F454092

General Info

Members Datasets Scaffolds Average Seq Length
491 280 490 278

Family's Representative Sequence

Representative Sequence 3300009545|Ga0105237_10023895|Ga0105237_100238956
Length 308
Sequence MERPVRDSRIAARRAWAQAPGMNTTATPLDHLSEWIGRSEQRDDEVTPAPLAGLTATLDRADDAPPTAGSVLPPLAHWLYFLPQALQRELGPDGHPKRGGFLPPVPLPRRMWAGGRLQFHHAIRVGEAVTRRSTIASVEAKYGRSGALVFVTVRHQVMNAHGEAVTEEHDIVYRENPAPGAVPPTPAQAPTDETFSRAITPDPVLLFRYSALTFNGHRIHYDRSYVTEVEGYPGLIVHGPLIATLLVDLLRRELPGAVLRQFDFKAASPLFDIHPFTVCGRRDVDGSVALWARNHLGQLAMSARAVIG

Samples

Sample ID Description Type Environment
1 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
2 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
3 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
4 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
5 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
6 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
7 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
8 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
66 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
67 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
68 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
69 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
70 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
85 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
86 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
87 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
88 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
93 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
94 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
95 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
96 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
97 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
98 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
99 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
147 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
148 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
149 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
150 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
151 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
152 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
153 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
154 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
155 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
156 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
157 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
158 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
159 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
160 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
161 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
162 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
163 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
164 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
165 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
166 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
167 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
168 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
169 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
170 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
171 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
172 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
173 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
174 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
175 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
176 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
177 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
178 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
179 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
180 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
181 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
182 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
183 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
184 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
185 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
186 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
187 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
188 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
189 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
190 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
191 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
