 4174
66 Ga0070673_100046405 3300005364 Unclassified 3375
67 Ga0070673_100056009 3300005364 Unclassified 3108
68 Ga0070673_100193882 3300005364 Bacteria 1746
69 Ga0070688_100010284 3300005365 Bacteria 5154
70 Ga0070659_100002681 3300005366 Bacteria 12650
71 Ga0070667_100013577 3300005367 Bacteria 6731
72 Ga0070667_100031194 3300005367 Unclassified 4444
73 Ga0070667_100049300 3300005367 Bacteria 3546
74 Ga0070667_100342647 3300005367 Bacteria 1352
75 Ga0070701_10053199 3300005438 Bacteria 2106
76 Ga0070700_100113384 3300005441 Bacteria 1806
77 Ga0070678_100029166 3300005456 Unclassified 3775
78 Ga0070678_100207190 3300005456 Unclassified 1622
79 Ga0070678_100380061 3300005456 Bacteria 1222
80 Ga0070662_100007205 3300005457 Bacteria 7203
81 Ga0070662_100158875 3300005457 Unclassified 1767
82 Ga0070681_10017119 3300005458 Bacteria 7246
83 Ga0068867_100010190 3300005459 Bacteria 6629
84 Ga0068867_100062701 3300005459 Archaea 2762
85 Ga0068867_100102926 3300005459 Unclassified 2183
86 Ga0068867_100332415 3300005459 Bacteria 1262
87 Ga0070685_10011303 3300005466 Bacteria 4674
88 Ga0070685_10044248 3300005466 Bacteria 2548
89 Ga0070685_10076106 3300005466 Bacteria 2001
90 Ga0070685_10110603 3300005466 Bacteria 1691
91 Ga0070679_100004228 3300005530 Bacteria 13253
92 Ga0070684_100000298 3300005535 Bacteria 34479
93 Ga0070684_100000731 3300005535 Bacteria 22754
94 Ga0070684_100022231 3300005535 Bacteria 5286
95 Ga0070684_100025483 3300005535 Bacteria 4973
96 Ga0068853_100003450 3300005539 Bacteria 12095
97 Ga0068853_100160674 3300005539 Unclassified 2027
98 Ga0070672_100017033 3300005543 Bacteria 5219
99 Ga0070672_100041853 3300005543 Unclassified 3525
100 Ga0070672_100058521 3300005543 Bacteria 3029
101 Ga0070672_100087881 3300005543 Bacteria 2502
102 Ga0070693_100006720 3300005547 Bacteria 5585
103 Ga0070693_100052875 3300005547 Bacteria 2330
104 Ga0070665_100068668 3300005548 Unclassified 3554
105 Ga0068855_100039140 3300005563 Bacteria 5628
106 Ga0070664_100000884 3300005564 Bacteria 23265
107 Ga0070664_100036166 3300005564 Bacteria 4148
108 Ga0070664_100053303 3300005564 Bacteria 3428
109 Ga0070664_100122531 3300005564 Bacteria 2278
110 Ga0070664_100250488 3300005564 Unclassified 1592
111 Ga0068857_100001112 3300005577 Bacteria 20920
112 Ga0068857_100103187 3300005577 Bacteria 2560
113 Ga0068857_100249769 3300005577 Unclassified 1626
114 Ga0068854_100112316 3300005578 Bacteria 2057
115 Ga0070702_100070548 3300005615 Bacteria 2063
116 Ga0068852_100067685 3300005616 Unclassified 3123
117 Ga0068859_100000025 3300005617 Bacteria 191679
118 Ga0068859_100004404 3300005617 Bacteria 14371
119 Ga0068859_100007493 3300005617 Bacteria 11079
120 Ga0068859_100020064 3300005617 Bacteria 6710
121 Ga0068859_100035579 3300005617 Bacteria 4996
122 Ga0068859_100069053 3300005617 Bacteria 3568
123 Ga0068859_100085349 3300005617 Unclassified 3202
124 Ga0068859_100126345 3300005617 Bacteria 2626
125 Ga0068859_100267957 3300005617 Bacteria 1800
126 Ga0068859_100361922 3300005617 Bacteria 1546
127 Ga0068859_100764705 3300005617 Unclassified 1055
128 Ga0068864_100012580 3300005618 Bacteria 6996
129 Ga0068864_100023053 3300005618 Bacteria 5226
130 Ga0068864_100033399 3300005618 Bacteria 4374
131 Ga0068864_100057609 3300005618 Bacteria 3357
132 Ga0068864_100085654 3300005618 Bacteria 2771
133 Ga0068864_100096524 3300005618 Bacteria 2616
134 Ga0068864_100345535 3300005618 Bacteria 1403
135 Ga0068861_100003118 3300005719 Bacteria 10950
136 Ga0068861_100188441 3300005719 Bacteria 1723
137 Ga0068861_100323446 3300005719 Archaea 1344
138 Ga0068851_10024316 3300005834 Bacteria 2966
139 Ga0068851_10052459 3300005834 Unclassified 2073
140 Ga0068870_10056988 3300005840 Bacteria 2087
141 Ga0068863_100004643 3300005841 Bacteria 13544
142 Ga0068863_100026404 3300005841 Bacteria 5540
143 Ga0068863_100063617 3300005841 Bacteria 3489
144 Ga0068863_100096451 3300005841 Unclassified 2807
145 Ga0068863_100268900 3300005841 Bacteria 1650
146 Ga0068858_100018416 3300005842 Bacteria 6537
147 Ga0068858_100035184 3300005842 Bacteria 4645
148 Ga0068858_100139611 3300005842 Bacteria 2274
149 Ga0068858_100412780 3300005842 Unclassified 1298
150 Ga0068860_100001253 3300005843 Bacteria 27686
151 Ga0068860_100010864 3300005843 Bacteria 8978
152 Ga0068860_100030957 3300005843 Bacteria 5145
153 Ga0068860_100052401 3300005843 Bacteria 3882
154 Ga0068860_100179452 3300005843 Unclassified 2047
155 Ga0068860_100277124 3300005843 Bacteria 1638
156 Ga0068862_100029430 3300005844 Bacteria 4629
157 Ga0068862_100134639 3300005844 Bacteria 2189
