F454085

General Info

Members Datasets Scaffolds Average Seq Length
491 200 491 168

Family's Representative Sequence

Representative Sequence 3300006847|Ga0075431_100001270|Ga0075431_10000127021
Length 188
Sequence MPVETRRGFWGETLQLVRAVGRAMGVTFKNLLRRPITVRYPTVKRVFPDRFRGILALTYDPQTGEENCIGCRLCEYICPPQVIKVEMLKAEKRNWAKTFTLELYVMLRSFDLATADRRELLLDKDRLHALGLQFEPSWATGNRLRDMQAPPKPVKPATHSTPDRRAPEASEGAPTADPRSAAPSSANP

Samples

Sample ID Description Type Environment
1 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
2 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
3 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
56 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
57 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
58 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
63 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
64 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
80 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
83 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
84 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
85 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
86 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
87 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
88 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
128 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
131 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
132 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
133 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
134 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
135 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
136 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
137 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
138 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
139 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
140 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
141 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
142 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
143 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
144 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
145 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
146 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
147 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
148 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
149 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
150 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
151 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
152 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
153 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
154 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
155 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
156 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
157 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
158 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
159 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
160 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
161 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
162 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
163 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
175 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
176 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
177 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
178 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
179 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
180 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
181 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
182 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
183 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
184 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
185 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
186 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
187 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
188 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
189 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
190 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
191 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
192 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
193 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
194 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
195 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
196 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
197 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
198 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
199 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
200 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.02
Rhizosphere 98.98
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1001951 3300001977 Bacteria 3285
2 JGI24745J21846_1010929 3300002073 Unclassified 1035
3 JGI24035J26624_1021093 3300002126 Unclassified 688
4 JGI25406J46586_10011300 3300003203 Bacteria 3923
5 Ga0065715_10162957 3300005293 Unclassified 1564
6 Ga0065707_10390774 3300005295 Unclassified 865
7 Ga0070676_10074028 3300005328 Bacteria 2050
8 Ga0070690_100082077 3300005330 Unclassified 2110
9 Ga0070690_101094629 3300005330 Bacteria 632
10 Ga0070677_10002331 3300005333 Bacteria 6065
11 Ga0068869_100258101 3300005334 Bacteria 1394
12 Ga0070666_10029185 3300005335 Bacteria 3624
13 Ga0070680_100411165 3300005336 Bacteria 1154
14 Ga0070689_100179427 3300005340 Bacteria 1719
15 Ga0070687_100015745 3300005343 Bacteria 3427
16 Ga0070668_100021604 3300005347 Bacteria 4862
17 Ga0070668_100044110 3300005347 Bacteria 3420
18 Ga0070669_100012365 3300005353 Bacteria 6055
19 Ga0070669_100031693 3300005353 Bacteria 3818
20 Ga0070675_100252044 3300005354 Bacteria 1545
21 Ga0070675_100565990 3300005354 Unclassified 1029
22 Ga0070673_100124601 3300005364 Bacteria 2154
23 Ga0070688_100048283 3300005365 Bacteria 2644
24 Ga0070659_100102975 3300005366 Bacteria 2299
25 Ga0070667_100034478 3300005367 Bacteria 4234
26 Ga0070701_10038494 3300005438 Bacteria 2420
27 Ga0070705_100195712 3300005440 Unclassified 1382
28 Ga0070705_100218810 3300005440 Bacteria 1317
29 Ga0070708_100042179 3300005445 Bacteria 4004
30 Ga0070708_100086704 3300005445 Bacteria 2844
31 Ga0070708_100329876 3300005445 Bacteria 1438
32 Ga0070708_100996774 3300005445 Unclassified 786
33 Ga0070678_100016025 3300005456 Bacteria 4780
34 Ga0070662_100006443 3300005457 Bacteria 7565
35 Ga0070662_101017438 3300005457 Bacteria 710
36 Ga0068867_100030066 3300005459 Bacteria 3917
37 Ga0068867_100897905 3300005459 Unclassified 797
38 Ga0070685_10045159 3300005466 Bacteria 2525
39 Ga0070706_100008450 3300005467 Bacteria 9590
40 Ga0070706_100577870 3300005467 Archaea 1045
41 Ga0070706_100620262 3300005467 Bacteria 1004
42 Ga0070707_100000729 3300005468 Bacteria 32778
43 Ga0070707_100045468 3300005468 Bacteria 4202
44 Ga0070707_100077890 3300005468 Bacteria 3198
45 Ga0070707_100138098 3300005468 Bacteria 2372
46 Ga0070707_100603894 3300005468 Bacteria 1060
47 Ga0070698_100004426 3300005471 Bacteria 15440
48 Ga0070698_100282480 3300005471 Bacteria 1591
49 Ga0070699_100000534 3300005518 Bacteria 36008
50 Ga0070699_100003941 3300005518 Bacteria 13112
51 Ga0070699_100080194 3300005518 Bacteria 2844
52 Ga0070699_100174329 3300005518 Bacteria 1906
53 Ga0070699_100234239 3300005518 Bacteria 1638
54 Ga0070699_100509393 3300005518 Unclassified 1094