192 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
193 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
194 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
195 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
196 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
197 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
198 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
199 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
200 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
201 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
202 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
203 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
204 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
205 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
206 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
207 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
208 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
209 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
210 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
211 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
212 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
213 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
214 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
215 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
216 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
217 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
218 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
219 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
220 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
221 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
222 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
223 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
224 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
225 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
226 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
227 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
228 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
229 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
230 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
231 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
232 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
233 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
234 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
235 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
236 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
237 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
238 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
239 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
240 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
241 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
242 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
243 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
244 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
245 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
246 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
247 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
248 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
249 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
250 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
251 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
252 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
253 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
254 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
255 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
256 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
257 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
258 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
259 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
260 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
261 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
262 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
263 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
264 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
265 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
266 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
267 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
268 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
269 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
270 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
271 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
272 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
273 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
274 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
275 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
276 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
277 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
278 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
279 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
280 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.59
Metatranscriptomes 0.2
Isolates 0.2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.89
Nodule 0
Rhizoplane 3.87
Rhizosphere 87.17
Stem 0
Stem Tuber 0
Unclassified 4.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055526_1004060 3300003771 Bacteria 8981
2 Ga0055537_1000060 3300003773 Bacteria 79376
3 Ga0055524_1006567 3300003775 Bacteria 5030
4 Ga0055534_1000009 3300003784 Bacteria 210256
5 Ga0055528_1000012 3300003790 Bacteria 182704
6 Ga0055540_1009756 3300003792 Bacteria 3277
7 Ga0065165_1002482 3300005262 Bacteria 15509
8 Ga0070690_100000556 3300005330 Bacteria 18657
9 Ga0070690_100064684 3300005330 Bacteria 2363
10 Ga0070670_100059016 3300005331 Bacteria 3294
11 Ga0070670_100114501 3300005331 Bacteria 2325
12 Ga0068869_100211372 3300005334 Bacteria 1534
13 Ga0070666_10004013 3300005335 Bacteria 8934
14 Ga0070666_10004185 3300005335 Bacteria 8755
15 Ga0070666_10127108 3300005335 Bacteria 1769
16 Ga0070680_100018637 3300005336 Bacteria 5488
17 Ga0070682_100020115 3300005337 Bacteria 3924
18 Ga0068868_100001782 3300005338 Bacteria 14769
19 Ga0068868_100001860 3300005338 Bacteria 14489
20 Ga0068868_100009574 3300005338 Bacteria 6986
21 Ga0068868_100199152 3300005338 Bacteria 1669
22 Ga0070660_100008574 3300005339 Bacteria 7159
23 Ga0070689_100005236 3300005340 Bacteria 8838
24 Ga0070689_100014610 3300005340 Bacteria 5708
25 Ga0070687_100014545 3300005343 Bacteria 3536
26 Ga0070661_100016566 3300005344 Bacteria 5214
27 Ga0070661_100219480 3300005344 Bacteria 1458
28 Ga0070692_10007483 3300005345 Bacteria 4810
29 Ga0070675_100000866 3300005354 Bacteria 21542
30 Ga0070675_100173019 3300005354 Bacteria 1863
31 Ga0070671_100007172 3300005355 Bacteria 8911
32 Ga0070671_100015965 3300005355 Bacteria 6067
33 Ga0070671_100084005 3300005355 Bacteria 2663
34 Ga0070671_100173783 3300005355 Bacteria 1822
35 Ga0070674_100012875 3300005356 Bacteria 5151
36 Ga0070674_100054392 3300005356 Bacteria 2769
37 Ga0070673_100000463 3300005364 Bacteria 21550
38 Ga0070673_100018977 3300005364 Bacteria 4930
39 Ga0070688_100000789 3300005365 Bacteria 15673
40 Ga0070688_100020322 3300005365 Bacteria 3859
41 Ga0070659_100195556 3300005366 Bacteria 1663
42 Ga0070667_100002208 3300005367 Bacteria 17125
43 Ga0070667_100007690 3300005367 Bacteria 8938
44 Ga0070709_10057610 3300005434 Bacteria 2461
45 Ga0070713_100067320 3300005436 Bacteria 3015
46 Ga0070710_10009223 3300005437 Bacteria 4822
47 Ga0070701_10001887 3300005438 Bacteria 7944
48 Ga0070701_10182996 3300005438 Bacteria 1228
49 Ga0070711_100003838 3300005439 Bacteria 8822
50 Ga0070705_100408939 3300005440 Bacteria 1007
51 Ga0070700_100051424 3300005441 Bacteria 2564
52 Ga0070663_100038978 3300005455 Bacteria 3318
53 Ga0070678_100003701 3300005456 Bacteria 8555
54 Ga0070678_100007865 3300005456 Bacteria 6345
55 Ga0070662_100040493 3300005457 Bacteria 3318
56 Ga0068867_100009459 3300005459 Bacteria 6872
57 Ga0068867_100049798 3300005459 Bacteria 3084
58 Ga0068867_100052950 3300005459 Bacteria 2996
59 Ga0068867_100096535 3300005459 Bacteria 2251
60 Ga0068867_100216061 3300005459 Bacteria 1542
61 Ga0070685_10001482 3300005466 Bacteria 12364
62 Ga0070707_100073845 3300005468 Bacteria 3288
63 Ga0070699_100083396 3300005518 Bacteria 2788
64 Ga0070679_100047595 3300005530 Bacteria 4273
65 Ga0070684_100052968 3300005535 Bacteria 3530
66 Ga0070672_100025360 3300005543 Bacteria 4396
67 Ga0070672_100046989 3300005543 Bacteria 3348
68 Ga0070686_100038942 3300005544 Bacteria 2959
69 Ga0070686_100105167 3300005544 Bacteria 1913
70 Ga0070695_100007028 3300005545 Bacteria 6672
71 Ga0070696_100025968 3300005546 Bacteria 3984
72 Ga0070696_100092373 3300005546 Bacteria 2157
73 Ga0070696_100273179 3300005546 Bacteria 1286
74 Ga0070693_100016005 3300005547 Bacteria 3874
75 Ga0070665_100001903 3300005548 Bacteria 23593
76 Ga0070665_100074027 3300005548 Bacteria 3412
77 Ga0070665_100166797 3300005548 Bacteria 2204