158 Ga0068862_100137426 3300005844 Bacteria 2167
159 Ga0068862_100291881 3300005844 Unclassified 1498
160 Ga0075366_10013347 3300006195 Bacteria 4675
161 Ga0097621_100104446 3300006237 Unclassified 2387
162 Ga0097621_100112021 3300006237 Unclassified 2306
163 Ga0097621_100160748 3300006237 Bacteria 1931
164 Ga0097621_100197829 3300006237 Bacteria 1743
165 Ga0097621_100259673 3300006237 Bacteria 1523
166 Ga0068871_100002075 3300006358 Bacteria 13555
167 Ga0068871_100015946 3300006358 Bacteria 5644
168 Ga0068871_100152679 3300006358 Bacteria 1970
169 Ga0075428_100006620 3300006844 Bacteria 12891
170 Ga0075430_100047579 3300006846 Bacteria 3622
171 Ga0075431_100022307 3300006847 Bacteria 6471
172 Ga0068865_100004271 3300006881 Bacteria 8620
173 Ga0068865_100421088 3300006881 Bacteria 1098
174 Ga0097620_100000025 3300006931 Bacteria 191679
175 Ga0097620_100004404 3300006931 Bacteria 14371
176 Ga0097620_100007493 3300006931 Bacteria 11079
177 Ga0097620_100020064 3300006931 Bacteria 6710
178 Ga0097620_100035579 3300006931 Bacteria 4996
179 Ga0097620_100069050 3300006931 Bacteria 3568
180 Ga0097620_100085350 3300006931 Unclassified 3202
181 Ga0097620_100126343 3300006931 Bacteria 2626
182 Ga0097620_100267927 3300006931 Bacteria 1800
183 Ga0097620_100361938 3300006931 Bacteria 1546
184 Ga0097620_100764651 3300006931 Unclassified 1055
185 Ga0105240_10012234 3300009093 Bacteria 11862
186 Ga0111539_10002837 3300009094 Bacteria 23041
187 Ga0111539_10110057 3300009094 Unclassified 3233
188 Ga0111539_10152829 3300009094 Bacteria 2701
189 Ga0105245_10108283 3300009098 Bacteria 2581
190 Ga0105245_10182499 3300009098 Bacteria 2006
191 Ga0105247_10005807 3300009101 Bacteria 7719
192 Ga0105247_10007209 3300009101 Bacteria 6826
193 Ga0105241_10000691 3300009174 Bacteria 25438
194 Ga0105241_10032965 3300009174 Unclassified 3886
195 Ga0105241_10104091 3300009174 Bacteria 2261
196 Ga0105242_10623091 3300009176 Bacteria 1045
197 Ga0105248_10157344 3300009177 Bacteria 2564
198 Ga0105237_10014702 3300009545 Bacteria 8172
199 Ga0105249_10001240 3300009553 Bacteria 22411
200 Ga0105249_10006762 3300009553 Bacteria 9991
201 Ga0105249_10010178 3300009553 Bacteria 8257
202 Ga0105249_10087723 3300009553 Bacteria 2904
203 Ga0105249_10087968 3300009553 Bacteria 2900
204 Ga0105249_10207710 3300009553 Unclassified 1920
205 Ga0105249_10214397 3300009553 Bacteria 1891
206 Ga0105249_10523717 3300009553 Unclassified 1233
207 Ga0105239_10345992 3300010375 Bacteria 1678
208 Ga0105246_10060681 3300011119 Bacteria 2628
209 Ga0157371_10003679 3300013102 Bacteria 13763
210 Ga0157371_10015182 3300013102 Bacteria 5783
211 Ga0157370_10025274 3300013104 Bacteria 5879
212 Ga0157370_10224558 3300013104 Bacteria 1739
213 Ga0157370_10395097 3300013104 Bacteria 1273
214 Ga0157369_10362375 3300013105 Unclassified 1505
215 Ga0157374_10000955 3300013296 Bacteria 25080
216 Ga0157374_10132282 3300013296 Bacteria 2415
217 Ga0157374_10136510 3300013296 Bacteria 2378
218 Ga0157374_10251812 3300013296 Bacteria 1738
219 Ga0157374_10257639 3300013296 Bacteria 1718
220 Ga0157378_10026297 3300013297 Bacteria 5130
221 Ga0157378_10037295 3300013297 Bacteria 4304
222 Ga0157378_10086406 3300013297 Bacteria 2843
223 Ga0157378_10087156 3300013297 Bacteria 2832
224 Ga0157378_10153707 3300013297 Bacteria 2146
225 Ga0157378_10269120 3300013297 Unclassified 1638
226 Ga0157378_10595671 3300013297 Bacteria 1116
227 Ga0163162_10000344 3300013306 Bacteria 42218
228 Ga0163162_10003357 3300013306 Bacteria 15306
229 Ga0163162_10029655 3300013306 Bacteria 5416
230 Ga0163162_10110618 3300013306 Bacteria 2844
231 Ga0163162_10151291 3300013306 Bacteria 2439
232 Ga0163162_10273007 3300013306 Bacteria 1823
233 Ga0163162_10405634 3300013306 Unclassified 1496
234 Ga0163162_10858077 3300013306 Unclassified 1023
235 Ga0157372_10066083 3300013307 Bacteria 4063
236 Ga0157372_10165026 3300013307 Unclassified 2561
237 Ga0157375_10002578 3300013308 Bacteria 15745
238 Ga0157375_10027018 3300013308 Bacteria 5359
239 Ga0157375_10059161 3300013308 Bacteria 3795
240 Ga0157375_10076468 3300013308 Bacteria 3375
241 Ga0157375_10218257 3300013308 Unclassified 2065
242 Ga0157375_10952105 3300013308 Unclassified 1000
243 Ga0163163_10000075 3300014325 Bacteria 109545
244 Ga0163163_10078028 3300014325 Bacteria 3308
245 Ga0163163_10272098 3300014325 Bacteria 1745
246 Ga0157380_10003006 3300014326 Bacteria 11479
247 Ga0157380_10003893 3300014326 Bacteria 10295
248 Ga0157380_10053159 3300014326 Bacteria 3210
249 Ga0157380_10096604 3300014326 Bacteria 2450
250 Ga0157380_10359999 3300014326 Unclassified 1365