55 Ga0070699_100583625 3300005518 Bacteria 1019
56 Ga0070699_100893964 3300005518 Unclassified 813
57 Ga0070679_100158348 3300005530 Bacteria 2239
58 Ga0070684_100829224 3300005535 Unclassified 865
59 Ga0070697_100001086 3300005536 Bacteria 20540
60 Ga0070697_100047520 3300005536 Bacteria 3479
61 Ga0070697_100048568 3300005536 Bacteria 3441
62 Ga0070697_100099340 3300005536 Bacteria 2416
63 Ga0070697_100274192 3300005536 Bacteria 1446
64 Ga0070697_100294054 3300005536 Bacteria 1395
65 Ga0068853_100601448 3300005539 Unclassified 1044
66 Ga0070672_100014619 3300005543 Bacteria 5567
67 Ga0070672_100049360 3300005543 Bacteria 3274
68 Ga0070686_100116357 3300005544 Bacteria 1829
69 Ga0070695_100063589 3300005545 Bacteria 2399
70 Ga0070696_100018685 3300005546 Bacteria 4689
71 Ga0070696_100092008 3300005546 Bacteria 2161
72 Ga0070696_100544939 3300005546 Bacteria 929
73 Ga0070693_100074595 3300005547 Bacteria 2007
74 Ga0070704_100043338 3300005549 Bacteria 3119
75 Ga0070704_100118148 3300005549 Bacteria 2031
76 Ga0070704_100224808 3300005549 Bacteria 1528
77 Ga0070704_100307111 3300005549 Unclassified 1324
78 Ga0070664_100024184 3300005564 Bacteria 5023
79 Ga0068854_100279027 3300005578 Unclassified 1345
80 Ga0068852_101182625 3300005616 Unclassified 786
81 Ga0068859_100065876 3300005617 Bacteria 3656
82 Ga0068859_100524987 3300005617 Bacteria 1279
83 Ga0068864_100170777 3300005618 Bacteria 1982
84 Ga0068866_10303690 3300005718 Bacteria 998
85 Ga0068861_100096593 3300005719 Bacteria 2342
86 Ga0068861_100178774 3300005719 Bacteria 1764
87 Ga0068861_100548868 3300005719 Bacteria 1053
88 Ga0068870_10002979 3300005840 Bacteria 7138
89 Ga0068863_100025327 3300005841 Bacteria 5656
90 Ga0068863_100873616 3300005841 Unclassified 899
91 Ga0068858_100034467 3300005842 Bacteria 4696
92 Ga0068860_100083585 3300005843 Bacteria 3037
93 Ga0068860_100159168 3300005843 Bacteria 2177
94 Ga0068862_100039181 3300005844 Bacteria 4023
95 Ga0068862_100182182 3300005844 Bacteria 1886
96 Ga0068862_100558532 3300005844 Bacteria 1094
97 Ga0068862_100595566 3300005844 Bacteria 1061
98 Ga0081455_10064100 3300005937 Bacteria 3079
99 Ga0081538_10003260 3300005981 Bacteria 15419
100 Ga0081540_1019869 3300005983 Bacteria 4064
101 Ga0081539_10000454 3300005985 Bacteria 87230
102 Ga0097621_100070646 3300006237 Bacteria 2883
103 Ga0068871_100200215 3300006358 Unclassified 1724
104 Ga0068871_100991748 3300006358 Bacteria 782
105 Ga0075428_100004648 3300006844 Bacteria 15196
106 Ga0075428_100006929 3300006844 Bacteria 12586
107 Ga0075428_100123681 3300006844 Bacteria 2816
108 Ga0075428_100197201 3300006844 Bacteria 2177
109 Ga0075428_100336358 3300006844 Bacteria 1622
110 Ga0075428_100446829 3300006844 Bacteria 1385
111 Ga0075428_100842536 3300006844 Unclassified 974
112 Ga0075430_100003492 3300006846 Bacteria 13154
113 Ga0075430_100012886 3300006846 Bacteria 7125
114 Ga0075430_100019472 3300006846 Bacteria 5771
115 Ga0075430_100028925 3300006846 Bacteria 4705
116 Ga0075430_100029617 3300006846 Bacteria 4646
117 Ga0075430_100032620 3300006846 Bacteria 4421
118 Ga0075430_100188262 3300006846 Bacteria 1716
119 Ga0075430_100345004 3300006846 Bacteria 1230
120 Ga0075431_100000082 3300006847 Bacteria 56660
121 Ga0075431_100000455 3300006847 Bacteria 33646
122 Ga0075431_100001270 3300006847 Bacteria 22987
123 Ga0075431_100001687 3300006847 Bacteria 20728
124 Ga0075431_100001936 3300006847 Bacteria 19722
125 Ga0075431_100052800 3300006847 Bacteria 4191
126 Ga0075431_100227399 3300006847 Bacteria 1902
127 Ga0075431_100759265 3300006847 Bacteria 945
128 Ga0075431_101011398 3300006847 Bacteria 798
129 Ga0075433_10000061 3300006852 Bacteria 47469
130 Ga0075433_10000427 3300006852 Bacteria 27010
131 Ga0075433_10005550 3300006852 Bacteria 9906
132 Ga0075433_10059591 3300006852 Bacteria 3340
133 Ga0075433_10181580 3300006852 Bacteria 1872
134 Ga0075433_10258382 3300006852 Bacteria 1544
135 Ga0075433_10270537 3300006852 Bacteria 1506
136 Ga0075433_10337826 3300006852 Bacteria 1331
137 Ga0075433_10358774 3300006852 Bacteria 1288
138 Ga0075433_10807578 3300006852 Bacteria 820
139 Ga0075433_11104542 3300006852 Unclassified 689
140 Ga0075434_100000180 3300006871 Bacteria 41040
141 Ga0075434_100017104 3300006871 Bacteria 6979
142 Ga0075434_100040188 3300006871 Bacteria 4633
143 Ga0075434_100073024 3300006871 Bacteria 3423
144 Ga0075434_100085881 3300006871 Bacteria 3146
145 Ga0075434_100094218 3300006871 Bacteria 2999
146 Ga0075434_100119131 3300006871 Unclassified 2654
147 Ga0075434_100165276 3300006871 Bacteria 2233
148 Ga0075434_100309702 3300006871 Bacteria 1599
149 Ga0075434_100451075 3300006871 Bacteria 1307
150 Ga0075429_100002106 3300006880 Bacteria 16613
151 Ga0075429_100002213 3300006880 Bacteria 16272
152 Ga0075429_100002798 3300006880 Bacteria 14762
153 Ga0075429_100002856 3300006880 Bacteria 14619
154 Ga0075429_100023887 3300006880 Bacteria 5305
155 Ga0075429_100064236 3300006880 Bacteria 3197
156 Ga0075429_100181246 3300006880 Bacteria 1846
157 Ga0075429_100197369 3300006880 Bacteria 1763
158 Ga0075429_100803774 3300006880 Bacteria 824
159 Ga0075429_100874527 3300006880 Unclassified 787
160 Ga0068865_100100613 3300006881 Bacteria 2115
161 Ga0068865_100219178 3300006881 Bacteria 1487
162 Ga0068865_100919620 3300006881 Unclassified 762
163 Ga0075436_100002146 3300006914 Bacteria 13600
164 Ga0075436_100144567 3300006914 Bacteria 1672
165 Ga0097620_100065876 3300006931 Bacteria 3656
166 Ga0097620_100524995 3300006931 Bacteria 1279
167 Ga0075435_100017542 3300007076 Bacteria 5422
168 Ga0075435_100051710 3300007076 Bacteria 3309
169 Ga0075435_100063505 3300007076 Bacteria 2999
170 Ga0075435_100099992 3300007076 Bacteria 2402
171 Ga0075435_100333209 3300007076 Unclassified 1300
172 Ga0075435_100387527 3300007076 Bacteria 1201
173 Ga0111539_10006594 3300009094 Bacteria 14961
174 Ga0111539_10012644 3300009094 Bacteria 10575
175 Ga0111539_10250103 3300009094 Bacteria 2064
176 Ga0111539_11218257 3300009094 Bacteria 874
177 Ga0114129_10000110 3300009147 Bacteria 81178
178 Ga0114129_10000936 3300009147 Bacteria 38136
179 Ga0114129_10002179 3300009147 Bacteria 26947
180 Ga0114129_10013658 3300009147 Bacteria 11571
181 Ga0114129_10020399 3300009147 Bacteria 9427
182 Ga0114129_10044379 3300009147 Bacteria 6253
183 Ga0114129_10085483 3300009147 Bacteria 4376
184 Ga0114129_10114857 3300009147 Bacteria 3712
185 Ga0114129_10211158 3300009147 Bacteria 2624
186 Ga0114129_10413676 3300009147 Bacteria 1775
187 Ga0114129_10445810 3300009147 Bacteria 1698
188 Ga0114129_10735289 3300009147 Bacteria 1265
189 Ga0114129_10750296 3300009147 Bacteria 1249
190 Ga0114129_10797536 3300009147 Bacteria 1205
191 Ga0114129_11037305 3300009147 Bacteria 1030
192 Ga0114129_11340586 3300009147 Bacteria 885
193 Ga0105243_10016133 3300009148 Bacteria 5650
194 Ga0105241_10041676 3300009174 Bacteria 3470
195 Ga0105242_10344983 3300009176 Bacteria 1373
196 Ga0105248_10194352 3300009177 Bacteria 2286
197 Ga0105248_10395701 3300009177 Bacteria 1556
198 Ga0105248_10463107 3300009177 Bacteria 1429
199 Ga0105249_10008153 3300009553 Bacteria 9132
200 Ga0105249_10732399 3300009553 Unclassified 1050
201 Ga0105239_10612823 3300010375 Bacteria 1242
202 Ga0157378_10060912 3300013297 Bacteria 3367
203 Ga0157378_10972879 3300013297 Bacteria 882
204 Ga0163162_10055861 3300013306 Bacteria 3976
205 Ga0163162_10103890 3300013306 Bacteria 2935
206 Ga0163162_10672215 3300013306 Bacteria 1158
207 Ga0157375_10137022 3300013308 Bacteria 2573