78 Ga0070704_100018383 3300005549 Bacteria 4469
79 Ga0070664_100244989 3300005564 Bacteria 1610
80 Ga0068854_100003266 3300005578 Bacteria 10099
81 Ga0068854_100018348 3300005578 Bacteria 4696
82 Ga0068856_100661151 3300005614 Bacteria 1065
83 Ga0070702_100005067 3300005615 Bacteria 6090
84 Ga0070702_100042486 3300005615 Bacteria 2556
85 Ga0068852_100064415 3300005616 Bacteria 3195
86 Ga0068859_100000849 3300005617 Bacteria 31102
87 Ga0068859_100003928 3300005617 Bacteria 15180
88 Ga0068864_100002466 3300005618 Bacteria 15271
89 Ga0068864_100004136 3300005618 Bacteria 11904
90 Ga0068864_100041763 3300005618 Bacteria 3922
91 Ga0068866_10005817 3300005718 Bacteria 5116
92 Ga0068866_10048775 3300005718 Bacteria 2142
93 Ga0068861_100027238 3300005719 Bacteria 4161
94 Ga0068861_100049269 3300005719 Bacteria 3188
95 Ga0068861_100064127 3300005719 Bacteria 2826
96 Ga0068851_10055836 3300005834 Bacteria 2013
97 Ga0068863_100002625 3300005841 Bacteria 17809
98 Ga0068863_100015509 3300005841 Bacteria 7322
99 Ga0068863_100024238 3300005841 Bacteria 5787
100 Ga0068863_100071639 3300005841 Bacteria 3279
101 Ga0068863_100483666 3300005841 Bacteria 1218
102 Ga0068858_100004378 3300005842 Bacteria 13857
103 Ga0068858_100009190 3300005842 Bacteria 9445
104 Ga0068858_100068343 3300005842 Bacteria 3292
105 Ga0068858_100248899 3300005842 Bacteria 1688
106 Ga0068860_100030877 3300005843 Bacteria 5151
107 Ga0068860_100050288 3300005843 Bacteria 3968
108 Ga0068860_100065958 3300005843 Bacteria 3438
109 Ga0068860_100157231 3300005843 Bacteria 2191
110 Ga0068862_100312451 3300005844 Bacteria 1449
111 Ga0068862_100394558 3300005844 Bacteria 1293
112 Ga0075365_10206125 3300006038 Bacteria 1378
113 Ga0075364_10002745 3300006051 Bacteria 9896
114 Ga0070715_10033974 3300006163 Bacteria 2088
115 Ga0070712_100083417 3300006175 Bacteria 2320
116 Ga0075369_10008272 3300006186 Bacteria 3999
117 Ga0075366_10002720 3300006195 Bacteria 9133
118 Ga0075366_10234701 3300006195 Bacteria 1118
119 Ga0097621_100456961 3300006237 Bacteria 1151
120 Ga0068871_100040783 3300006358 Bacteria 3720
121 Ga0068871_100059282 3300006358 Bacteria 3118
122 Ga0075434_100158687 3300006871 Bacteria 2282
123 Ga0068865_100016550 3300006881 Bacteria 4721
124 Ga0068865_100071552 3300006881 Bacteria 2460
125 Ga0097620_100000849 3300006931 Bacteria 31102
126 Ga0097620_100003928 3300006931 Bacteria 15180
127 Ga0075435_100148347 3300007076 Bacteria 1971
128 Ga0105245_10003896 3300009098 Bacteria 13266
129 Ga0105245_10008880 3300009098 Bacteria 8771
130 Ga0105245_10040577 3300009098 Bacteria 4147
131 Ga0105245_10044119 3300009098 Bacteria 3979
132 Ga0105247_10015842 3300009101 Bacteria 4513
133 Ga0105242_10030559 3300009176 Bacteria 4301
134 Ga0105248_10118413 3300009177 Bacteria 2987
135 Ga0105248_10175034 3300009177 Bacteria 2419
136 Ga0105248_10589438 3300009177 Bacteria 1254
137 Ga0105237_10023895 3300009545 Bacteria 6256
138 Ga0105237_10590438 3300009545 Bacteria 1118
139 Ga0105238_10046326 3300009551 Bacteria 4389
140 Ga0105238_10114293 3300009551 Bacteria 2679
141 Ga0105239_10110858 3300010375 Bacteria 3041
142 Ga0105246_10026028 3300011119 Bacteria 3817
143 Ga0105246_10036662 3300011119 Bacteria 3287
144 Ga0157373_10242720 3300013100 Bacteria 1273
145 Ga0157370_10005376 3300013104 Bacteria 14378
146 Ga0157370_10083407 3300013104 Bacteria 3005
147 Ga0157374_10000101 3300013296 Bacteria 79331
148 Ga0157374_10071144 3300013296 Bacteria 3279
149 Ga0157378_10010931 3300013297 Bacteria 7941
150 Ga0157378_10011929 3300013297 Bacteria 7609
151 Ga0163162_10004614 3300013306 Bacteria 13279
152 Ga0163162_10038948 3300013306 Bacteria 4746
153 Ga0163162_10297244 3300013306 Bacteria 1746
154 Ga0157375_10005750 3300013308 Bacteria 10786
155 Ga0157375_10022507 3300013308 Bacteria 5800
156 Ga0157375_10112478 3300013308 Bacteria 2823
157 Ga0157375_10170367 3300013308 Bacteria 2324
158 Ga0163163_10009687 3300014325 Bacteria 8620
159 Ga0163163_10010019 3300014325 Bacteria 8500
160 Ga0163163_10067828 3300014325 Bacteria 3548
161 Ga0157379_10007662 3300014968 Bacteria 9347
162 Ga0157379_10013450 3300014968 Bacteria 7169
163 Ga0157379_10174199 3300014968 Bacteria 1942
164 Ga0157379_10271323 3300014968 Bacteria 1543
165 Ga0157376_10002075 3300014969 Bacteria 13467
166 Ga0157376_10115241 3300014969 Bacteria 2372
167 Ga0157376_10199931 3300014969 Bacteria 1838
168 Ga0209565_1000015 3300025263 Bacteria 494091
169 Ga0209673_1000017 3300025273 Bacteria 492994
170 Ga0209675_1000012 3300025291 Bacteria 494061