251 Ga0157377_10017655 3300014745 Bacteria 3694
252 Ga0157377_10021099 3300014745 Bacteria 3421
253 Ga0157377_10080207 3300014745 Unclassified 1906
254 Ga0157377_10139023 3300014745 Unclassified 1491
255 Ga0157379_10030269 3300014968 Bacteria 4817
256 Ga0157379_10064290 3300014968 Bacteria 3279
257 Ga0157379_10219787 3300014968 Bacteria 1721
258 Ga0157376_10007363 3300014969 Bacteria 7848
259 Ga0157376_10018590 3300014969 Bacteria 5333
260 Ga0157376_10128729 3300014969 Bacteria 2256
261 Ga0157376_10555861 3300014969 Bacteria 1136
262 Ga0183373_1003 3300015682 Bacteria 558813
263 Ga0163161_10000046 3300017792 Bacteria 127211
264 Ga0163161_10000890 3300017792 Bacteria 23195
265 Ga0163161_10002168 3300017792 Bacteria 14151
266 Ga0163161_10015502 3300017792 Bacteria 5314
267 Ga0163161_10055848 3300017792 Bacteria 2867
268 Ga0163161_10123119 3300017792 Bacteria 1950
269 Ga0163161_10249673 3300017792 Bacteria 1383
270 Ga0207425_1000002 3300025245 Bacteria 1362590
271 Ga0209129_1000002 3300025258 Bacteria 1359086
272 Ga0209676_1000001 3300025292 Bacteria 1852142
273 Ga0209025_1000004 3300025294 Bacteria 1361782
274 Ga0209758_1000006 3300025297 Bacteria 1359562
275 Ga0209050_1000258 3300025298 Bacteria 113741
276 Ga0209257_1000008 3300025304 Bacteria 1294570
277 Ga0207697_10038686 3300025315 Bacteria 1956
278 Ga0207656_10112962 3300025321 Bacteria 1257
279 Ga0207682_10106942 3300025893 Bacteria 1228
280 Ga0207710_10000852 3300025900 Bacteria 16442
281 Ga0207710_10011865 3300025900 Bacteria 3666
282 Ga0207710_10019361 3300025900 Unclassified 2904
283 Ga0207688_10239744 3300025901 Bacteria 1096
284 Ga0207680_10000086 3300025903 Bacteria 42622
285 Ga0207680_10088010 3300025903 Bacteria 1968
286 Ga0207680_10260880 3300025903 Bacteria 1199
287 Ga0207645_10003860 3300025907 Bacteria 11217
288 Ga0207645_10005381 3300025907 Bacteria 9293
289 Ga0207645_10038583 3300025907 Unclassified 3062
290 Ga0207645_10054609 3300025907 Bacteria 2551
291 Ga0207643_10004125 3300025908 Bacteria 7826
292 Ga0207643_10034411 3300025908 Bacteria 2839
293 Ga0207643_10099197 3300025908 Bacteria 1707
294 Ga0207705_10283498 3300025909 Bacteria 1268
295 Ga0207654_10000361 3300025911 Bacteria 26751
296 Ga0207707_10000979 3300025912 Bacteria 27423
297 Ga0207695_10011799 3300025913 Bacteria 10543
298 Ga0207671_10014756 3300025914 Bacteria 6159
299 Ga0207660_10003834 3300025917 Bacteria 9803
300 Ga0207662_10043344 3300025918 Bacteria 2654
301 Ga0207681_10005582 3300025923 Bacteria 7729
302 Ga0207681_10441048 3300025923 Archaea 1058
303 Ga0207650_10145085 3300025925 Bacteria 1869
304 Ga0207650_10184102 3300025925 Unclassified 1666
305 Ga0207659_10064188 3300025926 Bacteria 2657
306 Ga0207659_10321186 3300025926 Bacteria 1277
307 Ga0207644_10058049 3300025931 Bacteria 2796
308 Ga0207644_10127656 3300025931 Bacteria 1943
309 Ga0207644_10279577 3300025931 Unclassified 1340
310 Ga0207644_10324780 3300025931 Unclassified 1245
311 Ga0207706_10024433 3300025933 Bacteria 5418
312 Ga0207686_10003202 3300025934 Bacteria 8808
313 Ga0207686_10114401 3300025934 Unclassified 1826
314 Ga0207709_10000049 3300025935 Bacteria 237124
315 Ga0207670_10016633 3300025936 Bacteria 4426
316 Ga0207670_10168155 3300025936 Bacteria 1642
317 Ga0207669_10030826 3300025937 Bacteria 2986
318 Ga0207704_10224008 3300025938 Bacteria 1394
319 Ga0207691_10009095 3300025940 Bacteria 9534
320 Ga0207691_10014205 3300025940 Bacteria 7596
321 Ga0207691_10030538 3300025940 Bacteria 5035
322 Ga0207691_10233332 3300025940 Bacteria 1593
323 Ga0207691_10327859 3300025940 Unclassified 1312
324 Ga0207691_10379929 3300025940 Bacteria 1206
325 Ga0207711_10135363 3300025941 Bacteria 2213
326 Ga0207689_10003687 3300025942 Bacteria 13959
327 Ga0207689_10007911 3300025942 Bacteria 9285
328 Ga0207689_10050693 3300025942 Unclassified 3422
329 Ga0207689_10088422 3300025942 Unclassified 2545
330 Ga0207689_10182134 3300025942 Unclassified 1732
331 Ga0207689_10218794 3300025942 Bacteria 1573
332 Ga0207689_10230924 3300025942 Unclassified 1529
333 Ga0207689_10251253 3300025942 Bacteria 1462
334 Ga0207661_10000738 3300025944 Bacteria 21229
335 Ga0207661_10109738 3300025944 Bacteria 2331
336 Ga0207679_10000902 3300025945 Bacteria 18967
337 Ga0207679_10024631 3300025945 Bacteria 4128
338 Ga0207679_10097660 3300025945 Bacteria 2288
339 Ga0207679_10273279 3300025945 Bacteria 1446
340 Ga0207667_10075605 3300025949 Bacteria 3497
341 Ga0207667_10191258 3300025949 Bacteria 2100
342 Ga0207667_10275895 3300025949 Bacteria 1718
343 Ga0207667_10370126 3300025949 Unclassified 1460
344 Ga0207651_10305602 3300025960 Bacteria 1324