208 Ga0157375_10374942 3300013308 Bacteria 1589
209 Ga0157380_10003226 3300014326 Bacteria 11146
210 Ga0157377_10005724 3300014745 Bacteria 5860
211 Ga0157379_10181268 3300014968 Bacteria 1903
212 Ga0157379_10433169 3300014968 Bacteria 1212
213 Ga0157376_10435855 3300014969 Bacteria 1275
214 Ga0163161_10104805 3300017792 Bacteria 2109
215 Ga0163161_10120352 3300017792 Bacteria 1972
216 Ga0207673_1012930 3300025290 Unclassified 1091
217 Ga0207697_10001435 3300025315 Bacteria 13051
218 Ga0207682_10003116 3300025893 Bacteria 7262
219 Ga0207688_10001607 3300025901 Bacteria 11929
220 Ga0207680_10023261 3300025903 Bacteria 3381
221 Ga0207645_10008679 3300025907 Bacteria 7079
222 Ga0207643_10000732 3300025908 Bacteria 20161
223 Ga0207643_10016950 3300025908 Bacteria 3976
224 Ga0207643_10155728 3300025908 Unclassified 1372
225 Ga0207684_10000279 3300025910 Bacteria 74399
226 Ga0207684_10018762 3300025910 Bacteria 5918
227 Ga0207684_10270741 3300025910 Bacteria 1465
228 Ga0207684_10319722 3300025910 Unclassified 1338
229 Ga0207684_10474242 3300025910 Archaea 1074
230 Ga0207654_10058214 3300025911 Bacteria 2249
231 Ga0207663_10241733 3300025916 Bacteria 1324
232 Ga0207660_10318513 3300025917 Unclassified 1241
233 Ga0207662_10039826 3300025918 Bacteria 2758
234 Ga0207649_10041050 3300025920 Bacteria 2815
235 Ga0207646_10001682 3300025922 Bacteria 26908
236 Ga0207646_10027725 3300025922 Bacteria 5163
237 Ga0207646_10039239 3300025922 Bacteria 4262
238 Ga0207646_10063999 3300025922 Bacteria 3283
239 Ga0207646_10284741 3300025922 Archaea 1494
240 Ga0207646_10340453 3300025922 Bacteria 1355
241 Ga0207681_10008334 3300025923 Bacteria 6339
242 Ga0207681_10294417 3300025923 Bacteria 1282
243 Ga0207659_10071452 3300025926 Bacteria 2534
244 Ga0207644_10087713 3300025931 Bacteria 2313
245 Ga0207690_10166105 3300025932 Bacteria 1649
246 Ga0207706_10334375 3300025933 Unclassified 1318
247 Ga0207706_10373711 3300025933 Unclassified 1238
248 Ga0207686_10340996 3300025934 Bacteria 1125
249 Ga0207709_10274742 3300025935 Bacteria 1242
250 Ga0207670_10181069 3300025936 Unclassified 1587
251 Ga0207691_10010524 3300025940 Bacteria 8877
252 Ga0207691_10035245 3300025940 Bacteria 4647
253 Ga0207691_10934904 3300025940 Unclassified 725
254 Ga0207711_10499914 3300025941 Unclassified 1133
255 Ga0207689_10091644 3300025942 Bacteria 2497
256 Ga0207679_10010677 3300025945 Bacteria 5920
257 Ga0207651_10121224 3300025960 Bacteria 1983
258 Ga0207712_10115092 3300025961 Bacteria 2024
259 Ga0207712_10135770 3300025961 Bacteria 1881
260 Ga0207668_10086619 3300025972 Bacteria 2289
261 Ga0207677_10145337 3300026023 Bacteria 1821
262 Ga0207708_10086171 3300026075 Bacteria 2417
263 Ga0207648_10082063 3300026089 Bacteria 2811
264 Ga0207648_10091646 3300026089 Bacteria 2657
265 Ga0207648_10129111 3300026089 Bacteria 2224
266 Ga0207676_10062298 3300026095 Bacteria 2958
267 Ga0207674_10185820 3300026116 Bacteria 2029
268 Ga0207674_10231648 3300026116 Unclassified 1795
269 Ga0207675_100012281 3300026118 Bacteria 8002
270 Ga0207675_100033594 3300026118 Bacteria 4779
271 Ga0207675_100404881 3300026118 Bacteria 1345
272 Ga0207683_10007833 3300026121 Bacteria 9145
273 Ga0207698_11899713 3300026142 Unclassified 610
274 Ga0210002_1033299 3300027617 Unclassified 862
275 Ga0209971_1099388 3300027682 Bacteria 712
276 Ga0209974_10029136 3300027876 Bacteria 1829
277 Ga0207428_10000027 3300027907 Bacteria 250186
278 Ga0207428_10008043 3300027907 Bacteria 9569
279 Ga0207428_10020343 3300027907 Bacteria 5639
280 Ga0207428_10148466 3300027907 Unclassified 1786
281 Ga0268265_10031665 3300028380 Bacteria 3821
282 Ga0268265_10213693 3300028380 Bacteria 1682
283 Ga0268265_10322867 3300028380 Bacteria 1399
284 Ga0268264_10323716 3300028381 Bacteria 1458
285 Ga0307408_100023380 3300031548 Bacteria 4209
286 Ga0307408_100054771 3300031548 Bacteria 2885
287 Ga0307408_100507328 3300031548 Bacteria 1057
288 Ga0307405_10892239 3300031731 Unclassified 751
289 Ga0307413_10425550 3300031824 Bacteria 1047
290 Ga0307406_10341647 3300031901 Bacteria 1166
291 Ga0307407_10043399 3300031903 Bacteria 2528
292 Ga0307409_100106896 3300031995 Bacteria 2337
293 Ga0307415_100321864 3300032126 Unclassified 1290
294 Ga0373928_0106101 3300035084 Unclassified 738
295 Ga0373940_0163321 3300035088 Bacteria 716
296 Ga0373949_0115688 3300035090 Unclassified 748
297 Ga0373951_0034593 3300035091 Bacteria 1200
298 Ga0373932_0037407 3300035112 Unclassified 1383
299 Ga0373932_0156615 3300035112 Bacteria 785
300 Ga0373939_0044598 3300035114 Bacteria 1350
301 Ga0373941_0081587 3300035115 Bacteria 1093
302 Ga0395899_0171878 3300037312 Bacteria 1526
303 Ga0395900_0068642 3300037418 Bacteria 3643
304 Ga0395905_0017487 3300037471 Bacteria 6807
305 Ga0395905_0207808 3300037471 Bacteria 1835
306 Ga0395905_0266452 3300037471 Bacteria 1599
307 Ga0395901_0138497 3300038443 Bacteria 2558
308 Ga0439464_0200917 3300042439 Unclassified 636
309 Ga0439460_0010314 3300042461 Bacteria 2388
310 Ga0451577_0206872 3300042876 Bacteria 1772
311 Ga0451577_0481095 3300042876 Bacteria 1127
312 Ga0451577_0583369 3300042876 Bacteria 1015
313 Ga0453683_0215319 3300044673 Bacteria 1221
314 Ga0451576_0259685 3300045051 Bacteria 1815
315 Ga0451576_0884149 3300045051 Bacteria 937
316 Ga0495594_0293017 3300046499 Unclassified 927
317 Ga0495642_0190316 3300046528 Unclassified 894
318 Ga0495656_0261984 3300046615 Unclassified 876
319 Ga0495659_0056330 3300046664 Bacteria 1443
320 Ga0495669_0046196 3300046684 Bacteria 1943
321 Ga0495669_0098589 3300046684 Bacteria 1356
322 Ga0495636_0151104 3300047318 Bacteria 1042
323 Ga0496100_0873433 3300048903 Bacteria 706
324 Ga0496102_0069075 3300048905 Bacteria 3243
325 Ga0496106_0064340 3300048909 Bacteria 2790
326 Ga0496110_0106836 3300048913 Bacteria 2512
327 Ga0496110_0799554 3300048913 Bacteria 847
328 Ga0501031_0220394 3300049568 Bacteria 1235
329 Ga0501036_0365083 3300049572 Bacteria 1205
330 Ga0501037_0621463 3300049573 Bacteria 724
331 Ga0501038_0205571 3300049574 Bacteria 1578
332 Ga0501038_0359531 3300049574 Bacteria 1132
333 Ga0501038_0429782 3300049574 Bacteria 1018
334 Ga0501039_0300696 3300049575 Bacteria 1261
335 Ga0501039_0435642 3300049575 Bacteria 1029
336 Ga0501039_0724611 3300049575 Bacteria 777
337 Ga0501040_0002340 3300049576 Bacteria 12167
338 Ga0501040_0097993 3300049576 Bacteria 2043
339 Ga0501040_0140618 3300049576 Bacteria 1700
340 Ga0501040_0266024 3300049576 Bacteria 1224
341 Ga0501041_0030643 3300049577 Bacteria 3247
342 Ga0501041_0093500 3300049577 Bacteria 1857
343 Ga0501042_0208829 3300049578 Bacteria 1408
344 Ga0501042_0252260 3300049578 Bacteria 1273
345 Ga0501043_0097849 3300049579 Bacteria 2307
346 Ga0501043_0269215 3300049579 Bacteria 1308
347 Ga0501046_0149702 3300049580 Bacteria 1761
348 Ga0501046_0299193 3300049580 Bacteria 1175
349 Ga0501046_0316460 3300049580 Bacteria 1138
350 Ga0501046_0691557 3300049580 Archaea 719
351 Ga0501048_0050021 3300049582 Bacteria 2977
352 Ga0501048_0112241 3300049582 Bacteria 1925
353 Ga0501048_0239954 3300049582 Bacteria 1286
354 Ga0501067_0009738 3300049583 Bacteria 5319
355 Ga0501068_0395256 3300049584 Bacteria 891
356 Ga0501068_0652391 3300049584 Bacteria 687
357 Ga0501071_0079021 3300049587 Bacteria 2405
358 Ga0501071_0174418 3300049587 Bacteria 1610
359 Ga0501071_0355806 3300049587 Unclassified 1115
360 Ga0501072_0019990 3300049588 Bacteria 5185
361 Ga0501072_0060057 3300049588 Bacteria 2998
362 Ga0501072_0676199 3300049588 Bacteria 812