345 Ga0207712_10003644 3300025961 Bacteria 9703
346 Ga0207712_10004435 3300025961 Bacteria 8865
347 Ga0207712_10022689 3300025961 Bacteria 4136
348 Ga0207712_10077235 3300025961 Bacteria 2413
349 Ga0207712_10322834 3300025961 Unclassified 1274
350 Ga0207668_10029049 3300025972 Unclassified 3621
351 Ga0207668_10030322 3300025972 Bacteria 3553
352 Ga0207640_10055868 3300025981 Unclassified 2588
353 Ga0207640_10128671 3300025981 Bacteria 1827
354 Ga0207658_10007791 3300025986 Bacteria 7294
355 Ga0207658_10055575 3300025986 Bacteria 2934
356 Ga0207658_10102894 3300025986 Bacteria 2241
357 Ga0207677_10015160 3300026023 Unclassified 4524
358 Ga0207677_10024262 3300026023 Bacteria 3764
359 Ga0207677_10036702 3300026023 Bacteria 3197
360 Ga0207703_10010342 3300026035 Bacteria 7304
361 Ga0207703_10506629 3300026035 Bacteria 1134
362 Ga0207639_10003196 3300026041 Bacteria 11015
363 Ga0207639_10145169 3300026041 Unclassified 1981
364 Ga0207639_10209377 3300026041 Unclassified 1677
365 Ga0207678_10140898 3300026067 Unclassified 2058
366 Ga0207678_10173022 3300026067 Unclassified 1844
367 Ga0207708_10165286 3300026075 Bacteria 1749
368 Ga0207708_10170780 3300026075 Bacteria 1722
369 Ga0207641_10000380 3300026088 Bacteria 52801
370 Ga0207641_10000661 3300026088 Bacteria 37590
371 Ga0207641_10025398 3300026088 Bacteria 4885
372 Ga0207641_10137453 3300026088 Bacteria 2201
373 Ga0207641_10139957 3300026088 Bacteria 2182
374 Ga0207641_10339233 3300026088 Bacteria 1430
375 Ga0207641_10439239 3300026088 Bacteria 1259
376 Ga0207648_10003599 3300026089 Bacteria 16209
377 Ga0207648_10012445 3300026089 Bacteria 7966
378 Ga0207648_10015417 3300026089 Bacteria 7031
379 Ga0207648_10016524 3300026089 Bacteria 6739
380 Ga0207648_10239323 3300026089 Bacteria 1616
381 Ga0207676_10009979 3300026095 Bacteria 6756
382 Ga0207676_10018751 3300026095 Bacteria 5037
383 Ga0207676_10033373 3300026095 Bacteria 3888
384 Ga0207676_10097429 3300026095 Bacteria 2430
385 Ga0207676_10162146 3300026095 Bacteria 1938
386 Ga0207674_10003262 3300026116 Bacteria 19959
387 Ga0207674_10050823 3300026116 Bacteria 4233
388 Ga0207674_10054955 3300026116 Bacteria 4051
389 Ga0207674_10223810 3300026116 Unclassified 1830
390 Ga0207675_100001429 3300026118 Bacteria 23947
391 Ga0207675_100002458 3300026118 Bacteria 18348
392 Ga0207675_100100436 3300026118 Bacteria 2726
393 Ga0207675_100149008 3300026118 Unclassified 2226
394 Ga0207683_10003509 3300026121 Bacteria 13675
395 Ga0207683_10221730 3300026121 Bacteria 1723
396 Ga0207683_10224962 3300026121 Bacteria 1710
397 Ga0207683_10263866 3300026121 Unclassified 1573
398 Ga0207698_10002995 3300026142 Bacteria 10135
399 Ga0207698_10121258 3300026142 Bacteria 2214
400 Ga0207698_10327502 3300026142 Bacteria 1437
401 Ga0207428_10214034 3300027907 Bacteria 1447
402 Ga0268265_10119737 3300028380 Unclassified 2167
403 Ga0268265_10145548 3300028380 Bacteria 1990
404 Ga0268264_10002545 3300028381 Bacteria 15994
405 Ga0268264_10035710 3300028381 Bacteria 4092
406 Ga0268264_10058470 3300028381 Bacteria 3229
407 Ga0268264_10122294 3300028381 Bacteria 2295
408 Ga0307515_10000162 3300028794 Bacteria 163720
409 Ga0307515_10009312 3300028794 Bacteria 19000
410 Ga0265327_10000034 3300031251 Bacteria 316018
411 Ga0307513_10199579 3300031456 Bacteria 1843
412 Ga0307513_10348649 3300031456 Bacteria 1229
413 Ga0307407_10000024 3300031903 Bacteria 113716
414 Ga0307412_10000031 3300031911 Bacteria 207128
415 Ga0307409_100121916 3300031995 Bacteria 2210
416 Ga0307416_100000037 3300032002 Bacteria 137513
417 Ga0307414_10001701 3300032004 Bacteria 11461
418 Ga0307414_10006990 3300032004 Bacteria 6326
419 Ga0307414_10063207 3300032004 Bacteria 2630
420 Ga0316583_10009883 3300032133 Bacteria 3436
421 Ga0316583_10068275 3300032133 Bacteria 1244
422 Ga0451807_1181851 3300041486 Unclassified 1116
423 Ga0439449_0013962 3300042007 Bacteria 3021
424 Ga0450923_003783 3300042125 Bacteria 2321
425 Ga0451577_0118220 3300042876 Bacteria 2374
426 Ga0466972_0000020 3300044658 Bacteria 197336
427 Ga0453684_0031258 3300044712 Bacteria 7489
428 Ga0453684_0106070 3300044712 Bacteria 3425
429 Ga0453684_0382731 3300044712 Bacteria 1579
430 Ga0466970_0001662 3300044765 Bacteria 10675
431 Ga0466959_0040336 3300045049 Bacteria 3449
432 Ga0495608_0039902 3300046511 Bacteria 3146
433 Ga0495621_0036741 3300046539 Bacteria 1701
434 Ga0495668_0000489 3300046616 Bacteria 49613
435 Ga0495668_0014735 3300046616 Bacteria 4578
436 Ga0495674_0064405 3300047319 Bacteria 3187
437 Ga0495686_0067990 3300047472 Bacteria 2198
438 Ga0495686_0103088 3300047472 Bacteria 1719