363 Ga0501072_0787069 3300049588 Unclassified 745
364 Ga0501073_0264986 3300049589 Bacteria 1186
365 Ga0501074_0044826 3300049590 Bacteria 3200
366 Ga0501074_0310999 3300049590 Bacteria 1119
367 Ga0501074_0405515 3300049590 Unclassified 967
368 Ga0501075_0011903 3300049591 Bacteria 6171
369 Ga0501075_0088260 3300049591 Bacteria 2351
370 Ga0501075_0099850 3300049591 Bacteria 2204
371 Ga0501075_0239742 3300049591 Bacteria 1382
372 Ga0501075_0405274 3300049591 Bacteria 1040
373 Ga0501075_0538506 3300049591 Unclassified 891
374 Ga0501076_0000831 3300049592 Bacteria 20044
375 Ga0501076_0003944 3300049592 Bacteria 10472
376 Ga0501076_0067189 3300049592 Bacteria 2862
377 Ga0501076_0195477 3300049592 Bacteria 1651
378 Ga0501076_0217123 3300049592 Bacteria 1563
379 Ga0501076_0320915 3300049592 Bacteria 1270
380 Ga0501076_0683595 3300049592 Unclassified 847
381 Ga0501077_0007379 3300049593 Bacteria 6777
382 Ga0501077_0183728 3300049593 Unclassified 1329
383 Ga0501077_0186395 3300049593 Bacteria 1318
384 Ga0501225_0102149 3300049705 Bacteria 839
385 Ga0501079_0011626 3300049741 Bacteria 6722
386 Ga0501079_0084525 3300049741 Bacteria 2455
387 Ga0501079_0165012 3300049741 Bacteria 1727
388 Ga0501079_0183887 3300049741 Bacteria 1631
389 Ga0501080_0104354 3300049742 Bacteria 2629
390 Ga0501080_0118634 3300049742 Bacteria 2453
391 Ga0501080_0161938 3300049742 Bacteria 2066
392 Ga0501080_0227900 3300049742 Bacteria 1704
393 Ga0501080_0529376 3300049742 Unclassified 1051
394 Ga0501081_0001826 3300049743 Bacteria 13182
395 Ga0501081_0002472 3300049743 Bacteria 11652
396 Ga0501081_0010638 3300049743 Bacteria 6009
397 Ga0501081_0218749 3300049743 Bacteria 1385
398 Ga0501081_0713618 3300049743 Unclassified 753
399 Ga0501083_0132646 3300049744 Bacteria 1633
400 Ga0501045_0008724 3300049824 Bacteria 7071
401 Ga0501045_0079400 3300049824 Bacteria 2419
402 Ga0501045_0170891 3300049824 Bacteria 1619
403 Ga0501045_0196184 3300049824 Bacteria 1504
404 Ga0501045_0244054 3300049824 Bacteria 1337
405 Ga0501045_0725249 3300049824 Bacteria 733
406 nmdc:mga05p37_115985_c1 3300050507 Bacteria 3292
407 nmdc:mga05p37_1245076_c1 3300050507 Unclassified 764
408 nmdc:mga05p37_155861_c1 3300050507 Bacteria 2791
409 nmdc:mga05p37_17395_c1 3300050507 Bacteria 8675
410 nmdc:mga05p37_1821_c1 3300050507 Bacteria 24853
411 nmdc:mga05p37_2476_c1 3300050507 Bacteria 21484
412 nmdc:mga05p37_30883_c1 3300050507 Bacteria 6539
413 nmdc:mga05p37_398270_c1 3300050507 Bacteria 1608
414 nmdc:mga05p37_42435_c1 3300050507 Bacteria 5589
415 nmdc:mga05p37_547764_c1 3300050507 Bacteria 1318
416 nmdc:mga05p37_7406_c1 3300050507 Bacteria 12949
417 nmdc:mga05p37_769_c1 3300050507 Bacteria 35683
418 nmdc:mga05p37_92449_c1 3300050507 Bacteria 3727
419 nmdc:mga05p37_95179_c1 3300050507 Bacteria 1899
420 nmdc:mga05p37_96499_c1 3300050507 Bacteria 3642
421 nmdc:mga09592_144854_c1 3300050508 Bacteria 2048
422 nmdc:mga09592_14652_c1 3300050508 Bacteria 6397
423 nmdc:mga09592_1944_c1 3300050508 Bacteria 16641
424 nmdc:mga09592_218704_c1 3300050508 Bacteria 1651
425 nmdc:mga09592_226520_c1 3300050508 Bacteria 1620
426 nmdc:mga09592_2581_c1 3300050508 Bacteria 14667
427 nmdc:mga09592_3878_c1 3300050508 Bacteria 12046
428 nmdc:mga09592_5317_c1 3300050508 Bacteria 10464
429 nmdc:mga09592_54900_c1 3300050508 Bacteria 3366
430 nmdc:mga0qj67_1433_c1 3300050509 Bacteria 16698
431 nmdc:mga0qj67_291779_c1 3300050509 Bacteria 1322
432 nmdc:mga0qj67_379638_c1 3300050509 Bacteria 1141
433 nmdc:mga0qj67_541015_c1 3300050509 Bacteria 935
434 nmdc:mga0qj67_60996_c1 3300050509 Bacteria 2994
435 nmdc:mga0qj67_7809_c1 3300050509 Bacteria 7907
436 nmdc:mga06r32_203185_c1 3300050510 Bacteria 1969
437 nmdc:mga06r32_225659_c1 3300050510 Bacteria 1862
438 nmdc:mga06r32_2396_c1 3300050510 Bacteria 16781
439 nmdc:mga06r32_313253_c1 3300050510 Bacteria 1555
440 nmdc:mga06r32_3786_c1 3300050510 Bacteria 13535
441 nmdc:mga06r32_443267_c1 3300050510 Bacteria 1278
442 nmdc:mga06r32_5775_c1 3300050510 Bacteria 11151
443 nmdc:mga06r32_68349_c1 3300050510 Bacteria 3432
444 nmdc:mga06r32_6924_c1 3300050510 Bacteria 10194
445 nmdc:mga06r32_70286_c1 3300050510 Bacteria 3385
446 nmdc:mga06r32_7977_c1 3300050510 Bacteria 9516
447 nmdc:mga06r32_931185_c1 3300050510 Bacteria 824
448 nmdc:mga08y16_1110536_c1 3300050511 Unclassified 765
449 nmdc:mga08y16_123507_c1 3300050511 Bacteria 2694
450 nmdc:mga08y16_149523_c1 3300050511 Bacteria 2428
451 nmdc:mga08y16_17787_c1 3300050511 Bacteria 7488
452 nmdc:mga08y16_243078_c1 3300050511 Bacteria 1860
453 nmdc:mga08y16_390636_c1 3300050511 Bacteria 1425
454 nmdc:mga08y16_49615_c1 3300050511 Bacteria 4393
455 nmdc:mga08y16_83078_c1 3300050511 Bacteria 3338
456 nmdc:mga0n895_1024627_c1 3300050512 Bacteria 806
457 nmdc:mga0n895_109152_c1 3300050512 Bacteria 2782
458 nmdc:mga0n895_1214_c1 3300050512 Bacteria 19023
459 nmdc:mga0n895_20754_c1 3300050512 Bacteria 6133
460 nmdc:mga0n895_232758_c1 3300050512 Bacteria 1870
461 nmdc:mga0n895_46940_c1 3300050512 Bacteria 4222
462 nmdc:mga0n895_60106_c1 3300050512 Bacteria 3750
463 nmdc:mga0n895_86246_c1 3300050512 Bacteria 3136
464 nmdc:mga0rr50_118551_c1 3300050513 Bacteria 2103
465 nmdc:mga0rr50_13734_c1 3300050513 Bacteria 5286
466 nmdc:mga0rr50_46560_c1 3300050513 Bacteria 3194
467 nmdc:mga0rr50_549_c1 3300050513 Bacteria 20121
468 nmdc:mga08x19_16828_c1 3300050514 Bacteria 4465
469 nmdc:mga08x19_1724_c1 3300050514 Bacteria 13452
470 nmdc:mga08x19_174249_c1 3300050514 Unclassified 1466
471 nmdc:mga0a205_106355_c1 3300050515 Bacteria 2704
472 nmdc:mga0a205_1170_c1 3300050515 Bacteria 21857
473 nmdc:mga0a205_1627_c1 3300050515 Bacteria 19317
474 nmdc:mga0a205_227_c1 3300050515 Bacteria 39744
475 nmdc:mga0a205_289101_c1 3300050515 Bacteria 1514
476 nmdc:mga0a205_336025_c1 3300050515 Bacteria 1380
477 nmdc:mga0a205_56926_c1 3300050515 Bacteria 3775
478 nmdc:mga0a205_6155_c1 3300050515 Bacteria 3270
479 nmdc:mga0a205_68336_c1 3300050515 Bacteria 3432
480 nmdc:mga0a205_8978_c1 3300050515 Bacteria 9109
481 Ga0501084_0021862 3300054114 Bacteria 5334
482 Ga0501084_0023135 3300054114 Bacteria 5187
483 Ga0501084_0026115 3300054114 Bacteria 4872
484 Ga0501084_0066027 3300054114 Bacteria 3027
485 Ga0501082_0003845 3300060353 Bacteria 13129
486 Ga0501082_0155650 3300060353 Bacteria 1986
487 Ga0530510_0012598 3300061734 Bacteria 5944
488 Ga0530510_0022860 3300061734 Bacteria 4456
489 Ga0530510_0098316 3300061734 Bacteria 2140
490 Ga0530510_0325754 3300061734 Bacteria 1152
491 Ga0530510_0647978 3300061734 Bacteria 804

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005843 Ga0068860_100159168 Ga0068860_1001591684 141
2 3300009553 Ga0105249_10732399 Ga0105249_107323992 142
3 3300014968 Ga0157379_10433169 Ga0157379_104331692 143
4 3300049578 Ga0501042_0252260 Ga0501042_0252260_390_896 147
5 3300049588 Ga0501072_0787069 Ga0501072_0787069_76_582 147
6 3300049593 Ga0501077_0183728 Ga0501077_0183728_593_1099 147
7 3300049741 Ga0501079_0084525 Ga0501079_0084525_864_1370 147
8 3300049742 Ga0501080_0104354 Ga0501080_0104354_1891_2397 147
9 3300049743 Ga0501081_0218749 Ga0501081_0218749_801_1307 147
10 3300046684 Ga0495669_0098589 Ga0495669_0098589_532_1080 150
11 3300049580 Ga0501046_0316460 Ga0501046_0316460_470_1027 150
12 3300060353 Ga0501082_0155650 Ga0501082_0155650_1246_1803 150
13 3300061734 Ga0530510_0098316 Ga0530510_0098316_1369_1926 150
14 3300025908 Ga0207643_10155728 Ga0207643_101557282 151
15 3300035115 Ga0373941_0081587 Ga0373941_0081587_39_557 151