439 Ga0496110_0020348 3300048913 Bacteria 5603
440 Ga0501031_0009213 3300049568 Bacteria 6418
441 Ga0501032_0003398 3300049569 Bacteria 12190
442 Ga0501032_0005879 3300049569 Bacteria 9072
443 Ga0501032_0060655 3300049569 Bacteria 2537
444 Ga0501033_0001504 3300049570 Bacteria 20644
445 Ga0501033_0016687 3300049570 Bacteria 5554
446 Ga0501034_0009004 3300049571 Bacteria 10484
447 Ga0501034_0020736 3300049571 Bacteria 6709
448 Ga0501036_0403915 3300049572 Bacteria 1140
449 Ga0501038_0012559 3300049574 Bacteria 7740
450 Ga0501038_0015850 3300049574 Bacteria 6848
451 Ga0501038_0104029 3300049574 Bacteria 2360
452 Ga0501043_0034896 3300049579 Bacteria 3956
453 Ga0501043_0036714 3300049579 Unclassified 3855
454 Ga0501047_0011195 3300049581 Bacteria 8489
455 Ga0501047_0326761 3300049581 Bacteria 1373
456 Ga0501241_000931 3300049758 Bacteria 6209
457 Ga0501035_0014615 3300049822 Bacteria 7246
458 Ga0501044_0007058 3300049823 Bacteria 12361
459 Ga0501045_0002787 3300049824 Bacteria 11945
460 nmdc:mga0k408_4631_c1 3300050493 Bacteria 7285
461 nmdc:mga05p37_214012_c1 3300050507 Bacteria 2328
462 nmdc:mga0qj67_25694_c1 3300050509 Bacteria 4552
463 nmdc:mga06r32_508524_c1 3300050510 Unclassified 1181
464 nmdc:mga08y16_234069_c1 3300050511 Bacteria 1899
465 nmdc:mga08y16_458568_c1 3300050511 Bacteria 1299
466 nmdc:mga08y16_64328_c1 3300050511 Bacteria 3830
467 Ga0500559_0025438 3300053136 Unclassified 2518
468 Ga0500616_0009323 3300053153 Bacteria 5978
469 Ga0500616_0038031 3300053153 Bacteria 2601
470 Ga0500622_0000844 3300053156 Bacteria 26216
471 Ga0500611_000002 3300053727 Bacteria 345991
472 Ga0500645_075571 3300053730 Unclassified 964
473 2586209283 2585427687 Bacteria 5544917
474 2722729850 2721755487 Bacteria 6357185
475 2738855745 2738541302 Bacteria 5944758
476 2739590202 2739367651 Bacteria 6359826
477 2739615992 2739367656 Bacteria 5152243
478 2739647718 2739367663 Bacteria 5040914
479 2819548404 2818991437 Bacteria 5805520
480 2842723027 2842722452 Bacteria 6263924
481 2842913983 2842909656 Bacteria 6185908
482 2857628532 2857627736 Bacteria 5625397
483 2884636338 2884634485 Bacteria 3928637
484 2904449525 2904445276 Bacteria 5310396
485 2946000001 2945997725 Bacteria 6404843
486 2954016600 2954016120 Bacteria 6446024
487 2977245467 2977243572 Bacteria 4374394
488 2984575699 2984572630 Bacteria 4186940
489 2984609153 2984606641 Bacteria 4186971
490 2993483815 2993480792 Bacteria 4022225
491 3003236668 3003233435 Bacteria 4458031
492 Ga0070698_100000645
493 MBSR1b_contig_14105882
494 MBSR1b_contig_3801401
495 JGI25150J39212_1000001
496 JGI25151J46595_10000001
497 JGI25153J46596_10000001
498 rootH1_10037522
499 rootL2_10056263
500 rootL2_10068138
501 rootL2_10096312
502 Ga0055531_10000354
503 Ga0065714_10002190
504 Ga0065714_10073048
505 Ga0065704_10113599
506 Ga0065704_10127413
507 Ga0065704_10192477
508 Ga0065712_10075749
509 Ga0065712_10101011
510 Ga0065715_10228237
511 Ga0070676_10032698
512 Ga0070676_10066248
513 Ga0070683_100002198
514 Ga0070683_100009990
515 Ga0070670_100064603
516 Ga0070670_100136570
517 Ga0070670_100214406
518 Ga0070677_10015462
519 Ga0070677_10023031
520 Ga0068869_100016079
521 Ga0068869_100016393
522 Ga0068869_100051048
523 Ga0068869_100103154
524 Ga0068869_100133213
525 Ga0068869_100160528
526 Ga0070666_10000050
527 Ga0070666_10103514
528 Ga0070680_100000914
529 Ga0070682_100002796
530 Ga0070682_100009802
531 Ga0068868_100001278
532 Ga0068868_100021695
533 Ga0068868_100089135
534 Ga0070660_100043327
535 Ga0070689_100003464
536 Ga0070689_100037229
537 Ga0070691_10001334
538 Ga0070687_100035931
539 Ga0070687_100055847
540 Ga0070661_100001199
541 Ga0070668_100028205
542 Ga0070668_100042416
543 Ga0070668_100074083
544 Ga0070669_100015785
545 Ga0070669_100076445
546 Ga0070675_100005613
547 Ga0070675_100050251
548 Ga0070675_100105349
549 Ga0070675_100142575
550 Ga0070675_100154998
551 Ga0070675_100197075
552 Ga0070671_100065142
553 Ga0070671_100136009
554 Ga0070671_100240452
555 Ga0070674_100370392
556 Ga0070673_100028180
557 Ga0070673_100046405
558 Ga0070673_100056009
559 Ga0070673_100193882
560 Ga0070688_100010284
561 Ga0070659_100002681
562 Ga0070667_100013577
563 Ga0070667_100031194
564 Ga0070667_100049300
565 Ga0070667_100342647
566 Ga0070701_10053199
567 Ga0070700_100113384
568 Ga0070678_100029166
569 Ga0070678_100207190
570 Ga0070678_100380061
571 Ga0070662_100007205
572 Ga0070662_100158875
573 Ga0070681_10017119
574 Ga0068867_100010190
575 Ga0068867_100062701
576 Ga0068867_100102926
577 Ga0068867_100332415
578 Ga0070685_10011303
579 Ga0070685_10044248
580 Ga0070685_10076106