16 3300049584 Ga0501068_0652391 Ga0501068_0652391_100_669 151
17 3300049591 Ga0501075_0239742 Ga0501075_0239742_476_1051 152
18 3300049742 Ga0501080_0227900 Ga0501080_0227900_214_789 152
19 3300050507 nmdc:mga05p37_30883_c1 nmdc:mga05p37_30883_c1_11_541 152
20 3300061734 Ga0530510_0022860 Ga0530510_0022860_1797_2372 152
21 3300006846 Ga0075430_100019472 Ga0075430_1000194726 153
22 3300006847 Ga0075431_100000082 Ga0075431_10000008213 153
23 3300009147 Ga0114129_10020399 Ga0114129_100203996 153
24 3300026116 Ga0207674_10231648 Ga0207674_102316484 153
25 3300050507 nmdc:mga05p37_17395_c1 nmdc:mga05p37_17395_c1_3681_4253 153
26 3300050508 nmdc:mga09592_144854_c1 nmdc:mga09592_144854_c1_151_723 153
27 3300050509 nmdc:mga0qj67_1433_c1 nmdc:mga0qj67_1433_c1_11547_12119 153
28 3300050510 nmdc:mga06r32_7977_c1 nmdc:mga06r32_7977_c1_1708_2280 153
29 3300050511 nmdc:mga08y16_1110536_c1 nmdc:mga08y16_1110536_c1_46_663 153
30 3300050511 nmdc:mga08y16_390636_c1 nmdc:mga08y16_390636_c1_145_717 153
31 3300005518 Ga0070699_100003941 Ga0070699_1000039416 155
32 3300005536 Ga0070697_100099340 Ga0070697_1000993403 155
33 3300006881 Ga0068865_100919620 Ga0068865_1009196201 155
34 3300049591 Ga0501075_0088260 Ga0501075_0088260_154_714 155
35 3300049592 Ga0501076_0217123 Ga0501076_0217123_31_591 155
36 3300049742 Ga0501080_0529376 Ga0501080_0529376_300_860 155
37 3300061734 Ga0530510_0325754 Ga0530510_0325754_567_1127 155
38 3300005347 Ga0070668_100044110 Ga0070668_1000441103 156
39 3300005353 Ga0070669_100031693 Ga0070669_1000316934 156
40 3300005457 Ga0070662_101017438 Ga0070662_1010174381 156
41 3300005543 Ga0070672_100049360 Ga0070672_1000493603 156
42 3300005718 Ga0068866_10303690 Ga0068866_103036902 156
43 3300005719 Ga0068861_100096593 Ga0068861_1000965934 156
44 3300005843 Ga0068860_100083585 Ga0068860_1000835852 156
45 3300005844 Ga0068862_100595566 Ga0068862_1005955662 156
46 3300006847 Ga0075431_100000455 Ga0075431_10000045510 156
47 3300006880 Ga0075429_100002213 Ga0075429_10000221312 156
48 3300009147 Ga0114129_10000936 Ga0114129_1000093611 156
49 3300009148 Ga0105243_10016133 Ga0105243_100161334 156
50 3300009174 Ga0105241_10041676 Ga0105241_100416762 156
51 3300013306 Ga0163162_10103890 Ga0163162_101038901 156
52 3300013308 Ga0157375_10137022 Ga0157375_101370222 156
53 3300017792 Ga0163161_10120352 Ga0163161_101203522 156
54 3300025911 Ga0207654_10058214 Ga0207654_100582142 156
55 3300025933 Ga0207706_10373711 Ga0207706_103737112 156
56 3300025935 Ga0207709_10274742 Ga0207709_102747422 156
57 3300025940 Ga0207691_10035245 Ga0207691_100352454 156
58 3300026089 Ga0207648_10129111 Ga0207648_101291112 156
59 3300026118 Ga0207675_100033594 Ga0207675_1000335942 156
60 3300032126 Ga0307415_100321864 Ga0307415_1003218642 156
61 3300045051 Ga0451576_0259685 Ga0451576_0259685_510_1124 156
62 3300046499 Ga0495594_0293017 Ga0495594_0293017_210_797 156
63 3300046615 Ga0495656_0261984 Ga0495656_0261984_111_698 156
64 3300046684 Ga0495669_0046196 Ga0495669_0046196_376_963 156
65 3300048903 Ga0496100_0873433 Ga0496100_0873433_109_696 156
66 3300050507 nmdc:mga05p37_769_c1 nmdc:mga05p37_769_c1_4585_5157 156
67 3300050508 nmdc:mga09592_2581_c1 nmdc:mga09592_2581_c1_6895_7467 156
68 3300050510 nmdc:mga06r32_5775_c1 nmdc:mga06r32_5775_c1_7804_8376 156
69 3300005354 Ga0070675_100565990 Ga0070675_1005659902 157
70 3300005445 Ga0070708_100086704 Ga0070708_1000867043 157
71 3300005518 Ga0070699_100080194 Ga0070699_1000801942 157
72 3300005536 Ga0070697_100274192 Ga0070697_1002741922 157
73 3300005546 Ga0070696_100544939 Ga0070696_1005449391 157
74 3300005841 Ga0068863_100873616 Ga0068863_1008736162 157
75 3300006844 Ga0075428_100336358 Ga0075428_1003363582 157
76 3300006847 Ga0075431_101011398 Ga0075431_1010113982 157
77 3300009147 Ga0114129_10085483 Ga0114129_100854834 157
78 3300009147 Ga0114129_11340586 Ga0114129_113405862 157
79 3300013297 Ga0157378_10972879 Ga0157378_109728791 157
80 3300013306 Ga0163162_10672215 Ga0163162_106722152 157
81 3300025910 Ga0207684_10270741 Ga0207684_102707412 157
82 3300025922 Ga0207646_10340453 Ga0207646_103404532 157
83 3300046664 Ga0495659_0056330 Ga0495659_0056330_64_639 157
84 3300048913 Ga0496110_0799554 Ga0496110_0799554_209_766 157
85 3300050507 nmdc:mga05p37_1245076_c1 nmdc:mga05p37_1245076_c1_127_699 157
86 3300050507 nmdc:mga05p37_96499_c1 nmdc:mga05p37_96499_c1_589_1125 157
87 3300050510 nmdc:mga06r32_313253_c1 nmdc:mga06r32_313253_c1_116_688 157
88 3300005467 Ga0070706_100577870 Ga0070706_1005778702 158
89 3300006846 Ga0075430_100012886 Ga0075430_1000128866 158
90 3300006852 Ga0075433_10000427 Ga0075433_1000042724 158
91 3300006871 Ga0075434_100000180 Ga0075434_10000018014 158
92 3300006880 Ga0075429_100002798 Ga0075429_10000279813 158
93 3300009094 Ga0111539_11218257 Ga0111539_112182572 158
94 3300009147 Ga0114129_10000110 Ga0114129_1000011037 158
95 3300025910 Ga0207684_10474242 Ga0207684_104742422 158
96 3300025916 Ga0207663_10241733 Ga0207663_102417332 158
97 3300042876 Ga0451577_0583369 Ga0451577_0583369_419_1000 158
98 3300050507 nmdc:mga05p37_7406_c1 nmdc:mga05p37_7406_c1_9401_9973 158
99 3300050508 nmdc:mga09592_3878_c1 nmdc:mga09592_3878_c1_10309_10881 158
100 3300050509 nmdc:mga0qj67_541015_c1 nmdc:mga0qj67_541015_c1_251_832 158
101 3300050513 nmdc:mga0rr50_13734_c1 nmdc:mga0rr50_13734_c1_1146_1718 158
102 3300050515 nmdc:mga0a205_227_c1 nmdc:mga0a205_227_c1_28233_28805 158
103 3300005445 Ga0070708_100042179 Ga0070708_1000421794 159
104 3300005536 Ga0070697_100048568 Ga0070697_1000485683 159
105 3300005536 Ga0070697_100294054 Ga0070697_1002940542 159
106 3300006847 Ga0075431_100227399 Ga0075431_1002273991 159
107 3300006852 Ga0075433_10270537 Ga0075433_102705372 159
108 3300007076 Ga0075435_100387527 Ga0075435_1003875272 159
109 3300009147 Ga0114129_10013658 Ga0114129_100136582 159
110 3300025910 Ga0207684_10018762 Ga0207684_100187622 159
111 3300025922 Ga0207646_10063999 Ga0207646_100639992 159
112 3300042461 Ga0439460_0010314 Ga0439460_0010314_947_1498 159
113 3300049573 Ga0501037_0621463 Ga0501037_0621463_60_626 159
114 3300050510 nmdc:mga06r32_203185_c1 nmdc:mga06r32_203185_c1_1278_1937 159
115 3300050512 nmdc:mga0n895_1024627_c1 nmdc:mga0n895_1024627_c1_86_745 159
116 3300050513 nmdc:mga0rr50_118551_c1 nmdc:mga0rr50_118551_c1_147_719 159
117 3300003203 JGI25406J46586_10011300 JGI25406J46586_100113004 160
118 3300005985 Ga0081539_10000454 Ga0081539_1000045427 160
119 3300006871 Ga0075434_100165276 Ga0075434_1001652762 160
120 3300025940 Ga0207691_10934904 Ga0207691_109349042 160
121 3300031731 Ga0307405_10892239 Ga0307405_108922392 160
122 3300035090 Ga0373949_0115688 Ga0373949_0115688_75_653 160
123 3300035091 Ga0373951_0034593 Ga0373951_0034593_269_850 160
124 3300049587 Ga0501071_0355806 Ga0501071_0355806_454_1002 160
125 3300050511 nmdc:mga08y16_243078_c1 nmdc:mga08y16_243078_c1_1272_1820 160
126 3300005459 Ga0068867_100897905 Ga0068867_1008979051 161
127 3300005549 Ga0070704_100224808 Ga0070704_1002248083 161
128 3300005844 Ga0068862_100182182 Ga0068862_1001821822 161
129 3300005937 Ga0081455_10064100 Ga0081455_100641002 161
130 3300006844 Ga0075428_100123681 Ga0075428_1001236813 161
131 3300006847 Ga0075431_100052800 Ga0075431_1000528004 161
132 3300006852 Ga0075433_10059591 Ga0075433_100595913 161
133 3300006871 Ga0075434_100017104 Ga0075434_1000171043 161
134 3300006881 Ga0068865_100100613 Ga0068865_1001006134 161
135 3300007076 Ga0075435_100333209 Ga0075435_1003332092 161
136 3300009147 Ga0114129_10044379 Ga0114129_100443794 161
137 3300027907 Ga0207428_10000027 Ga0207428_10000027195 161
138 3300035112 Ga0373932_0156615 Ga0373932_0156615_144_716 161
139 3300045051 Ga0451576_0884149 Ga0451576_0884149_268_840 161
140 3300046528 Ga0495642_0190316 Ga0495642_0190316_231_800 161
141 3300049574 Ga0501038_0429782 Ga0501038_0429782_370_930 161
142 3300049592 Ga0501076_0683595 Ga0501076_0683595_206_751 161
143 3300050510 nmdc:mga06r32_68349_c1 nmdc:mga06r32_68349_c1_539_1156 161
144 3300050511 nmdc:mga08y16_17787_c1 nmdc:mga08y16_17787_c1_1254_1835 161
145 3300050512 nmdc:mga0n895_86246_c1 nmdc:mga0n895_86246_c1_2099_2671 161
146 3300050513 nmdc:mga0rr50_46560_c1 nmdc:mga0rr50_46560_c1_1016_1588 161
147 3300050515 nmdc:mga0a205_336025_c1 nmdc:mga0a205_336025_c1_126_743 161
148 3300050515 nmdc:mga0a205_56926_c1 nmdc:mga0a205_56926_c1_2117_2689 161
149 3300006852 Ga0075433_10000061 Ga0075433_1000006144 162
150 3300006914 Ga0075436_100002146 Ga0075436_1000021463 162
151 3300007076 Ga0075435_100017542 Ga0075435_1000175422 162
152 3300037471 Ga0395905_0266452 Ga0395905_0266452_928_1512 162
153 3300049572 Ga0501036_0365083 Ga0501036_0365083_123_668 162
154 3300049574 Ga0501038_0359531 Ga0501038_0359531_315_860 162
155 3300049575 Ga0501039_0300696 Ga0501039_0300696_213_758 162
156 3300049575 Ga0501039_0724611 Ga0501039_0724611_144_725 162
157 3300049576 Ga0501040_0097993 Ga0501040_0097993_762_1307 162
158 3300049576 Ga0501040_0140618 Ga0501040_0140618_784_1329 162
159 3300049577 Ga0501041_0030643 Ga0501041_0030643_282_827 162
160 3300049579 Ga0501043_0097849 Ga0501043_0097849_998_1543 162
161 3300049580 Ga0501046_0299193 Ga0501046_0299193_306_851 162
162 3300049582 Ga0501048_0112241 Ga0501048_0112241_1095_1640 162
163 3300049592 Ga0501076_0000831 Ga0501076_0000831_4828_5373 162
164 3300049592 Ga0501076_0320915 Ga0501076_0320915_262_807 162
165 3300049593 Ga0501077_0007379 Ga0501077_0007379_1872_2417 162
166 3300049741 Ga0501079_0183887 Ga0501079_0183887_782_1327 162
167 3300049742 Ga0501080_0118634 Ga0501080_0118634_303_848 162
168 3300049743 Ga0501081_0010638 Ga0501081_0010638_4364_4909 162
169 3300049744 Ga0501083_0132646 Ga0501083_0132646_327_872 162
170 3300049824 Ga0501045_0008724 Ga0501045_0008724_4994_5539 162
171 3300050507 nmdc:mga05p37_1821_c1 nmdc:mga05p37_1821_c1_12135_12797 162
172 3300050512 nmdc:mga0n895_1214_c1 nmdc:mga0n895_1214_c1_7971_8633 162
173 3300050513 nmdc:mga0rr50_549_c1 nmdc:mga0rr50_549_c1_14415_15077 162
174 3300050514 nmdc:mga08x19_16828_c1 nmdc:mga08x19_16828_c1_1807_2400 162
175 3300050514 nmdc:mga08x19_1724_c1 nmdc:mga08x19_1724_c1_4563_5225 162
176 3300050515 nmdc:mga0a205_1170_c1 nmdc:mga0a205_1170_c1_16151_16813 162
177 3300054114 Ga0501084_0066027 Ga0501084_0066027_1983_2528 162
178 3300060353 Ga0501082_0003845 Ga0501082_0003845_2379_2924 162
179 3300061734 Ga0530510_0012598 Ga0530510_0012598_1387_1932 162
180 3300005468 Ga0070707_100603894 Ga0070707_1006038941 163
181 3300005518 Ga0070699_100893964 Ga0070699_1008939642 163
182 3300005546 Ga0070696_100092008 Ga0070696_1000920084 163
183 3300005549 Ga0070704_100118148 Ga0070704_1001181482 163
184 3300006852 Ga0075433_10807578 Ga0075433_108075782 163
185 3300006914 Ga0075436_100144567 Ga0075436_1001445672 163
186 3300037312 Ga0395899_0171878 Ga0395899_0171878_368_919 163
187 3300037418 Ga0395900_0068642 Ga0395900_0068642_2047_2598 163
188 3300037471 Ga0395905_0017487 Ga0395905_0017487_111_662 163
189 3300038443 Ga0395901_0138497 Ga0395901_0138497_1266_1817 163
190 3300049568 Ga0501031_0220394 Ga0501031_0220394_553_1140 163
191 3300049574 Ga0501038_0205571 Ga0501038_0205571_59_646 163
192 3300049575 Ga0501039_0435642 Ga0501039_0435642_166_753 163
193 3300049577 Ga0501041_0093500 Ga0501041_0093500_317_904 163
194 3300049578 Ga0501042_0208829 Ga0501042_0208829_724_1311 163
195 3300049579 Ga0501043_0269215 Ga0501043_0269215_680_1267 163
196 3300049580 Ga0501046_0149702 Ga0501046_0149702_387_974 163
197 3300049582 Ga0501048_0050021 Ga0501048_0050021_1443_2030 163
198 3300049583 Ga0501067_0009738 Ga0501067_0009738_1350_1937 163
199 3300049587 Ga0501071_0079021 Ga0501071_0079021_760_1347 163
200 3300049587 Ga0501071_0174418 Ga0501071_0174418_988_1539 163
201 3300049589 Ga0501073_0264986 Ga0501073_0264986_576_1163 163
202 3300049590 Ga0501074_0310999 Ga0501074_0310999_122_709 163
203 3300049591 Ga0501075_0011903 Ga0501075_0011903_5467_6054 163
204 3300049591 Ga0501075_0099850 Ga0501075_0099850_828_1379 163
205 3300049592 Ga0501076_0067189 Ga0501076_0067189_1324_1911 163
206 3300049592 Ga0501076_0195477 Ga0501076_0195477_284_835 163
207 3300049741 Ga0501079_0011626 Ga0501079_0011626_3113_3700 163
208 3300049741 Ga0501079_0165012 Ga0501079_0165012_728_1279 163
209 3300049742 Ga0501080_0161938 Ga0501080_0161938_567_1154 163
210 3300049743 Ga0501081_0001826 Ga0501081_0001826_8687_9274 163
211 3300049824 Ga0501045_0196184 Ga0501045_0196184_127_714 163
212 3300049824 Ga0501045_0725249 Ga0501045_0725249_88_642 163
213 3300050509 nmdc:mga0qj67_379638_c1 nmdc:mga0qj67_379638_c1_561_1127 163
214 3300054114 Ga0501084_0021862 Ga0501084_0021862_4080_4667 163
215 3300054114 Ga0501084_0023135 Ga0501084_0023135_3153_3704 163
216 3300061734 Ga0530510_0647978 Ga0530510_0647978_104_691 163
217 3300005467 Ga0070706_100008450 Ga0070706_1000084504 164
218 3300005468 Ga0070707_100000729 Ga0070707_10000072912 164
219 3300005471 Ga0070698_100004426 Ga0070698_10000442610 164
220 3300005518 Ga0070699_100000534 Ga0070699_10000053413 164
221 3300005536 Ga0070697_100001086 Ga0070697_10000108613 164
222 3300005536 Ga0070697_100047520 Ga0070697_1000475203 164
223 3300005719 Ga0068861_100548868 Ga0068861_1005488682 164
224 3300006844 Ga0075428_100006929 Ga0075428_1000069297 164
225 3300006844 Ga0075428_100446829 Ga0075428_1004468292 164
226 3300006846 Ga0075430_100032620 Ga0075430_1000326204 164
227 3300006846 Ga0075430_100345004 Ga0075430_1003450042 164
228 3300006880 Ga0075429_100197369 Ga0075429_1001973693 164
229 3300006880 Ga0075429_100803774 Ga0075429_1008037742 164
230 3300006880 Ga0075429_100874527 Ga0075429_1008745272 164
231 3300009147 Ga0114129_10002179 Ga0114129_1000217925 164
232 3300009147 Ga0114129_10735289 Ga0114129_107352891 164
233 3300025910 Ga0207684_10000279 Ga0207684_1000027962 164
234 3300025922 Ga0207646_10001682 Ga0207646_1000168212 164
235 3300026118 Ga0207675_100404881 Ga0207675_1004048812 164
236 3300031548 Ga0307408_100023380 Ga0307408_1000233805 164
237 3300031901 Ga0307406_10341647 Ga0307406_103416472 164
238 3300031903 Ga0307407_10043399 Ga0307407_100433992 164
239 3300037471 Ga0395905_0207808 Ga0395905_0207808_58_636 164
240 3300049588 Ga0501072_0676199 Ga0501072_0676199_64_684 164
241 3300050507 nmdc:mga05p37_155861_c1 nmdc:mga05p37_155861_c1_1907_2476 164
242 3300050507 nmdc:mga05p37_2476_c1 nmdc:mga05p37_2476_c1_8371_8958 164
243 3300050508 nmdc:mga09592_226520_c1 nmdc:mga09592_226520_c1_845_1432 164
244 3300050509 nmdc:mga0qj67_291779_c1 nmdc:mga0qj67_291779_c1_446_1033 164
245 3300050510 nmdc:mga06r32_225659_c1 nmdc:mga06r32_225659_c1_970_1530 164
246 3300050510 nmdc:mga06r32_6924_c1 nmdc:mga06r32_6924_c1_582_1169 164
247 3300050511 nmdc:mga08y16_83078_c1 nmdc:mga08y16_83078_c1_1989_2537 164
248 3300005336 Ga0070680_100411165 Ga0070680_1004111652 165
249 3300005445 Ga0070708_100996774 Ga0070708_1009967742 165
250 3300005530 Ga0070679_100158348 Ga0070679_1001583482 165
251 3300005545 Ga0070695_100063589 Ga0070695_1000635894 165