581 Ga0070685_10110603
582 Ga0070679_100004228
583 Ga0070684_100000298
584 Ga0070684_100000731
585 Ga0070684_100022231
586 Ga0070684_100025483
587 Ga0068853_100003450
588 Ga0068853_100160674
589 Ga0070672_100017033
590 Ga0070672_100041853
591 Ga0070672_100058521
592 Ga0070672_100087881
593 Ga0070693_100006720
594 Ga0070693_100052875
595 Ga0070665_100068668
596 Ga0068855_100039140
597 Ga0070664_100000884
598 Ga0070664_100036166
599 Ga0070664_100053303
600 Ga0070664_100122531
601 Ga0070664_100250488
602 Ga0068857_100001112
603 Ga0068857_100103187
604 Ga0068857_100249769
605 Ga0068854_100112316
606 Ga0070702_100070548
607 Ga0068852_100067685
608 Ga0068859_100000025
609 Ga0068859_100004404
610 Ga0068859_100007493
611 Ga0068859_100020064
612 Ga0068859_100035579
613 Ga0068859_100069053
614 Ga0068859_100085349
615 Ga0068859_100126345
616 Ga0068859_100267957
617 Ga0068859_100361922
618 Ga0068859_100764705
619 Ga0068864_100012580
620 Ga0068864_100023053
621 Ga0068864_100033399
622 Ga0068864_100057609
623 Ga0068864_100085654
624 Ga0068864_100096524
625 Ga0068864_100345535
626 Ga0068861_100003118
627 Ga0068861_100188441
628 Ga0068861_100323446
629 Ga0068851_10024316
630 Ga0068851_10052459
631 Ga0068870_10056988
632 Ga0068863_100004643
633 Ga0068863_100026404
634 Ga0068863_100063617
635 Ga0068863_100096451
636 Ga0068863_100268900
637 Ga0068858_100018416
638 Ga0068858_100035184
639 Ga0068858_100139611
640 Ga0068858_100412780
641 Ga0068860_100001253
642 Ga0068860_100010864
643 Ga0068860_100030957
644 Ga0068860_100052401
645 Ga0068860_100179452
646 Ga0068860_100277124
647 Ga0068862_100029430
648 Ga0068862_100134639
649 Ga0068862_100137426
650 Ga0068862_100291881
651 Ga0075366_10013347
652 Ga0097621_100104446
653 Ga0097621_100112021
654 Ga0097621_100160748
655 Ga0097621_100197829
656 Ga0097621_100259673
657 Ga0068871_100002075
658 Ga0068871_100015946
659 Ga0068871_100152679
660 Ga0075428_100006620
661 Ga0075430_100047579
662 Ga0075431_100022307
663 Ga0068865_100004271
664 Ga0068865_100421088
665 Ga0097620_100000025
666 Ga0097620_100004404
667 Ga0097620_100007493
668 Ga0097620_100020064
669 Ga0097620_100035579
670 Ga0097620_100069050
671 Ga0097620_100085350
672 Ga0097620_100126343
673 Ga0097620_100267927
674 Ga0097620_100361938
675 Ga0097620_100764651
676 Ga0105240_10012234
677 Ga0111539_10002837
678 Ga0111539_10110057
679 Ga0111539_10152829
680 Ga0105245_10108283
681 Ga0105245_10182499
682 Ga0105247_10005807
683 Ga0105247_10007209
684 Ga0105241_10000691
685 Ga0105241_10032965
686 Ga0105241_10104091
687 Ga0105242_10623091
688 Ga0105248_10157344
689 Ga0105237_10014702
690 Ga0105249_10001240
691 Ga0105249_10006762
692 Ga0105249_10010178
693 Ga0105249_10087723
694 Ga0105249_10087968
695 Ga0105249_10207710
696 Ga0105249_10214397
697 Ga0105249_10523717
698 Ga0105239_10345992
699 Ga0105246_10060681
700 Ga0157371_10003679
701 Ga0157371_10015182
702 Ga0157370_10025274
703 Ga0157370_10224558
704 Ga0157370_10395097
705 Ga0157369_10362375
706 Ga0157374_10000955
707 Ga0157374_10132282
708 Ga0157374_10136510
709 Ga0157374_10251812
710 Ga0157374_10257639
711 Ga0157378_10026297
712 Ga0157378_10037295
713 Ga0157378_10086406
714 Ga0157378_10087156
715 Ga0157378_10153707
716 Ga0157378_10269120
717 Ga0157378_10595671
718 Ga0163162_10000344
719 Ga0163162_10003357
720 Ga0163162_10029655
721 Ga0163162_10110618
722 Ga0163162_10151291
723 Ga0163162_10273007
724 Ga0163162_10405634
725 Ga0163162_10858077
726 Ga0157372_10066083
727 Ga0157372_10165026
728 Ga0157375_10002578
729 Ga0157375_10027018
730 Ga0157375_10059161
731 Ga0157375_10076468
732 Ga0157375_10218257
733 Ga0157375_10952105
734 Ga0163163_10000075
735 Ga0163163_10078028
736 Ga0163163_10272098
737 Ga0157380_10003006
738 Ga0157380_10003893
739 Ga0157380_10053159
740 Ga0157380_10096604
741 Ga0157380_10359999
742 Ga0157377_10017655
743 Ga0157377_10021099
744 Ga0157377_10080207
745 Ga0157377_10139023
746 Ga0157379_10030269
747 Ga0157379_10064290
748 Ga0157379_10219787
749 Ga0157376_10007363
750 Ga0157376_10018590
751 Ga0157376_10128729
752 Ga0157376_10555861
753 Ga0183373_1003
754 Ga0163161_10000046
755 Ga0163161_10000890
756 Ga0163161_10002168
757 Ga0163161_10015502
758 Ga0163161_10055848
759 Ga0163161_10123119
760 Ga0163161_10249673
761 Ga0207425_1000002
762 Ga0209129_1000002
763 Ga0209676_1000001
764 Ga0209025_1000004
765 Ga0209758_1000006
766 Ga0209050_1000258
767 Ga0209257_1000008
768 Ga0207697_10038686
769 Ga0207656_10112962
770 Ga0207682_10106942
771 Ga0207710_10000852
772 Ga0207710_10011865
773 Ga0207710_10019361
774 Ga0207688_10239744
775 Ga0207680_10000086
776 Ga0207680_10088010
777 Ga0207680_10260880
778 Ga0207645_10003860
779 Ga0207645_10005381
780 Ga0207645_10038583
781 Ga0207645_10054609
782 Ga0207643_10004125
783 Ga0207643_10034411
784 Ga0207643_10099197
785 Ga0207705_10283498
786 Ga0207654_10000361
787 Ga0207707_10000979
788 Ga0207695_10011799
789 Ga0207671_10014756
790 Ga0207660_10003834
791 Ga0207662_10043344
792 Ga0207681_10005582
793 Ga0207681_10441048
794 Ga0207650_10145085
795 Ga0207650_10184102
796 Ga0207659_10064188
797 Ga0207659_10321186
798 Ga0207644_10058049
799 Ga0207644_10127656
800 Ga0207644_10279577
801 Ga0207644_10324780
802 Ga0207706_10024433
803 Ga0207686_10003202
804 Ga0207686_10114401
805 Ga0207709_10000049
806 Ga0207670_10016633
807 Ga0207670_10168155
808 Ga0207669_10030826
809 Ga0207704_10224008
810 Ga0207691_10009095
811 Ga0207691_10014205
812 Ga0207691_10030538
813 Ga0207691_10233332
814 Ga0207691_10327859
815 Ga0207691_10379929
816 Ga0207711_10135363
817 Ga0207689_10003687
818 Ga0207689_10007911
819 Ga0207689_10050693
820 Ga0207689_10088422
821 Ga0207689_10182134
822 Ga0207689_10218794
823 Ga0207689_10230924
824 Ga0207689_10251253
825 Ga0207661_10000738
826 Ga0207661_10109738
827 Ga0207679_10000902
828 Ga0207679_10024631
829 Ga0207679_10097660
830 Ga0207679_10273279
831 Ga0207667_10075605
832 Ga0207667_10191258
833 Ga0207667_10275895
834 Ga0207667_10370126
835 Ga0207651_10305602
836 Ga0207712_10003644
837 Ga0207712_10004435
838 Ga0207712_10022689
839 Ga0207712_10077235
840 Ga0207712_10322834
841 Ga0207668_10029049
842 Ga0207668_10030322
843 Ga0207640_10055868
844 Ga0207640_10128671
845 Ga0207658_10007791
846 Ga0207658_10055575
847 Ga0207658_10102894
848 Ga0207677_10015160
849 Ga0207677_10024262
850 Ga0207677_10036702
851 Ga0207703_10010342
852 Ga0207703_10506629
853 Ga0207639_10003196
854 Ga0207639_10145169
855 Ga0207639_10209377
856 Ga0207678_10140898
857 Ga0207678_10173022
858 Ga0207708_10165286
859 Ga0207708_10170780
860 Ga0207641_10000380
861 Ga0207641_10000661
862 Ga0207641_10025398
863 Ga0207641_10137453
864 Ga0207641_10139957
865 Ga0207641_10339233
866 Ga0207641_10439239
867 Ga0207648_10003599
868 Ga0207648_10012445
869 Ga0207648_10015417
870 Ga0207648_10016524
871 Ga0207648_10239323
872 Ga0207676_10009979
873 Ga0207676_10018751
874 Ga0207676_10033373
875 Ga0207676_10097429
876 Ga0207676_10162146
877 Ga0207674_10003262
878 Ga0207674_10050823
879 Ga0207674_10054955
880 Ga0207674_10223810
881 Ga0207675_100001429
882 Ga0207675_100002458
883 Ga0207675_100100436
884 Ga0207675_100149008
885 Ga0207683_10003509
886 Ga0207683_10221730
887 Ga0207683_10224962
888 Ga0207683_10263866
889 Ga0207698_10002995
890 Ga0207698_10121258
891 Ga0207698_10327502
892 Ga0207428_10214034
893 Ga0268265_10119737
894 Ga0268265_10145548
895 Ga0268264_10002545
896 Ga0268264_10035710
897 Ga0268264_10058470
898 Ga0268264_10122294
899 Ga0307515_10000162
900 Ga0307515_10009312
901 Ga0265327_10000034
902 Ga0307513_10199579
903 Ga0307513_10348649
904 Ga0307407_10000024
905 Ga0307412_10000031
906 Ga0307409_100121916
907 Ga0307416_100000037
908 Ga0307414_10001701
909 Ga0307414_10006990
910 Ga0307414_10063207
911 Ga0316583_10009883
912 Ga0316583_10068275
913 Ga0451807_1181851
914 Ga0439449_0013962
915 Ga0450923_003783
916 Ga0451577_0118220
917 Ga0466972_0000020
918 Ga0453684_0031258
919 Ga0453684_0106070
920 Ga0453684_0382731
921 Ga0466970_0001662
922 Ga0466959_0040336
923 Ga0495608_0039902
924 Ga0495621_0036741
925 Ga0495668_0000489
926 Ga0495668_0014735
927 Ga0495674_0064405
928 Ga0495686_0067990
929 Ga0495686_0103088
930 Ga0496110_0020348
931 Ga0501031_0009213
932 Ga0501032_0003398
933 Ga0501032_0005879
934 Ga0501032_0060655
935 Ga0501033_0001504
936 Ga0501033_0016687
937 Ga0501034_0009004
938 Ga0501034_0020736
939 Ga0501036_0403915
940 Ga0501038_0012559
941 Ga0501038_0015850
942 Ga0501038_0104029
943 Ga0501043_0034896
944 Ga0501043_0036714
945 Ga0501047_0011195
946 Ga0501047_0326761
947 Ga0501241_000931
948 Ga0501035_0014615
949 Ga0501044_0007058
950 Ga0501045_0002787
951 nmdc:mga0k408_4631_c1
952 nmdc:mga05p37_214012_c1
953 nmdc:mga0qj67_25694_c1
954 nmdc:mga06r32_508524_c1
955 nmdc:mga08y16_234069_c1
956 nmdc:mga08y16_458568_c1
957 nmdc:mga08y16_64328_c1
958 Ga0500559_0025438
959 Ga0500616_0009323
960 Ga0500616_0038031
961 Ga0500622_0000844
962 Ga0500611_000002
963 Ga0500645_075571
964 2586209283
965 2722729850
966 2738855745
967 2739590202
968 2739615992
969 2739647718
970 2819548404
971 2842723027
972 2842913983
973 2857628532
974 2884636338
975 2904449525
976 2946000001
977 2954016600
978 2977245467
979 2984575699
980 2984609153
981 2993483815
982 3003236668