252 3300005549 Ga0070704_100043338 Ga0070704_1000433383 165
253 3300005981 Ga0081538_10003260 Ga0081538_100032609 165
254 3300006852 Ga0075433_10181580 Ga0075433_101815802 165
255 3300006852 Ga0075433_10258382 Ga0075433_102583822 165
256 3300006871 Ga0075434_100309702 Ga0075434_1003097023 165
257 3300007076 Ga0075435_100099992 Ga0075435_1000999923 165
258 3300009147 Ga0114129_10211158 Ga0114129_102111582 165
259 3300009147 Ga0114129_10797536 Ga0114129_107975361 165
260 3300009147 Ga0114129_11037305 Ga0114129_110373052 165
261 3300010375 Ga0105239_10612823 Ga0105239_106128232 165
262 3300025917 Ga0207660_10318513 Ga0207660_103185133 165
263 3300042876 Ga0451577_0481095 Ga0451577_0481095_537_1091 165
264 3300049590 Ga0501074_0405515 Ga0501074_0405515_272_832 165
265 3300049824 Ga0501045_0079400 Ga0501045_0079400_636_1226 165
266 3300050510 nmdc:mga06r32_443267_c1 nmdc:mga06r32_443267_c1_122_676 165
267 3300050512 nmdc:mga0n895_232758_c1 nmdc:mga0n895_232758_c1_137_724 165
268 3300050512 nmdc:mga0n895_46940_c1 nmdc:mga0n895_46940_c1_3339_3908 165
269 3300050514 nmdc:mga08x19_174249_c1 nmdc:mga08x19_174249_c1_406_975 165
270 3300050515 nmdc:mga0a205_289101_c1 nmdc:mga0a205_289101_c1_123_710 165
271 3300050515 nmdc:mga0a205_68336_c1 nmdc:mga0a205_68336_c1_2826_3395 165
272 3300005330 Ga0070690_101094629 Ga0070690_1010946291 166
273 3300005440 Ga0070705_100218810 Ga0070705_1002188102 166
274 3300005468 Ga0070707_100138098 Ga0070707_1001380982 166
275 3300005518 Ga0070699_100583625 Ga0070699_1005836252 166
276 3300005546 Ga0070696_100018685 Ga0070696_1000186855 166
277 3300005547 Ga0070693_100074595 Ga0070693_1000745954 166
278 3300005617 Ga0068859_100524987 Ga0068859_1005249872 166
279 3300005844 Ga0068862_100558532 Ga0068862_1005585322 166
280 3300006844 Ga0075428_100197201 Ga0075428_1001972012 166
281 3300006844 Ga0075428_100842536 Ga0075428_1008425362 166
282 3300006846 Ga0075430_100028925 Ga0075430_1000289251 166
283 3300006846 Ga0075430_100188262 Ga0075430_1001882622 166
284 3300006847 Ga0075431_100759265 Ga0075431_1007592652 166
285 3300006852 Ga0075433_10337826 Ga0075433_103378262 166
286 3300006852 Ga0075433_10358774 Ga0075433_103587742 166
287 3300006852 Ga0075433_11104542 Ga0075433_111045421 166
288 3300006871 Ga0075434_100073024 Ga0075434_1000730244 166
289 3300006871 Ga0075434_100085881 Ga0075434_1000858813 166
290 3300006871 Ga0075434_100451075 Ga0075434_1004510751 166
291 3300006880 Ga0075429_100023887 Ga0075429_1000238874 166
292 3300006880 Ga0075429_100181246 Ga0075429_1001812463 166
293 3300006931 Ga0097620_100524995 Ga0097620_1005249952 166
294 3300007076 Ga0075435_100063505 Ga0075435_1000635053 166
295 3300009094 Ga0111539_10012644 Ga0111539_1001264410 166
296 3300009094 Ga0111539_10250103 Ga0111539_102501033 166
297 3300009147 Ga0114129_10750296 Ga0114129_107502962 166
298 3300009176 Ga0105242_10344983 Ga0105242_103449832 166
299 3300009177 Ga0105248_10194352 Ga0105248_101943522 166
300 3300013297 Ga0157378_10060912 Ga0157378_100609123 166
301 3300025922 Ga0207646_10284741 Ga0207646_102847412 166
302 3300025923 Ga0207681_10294417 Ga0207681_102944172 166
303 3300025934 Ga0207686_10340996 Ga0207686_103409962 166
304 3300025961 Ga0207712_10115092 Ga0207712_101150924 166
305 3300026089 Ga0207648_10091646 Ga0207648_100916462 166
306 3300027907 Ga0207428_10020343 Ga0207428_100203434 166
307 3300027907 Ga0207428_10148466 Ga0207428_101484662 166
308 3300028380 Ga0268265_10213693 Ga0268265_102136932 166
309 3300028380 Ga0268265_10322867 Ga0268265_103228672 166
310 3300028381 Ga0268264_10323716 Ga0268264_103237162 166
311 3300035084 Ga0373928_0106101 Ga0373928_0106101_157_723 166
312 3300035088 Ga0373940_0163321 Ga0373940_0163321_131_700 166
313 3300042876 Ga0451577_0206872 Ga0451577_0206872_692_1264 166
314 3300047318 Ga0495636_0151104 Ga0495636_0151104_384_959 166
315 3300048905 Ga0496102_0069075 Ga0496102_0069075_675_1241 166
316 3300048909 Ga0496106_0064340 Ga0496106_0064340_235_801 166
317 3300049584 Ga0501068_0395256 Ga0501068_0395256_33_605 166
318 3300049588 Ga0501072_0019990 Ga0501072_0019990_1173_1727 166
319 3300049591 Ga0501075_0538506 Ga0501075_0538506_281_853 166
320 3300050507 nmdc:mga05p37_115985_c1 nmdc:mga05p37_115985_c1_1373_1942 166
321 3300050507 nmdc:mga05p37_42435_c1 nmdc:mga05p37_42435_c1_1773_2348 166
322 3300050507 nmdc:mga05p37_547764_c1 nmdc:mga05p37_547764_c1_718_1287 166
323 3300050508 nmdc:mga09592_5317_c1 nmdc:mga09592_5317_c1_5676_6251 166
324 3300050510 nmdc:mga06r32_931185_c1 nmdc:mga06r32_931185_c1_214_789 166
325 3300050511 nmdc:mga08y16_149523_c1 nmdc:mga08y16_149523_c1_568_1128 166
326 3300050511 nmdc:mga08y16_49615_c1 nmdc:mga08y16_49615_c1_1749_2324 166
327 3300050512 nmdc:mga0n895_60106_c1 nmdc:mga0n895_60106_c1_1232_1801 166
328 3300050515 nmdc:mga0a205_106355_c1 nmdc:mga0a205_106355_c1_1421_1990 166
329 3300050515 nmdc:mga0a205_6155_c1 nmdc:mga0a205_6155_c1_2127_2687 166
330 3300050515 nmdc:mga0a205_8978_c1 nmdc:mga0a205_8978_c1_3030_3605 166
331 3300005445 Ga0070708_100329876 Ga0070708_1003298763 167
332 3300005467 Ga0070706_100620262 Ga0070706_1006202622 167
333 3300005468 Ga0070707_100045468 Ga0070707_1000454684 167
334 3300005468 Ga0070707_100077890 Ga0070707_1000778904 167
335 3300005471 Ga0070698_100282480 Ga0070698_1002824802 167
336 3300005518 Ga0070699_100174329 Ga0070699_1001743293 167
337 3300005518 Ga0070699_100234239 Ga0070699_1002342392 167
338 3300005518 Ga0070699_100509393 Ga0070699_1005093932 167
339 3300006358 Ga0068871_100991748 Ga0068871_1009917482 167
340 3300006871 Ga0075434_100094218 Ga0075434_1000942182 167
341 3300025910 Ga0207684_10319722 Ga0207684_103197222 167
342 3300025922 Ga0207646_10027725 Ga0207646_100277252 167
343 3300025922 Ga0207646_10039239 Ga0207646_100392394 167
344 3300031548 Ga0307408_100054771 Ga0307408_1000547714 167
345 3300031548 Ga0307408_100507328 Ga0307408_1005073282 167
346 3300031824 Ga0307413_10425550 Ga0307413_104255502 167
347 3300031995 Ga0307409_100106896 Ga0307409_1001068961 167
348 3300044673 Ga0453683_0215319 Ga0453683_0215319_596_1177 167
349 3300049576 Ga0501040_0002340 Ga0501040_0002340_5700_6281 167
350 3300049576 Ga0501040_0266024 Ga0501040_0266024_185_838 167
351 3300049580 Ga0501046_0691557 Ga0501046_0691557_64_672 167
352 3300049582 Ga0501048_0239954 Ga0501048_0239954_599_1216 167
353 3300049588 Ga0501072_0060057 Ga0501072_0060057_909_1526 167
354 3300049590 Ga0501074_0044826 Ga0501074_0044826_1548_2165 167
355 3300049591 Ga0501075_0405274 Ga0501075_0405274_318_965 167
356 3300049592 Ga0501076_0003944 Ga0501076_0003944_430_1047 167
357 3300049593 Ga0501077_0186395 Ga0501077_0186395_375_992 167
358 3300049743 Ga0501081_0002472 Ga0501081_0002472_6963_7580 167
359 3300049743 Ga0501081_0713618 Ga0501081_0713618_79_660 167
360 3300049824 Ga0501045_0170891 Ga0501045_0170891_202_783 167
361 3300049824 Ga0501045_0244054 Ga0501045_0244054_678_1259 167
362 3300050512 nmdc:mga0n895_109152_c1 nmdc:mga0n895_109152_c1_1591_2163 167
363 3300054114 Ga0501084_0026115 Ga0501084_0026115_987_1604 167
364 3300005983 Ga0081540_1019869 Ga0081540_10198693 168
365 3300006871 Ga0075434_100119131 Ga0075434_1001191314 168
366 3300007076 Ga0075435_100051710 Ga0075435_1000517104 168
367 3300006846 Ga0075430_100003492 Ga0075430_1000034924 169
368 3300006847 Ga0075431_100001936 Ga0075431_10000193617 169
369 3300006880 Ga0075429_100002856 Ga0075429_10000285611 169
370 3300009147 Ga0114129_10114857 Ga0114129_101148573 169
371 3300049705 Ga0501225_0102149 Ga0501225_0102149_194_793 169
372 3300050507 nmdc:mga05p37_92449_c1 nmdc:mga05p37_92449_c1_1349_1933 169
373 3300050508 nmdc:mga09592_54900_c1 nmdc:mga09592_54900_c1_852_1454 169
374 3300050509 nmdc:mga0qj67_60996_c1 nmdc:mga0qj67_60996_c1_1159_1761 169
375 3300050510 nmdc:mga06r32_70286_c1 nmdc:mga06r32_70286_c1_309_911 169
376 3300006847 Ga0075431_100001270 Ga0075431_10000127021 171
377 3300006880 Ga0075429_100002106 Ga0075429_10000210614 171
378 3300009147 Ga0114129_10445810 Ga0114129_104458102 171
379 3300027682 Ga0209971_1099388 Ga0209971_10993881 171
380 3300027876 Ga0209974_10029136 Ga0209974_100291362 171
381 3300050507 nmdc:mga05p37_95179_c1 nmdc:mga05p37_95179_c1_773_1390 171
382 3300050508 nmdc:mga09592_1944_c1 nmdc:mga09592_1944_c1_10293_10910 171
383 3300050510 nmdc:mga06r32_3786_c1 nmdc:mga06r32_3786_c1_5244_5861 171
384 3300025908 Ga0207643_10016950 Ga0207643_100169504 172
385 3300009177 Ga0105248_10463107 Ga0105248_104631073 173
386 3300001977 JGI24746J21847_1001951 JGI24746J21847_10019514 174
387 3300002073 JGI24745J21846_1010929 JGI24745J21846_10109292 174
388 3300002126 JGI24035J26624_1021093 JGI24035J26624_10210932 174
389 3300005293 Ga0065715_10162957 Ga0065715_101629573 174
390 3300005295 Ga0065707_10390774 Ga0065707_103907742 174
391 3300005328 Ga0070676_10074028 Ga0070676_100740282 174
392 3300005330 Ga0070690_100082077 Ga0070690_1000820772 174
393 3300005333 Ga0070677_10002331 Ga0070677_100023312 174
394 3300005334 Ga0068869_100258101 Ga0068869_1002581012 174
395 3300005335 Ga0070666_10029185 Ga0070666_100291854 174
396 3300005340 Ga0070689_100179427 Ga0070689_1001794272 174
397 3300005343 Ga0070687_100015745 Ga0070687_1000157455 174
398 3300005347 Ga0070668_100021604 Ga0070668_1000216045 174
399 3300005353 Ga0070669_100012365 Ga0070669_1000123653 174
400 3300005354 Ga0070675_100252044 Ga0070675_1002520442 174
401 3300005364 Ga0070673_100124601 Ga0070673_1001246014 174
402 3300005365 Ga0070688_100048283 Ga0070688_1000482834 174
403 3300005366 Ga0070659_100102975 Ga0070659_1001029754 174
404 3300005367 Ga0070667_100034478 Ga0070667_1000344784 174
405 3300005438 Ga0070701_10038494 Ga0070701_100384942 174
406 3300005440 Ga0070705_100195712 Ga0070705_1001957122 174
407 3300005456 Ga0070678_100016025 Ga0070678_1000160251 174
408 3300005457 Ga0070662_100006443 Ga0070662_1000064439 174
409 3300005459 Ga0068867_100030066 Ga0068867_1000300664 174
410 3300005466 Ga0070685_10045159 Ga0070685_100451593 174
411 3300005535 Ga0070684_100829224 Ga0070684_1008292242 174
412 3300005539 Ga0068853_100601448 Ga0068853_1006014482 174
413 3300005543 Ga0070672_100014619 Ga0070672_1000146192 174
414 3300005544 Ga0070686_100116357 Ga0070686_1001163572 174
415 3300005549 Ga0070704_100307111 Ga0070704_1003071112 174
416 3300005564 Ga0070664_100024184 Ga0070664_1000241845 174
417 3300005578 Ga0068854_100279027 Ga0068854_1002790272 174
418 3300005616 Ga0068852_101182625 Ga0068852_1011826252 174
419 3300005617 Ga0068859_100065876 Ga0068859_1000658763 174
420 3300005618 Ga0068864_100170777 Ga0068864_1001707772 174
421 3300005719 Ga0068861_100178774 Ga0068861_1001787744 174
422 3300005840 Ga0068870_10002979 Ga0068870_100029797 174
423 3300005841 Ga0068863_100025327 Ga0068863_1000253272 174
424 3300005842 Ga0068858_100034467 Ga0068858_1000344675 174
425 3300005844 Ga0068862_100039181 Ga0068862_1000391814 174
426 3300006237 Ga0097621_100070646 Ga0097621_1000706464 174
427 3300006358 Ga0068871_100200215 Ga0068871_1002002154 174
428 3300006844 Ga0075428_100004648 Ga0075428_10000464810 174
429 3300006846 Ga0075430_100029617 Ga0075430_1000296174 174
430 3300006847 Ga0075431_100001687 Ga0075431_10000168716 174
431 3300006852 Ga0075433_10005550 Ga0075433_100055508 174
432 3300006871 Ga0075434_100040188 Ga0075434_1000401885 174
433 3300006880 Ga0075429_100064236 Ga0075429_1000642364 174
434 3300006881 Ga0068865_100219178 Ga0068865_1002191782 174
435 3300006931 Ga0097620_100065876 Ga0097620_1000658763 174
436 3300009094 Ga0111539_10006594 Ga0111539_1000659410 174
437 3300009147 Ga0114129_10413676 Ga0114129_104136763 174
438 3300009177 Ga0105248_10395701 Ga0105248_103957012 174
439 3300009553 Ga0105249_10008153 Ga0105249_100081535 174
440 3300013306 Ga0163162_10055861 Ga0163162_100558614 174
441 3300013308 Ga0157375_10374942 Ga0157375_103749422 174
442 3300014326 Ga0157380_10003226 Ga0157380_100032267 174
443 3300014745 Ga0157377_10005724 Ga0157377_100057246 174
444 3300014968 Ga0157379_10181268 Ga0157379_101812682 174
445 3300014969 Ga0157376_10435855 Ga0157376_104358552 174
446 3300017792 Ga0163161_10104805 Ga0163161_101048052 174
447 3300025290 Ga0207673_1012930 Ga0207673_10129302 174
448 3300025315 Ga0207697_10001435 Ga0207697_100014359 174
449 3300025893 Ga0207682_10003116 Ga0207682_100031162 174
450 3300025901 Ga0207688_10001607 Ga0207688_100016072 174
451 3300025903 Ga0207680_10023261 Ga0207680_100232613 174
452 3300025907 Ga0207645_10008679 Ga0207645_100086796 174
453 3300025908 Ga0207643_10000732 Ga0207643_100007322 174
454 3300025918 Ga0207662_10039826 Ga0207662_100398262 174
455 3300025920 Ga0207649_10041050 Ga0207649_100410503 174
456 3300025923 Ga0207681_10008334 Ga0207681_100083343 174
457 3300025926 Ga0207659_10071452 Ga0207659_100714522 174
458 3300025931 Ga0207644_10087713 Ga0207644_100877133 174
459 3300025932 Ga0207690_10166105 Ga0207690_101661052 174
460 3300025933 Ga0207706_10334375 Ga0207706_103343753 174
461 3300025936 Ga0207670_10181069 Ga0207670_101810692 174
462 3300025940 Ga0207691_10010524 Ga0207691_100105247 174
463 3300025941 Ga0207711_10499914 Ga0207711_104999142 174
464 3300025942 Ga0207689_10091644 Ga0207689_100916443 174
465 3300025945 Ga0207679_10010677 Ga0207679_100106777 174
466 3300025960 Ga0207651_10121224 Ga0207651_101212242 174
467 3300025961 Ga0207712_10135770 Ga0207712_101357702 174
468 3300025972 Ga0207668_10086619 Ga0207668_100866193 174
469 3300026023 Ga0207677_10145337 Ga0207677_101453371 174
470 3300026075 Ga0207708_10086171 Ga0207708_100861712 174
471 3300026089 Ga0207648_10082063 Ga0207648_100820634 174
472 3300026095 Ga0207676_10062298 Ga0207676_100622982 174
473 3300026116 Ga0207674_10185820 Ga0207674_101858203 174
474 3300026118 Ga0207675_100012281 Ga0207675_1000122819 174
475 3300026121 Ga0207683_10007833 Ga0207683_100078332 174
476 3300026142 Ga0207698_11899713 Ga0207698_118997131 174
477 3300027617 Ga0210002_1033299 Ga0210002_10332992 174
478 3300027907 Ga0207428_10008043 Ga0207428_100080433 174
479 3300028380 Ga0268265_10031665 Ga0268265_100316654 174
480 3300035112 Ga0373932_0037407 Ga0373932_0037407_268_843 174
481 3300035114 Ga0373939_0044598 Ga0373939_0044598_587_1162 174
482 3300042439 Ga0439464_0200917 Ga0439464_0200917_25_600 174
483 3300048913 Ga0496110_0106836 Ga0496110_0106836_342_917 174
484 3300050507 nmdc:mga05p37_398270_c1 nmdc:mga05p37_398270_c1_400_975 174
485 3300050508 nmdc:mga09592_14652_c1 nmdc:mga09592_14652_c1_151_726 174
486 3300050508 nmdc:mga09592_218704_c1 nmdc:mga09592_218704_c1_139_714 174
487 3300050509 nmdc:mga0qj67_7809_c1 nmdc:mga0qj67_7809_c1_1424_1999 174
488 3300050510 nmdc:mga06r32_2396_c1 nmdc:mga06r32_2396_c1_1407_1982 174
489 3300050511 nmdc:mga08y16_123507_c1 nmdc:mga08y16_123507_c1_1385_1963 174
490 3300050512 nmdc:mga0n895_20754_c1 nmdc:mga0n895_20754_c1_534_1109 174
491 3300050515 nmdc:mga0a205_1627_c1 nmdc:mga0a205_1627_c1_2703_3278 174

Feature Viewer

pLDDT pTM Quality
44.52 0.19 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map