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04055

Radical_SAM

Radical SAM superfamily

59

218

0.98

PF06463

Mob_synth_C

Molybdenum Cofactor Synthesis C

223

345

0.94

PF13353

Fer4_12

4Fe-4S single cluster domain

57

186

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
1tv8-assembly1.cif.gz_A structure of moaa in complex with s-adenosylmethionine 0.915 3 263
2fb2-assembly1.cif.gz_B structure of the moaa arg17/266/268/ala triple mutant 0.9094 3 263
7tom-assembly1.cif.gz_A x-ray crystal structure of glycerol dibiphytanyl glycerol tetraether - macrocyclic archaeol synthase (gdgt-mas) from methanocaldococcus jannaschii with bacterial lipid substrate analog, 5'deoxyadenosine, and methionine bound 0.8516 35 184
7jma-assembly1.cif.gz_A crystal structure of the apo form of nitrogenase iron-molybdenum cofactor biosynthesis enzyme nifb from methanothermobacter thermautotrophicus 0.8283 13 183
3cb8-assembly1.cif.gz_A 4fe-4s-pyruvate formate-lyase activating enzyme in complex with adomet and a peptide substrate 0.8227 20 158
ID Description Score Start End Superfamily
af_I1KTQ5_72_400_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.924 1 298 3.20.20.70
af_I1KTQ5_72_400_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.921 1 298 3.20.20.70
1tv8A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.915 3 263 3.20.20.70
af_P9WJS1_27_360_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9003 1 298 3.20.20.70
af_P9WJS1_27_360_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8975 1 298 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A0E9M0N6-F1-model_v4 GTP 3',8-cyclase (EC 4.1.99.22) 0.98 1 298 GO:0005525
GO:0006777
GO:0046872
GO:0051539
GO:0061798
GO:0061799
AF-A0A519LVT0-F1-model_v4 Cyclic pyranopterin phosphate synthase MoaA 0.9783 82 298 GO:0005525
GO:0006777
GO:0046872
GO:0051539
GO:0061798
GO:0061799
AF-A0A0E9M0N6-F1-model_v4 GTP 3',8-cyclase (EC 4.1.99.22) 0.9767 1 298 GO:0005525
GO:0006777
GO:0046872
GO:0051539
GO:0061798
GO:0061799
AF-A0A812E6X5-F1-model_v4 GTP 3',8-cyclase (EC 4.1.99.22) 0.9763 1 271 GO:0005525
GO:0006777
GO:0016020
GO:0046872
GO:0051539
GO:0061798
GO:0061799
AF-A0A812E3P4-F1-model_v4 GTP 3',8-cyclase (EC 4.1.99.22) 0.9762 1 271 GO:0005525
GO:0006777
GO:0016020
GO:0046872
GO:0051539
GO:0061798
GO:0061799

Map