171 Ga0209564_1000016 3300025295 Bacteria 613131
172 Ga0209256_1000346 3300025299 Bacteria 75456
173 Ga0209051_1001760 3300025303 Bacteria 17204
174 Ga0207642_10000954 3300025899 Bacteria 9041
175 Ga0207642_10029866 3300025899 Bacteria 2263
176 Ga0207680_10000645 3300025903 Bacteria 16429
177 Ga0207680_10057363 3300025903 Bacteria 2356
178 Ga0207684_10031839 3300025910 Bacteria 4487
179 Ga0207695_10085161 3300025913 Bacteria 3190
180 Ga0207693_10031152 3300025915 Bacteria 4214
181 Ga0207693_10077483 3300025915 Bacteria 2603
182 Ga0207663_10085088 3300025916 Bacteria 2081
183 Ga0207662_10013341 3300025918 Bacteria 4595
184 Ga0207657_10001395 3300025919 Bacteria 25756
185 Ga0207649_10443715 3300025920 Bacteria 978
186 Ga0207652_10171965 3300025921 Bacteria 1944
187 Ga0207646_10408627 3300025922 Bacteria 1226
188 Ga0207681_10146744 3300025923 Bacteria 1763
189 Ga0207694_10270016 3300025924 Bacteria 1395
190 Ga0207659_10000204 3300025926 Bacteria 35509
191 Ga0207659_10120382 3300025926 Bacteria 2011
192 Ga0207687_10002914 3300025927 Bacteria 11611
193 Ga0207687_10003878 3300025927 Bacteria 10039
194 Ga0207687_10016582 3300025927 Bacteria 4839
195 Ga0207644_10000730 3300025931 Bacteria 20840
196 Ga0207644_10005984 3300025931 Bacteria 7928
197 Ga0207706_10020278 3300025933 Bacteria 5975
198 Ga0207706_10120028 3300025933 Bacteria 2311
199 Ga0207706_10162258 3300025933 Bacteria 1964
200 Ga0207686_10000362 3300025934 Bacteria 32004
201 Ga0207709_10021554 3300025935 Bacteria 3649
202 Ga0207670_10001304 3300025936 Bacteria 13159
203 Ga0207670_10009452 3300025936 Bacteria 5564
204 Ga0207669_10062261 3300025937 Bacteria 2297
205 Ga0207704_10134102 3300025938 Bacteria 1720
206 Ga0207691_10023343 3300025940 Bacteria 5822
207 Ga0207691_10036067 3300025940 Bacteria 4583
208 Ga0207691_10040567 3300025940 Bacteria 4300
209 Ga0207691_10122637 3300025940 Bacteria 2301
210 Ga0207711_10000164 3300025941 Bacteria 71542
211 Ga0207711_10556664 3300025941 Bacteria 1070
212 Ga0207689_10032911 3300025942 Bacteria 4309
213 Ga0207689_10033170 3300025942 Bacteria 4291
214 Ga0207689_10243558 3300025942 Bacteria 1486
215 Ga0207679_10139547 3300025945 Bacteria 1957
216 Ga0207667_10054701 3300025949 Bacteria 4198
217 Ga0207667_10227305 3300025949 Bacteria 1911
218 Ga0207651_10001215 3300025960 Bacteria 11544
219 Ga0207651_10002573 3300025960 Bacteria 8666
220 Ga0207651_10050585 3300025960 Bacteria 2822
221 Ga0207712_10354346 3300025961 Bacteria 1221
222 Ga0207640_10556888 3300025981 Bacteria 964
223 Ga0207658_10001441 3300025986 Bacteria 18547
224 Ga0207658_10012245 3300025986 Bacteria 5854
225 Ga0207677_10000092 3300026023 Bacteria 73792
226 Ga0207677_10005547 3300026023 Bacteria 6857
227 Ga0207677_10025142 3300026023 Bacteria 3710
228 Ga0207677_10550677 3300026023 Bacteria 1005
229 Ga0207703_10001684 3300026035 Bacteria 19879
230 Ga0207703_10003576 3300026035 Bacteria 12988
231 Ga0207703_10011028 3300026035 Bacteria 7042
232 Ga0207703_10220883 3300026035 Bacteria 1694
233 Ga0207639_10512809 3300026041 Bacteria 1097
234 Ga0207678_10036823 3300026067 Bacteria 4259
235 Ga0207708_10014710 3300026075 Bacteria 5857
236 Ga0207702_10042911 3300026078 Bacteria 3795
237 Ga0207702_10169502 3300026078 Bacteria 2001
238 Ga0207641_10003140 3300026088 Bacteria 14836
239 Ga0207641_10005675 3300026088 Bacteria 10620
240 Ga0207641_10022128 3300026088 Bacteria 5231
241 Ga0207641_10080649 3300026088 Bacteria 2824
242 Ga0207648_10005377 3300026089 Bacteria 12911
243 Ga0207648_10031475 3300026089 Bacteria 4691
244 Ga0207648_10056724 3300026089 Bacteria 3418
245 Ga0207648_10115490 3300026089 Bacteria 2359
246 Ga0207648_10465601 3300026089 Bacteria 1153
247 Ga0207676_10000121 3300026095 Bacteria 68688
248 Ga0207676_10000459 3300026095 Bacteria 34117
249 Ga0207676_10031138 3300026095 Bacteria 4010
250 Ga0207674_10016595 3300026116 Bacteria 8052
251 Ga0207675_100075529 3300026118 Bacteria 3155
252 Ga0207675_100539841 3300026118 Bacteria 1164
253 Ga0207683_10000281 3300026121 Bacteria 45555
254 Ga0207683_10019913 3300026121 Bacteria 5734
255 Ga0207683_10136369 3300026121 Bacteria 2209
256 Ga0209974_10009647 3300027876 Bacteria 3275
257 Ga0268266_10021698 3300028379 Bacteria 5472
258 Ga0268266_10200405 3300028379 Bacteria 1826
259 Ga0268264_10000837 3300028381 Bacteria 32905
260 Ga0268264_10034523 3300028381 Bacteria 4161
261 Ga0268264_10041138 3300028381 Bacteria 3821
262 Ga0268264_10059127 3300028381 Bacteria 3211
263 Ga0268264_10150118 3300028381 Bacteria 2088
264 Ga0307515_10004453 3300028794 Bacteria 29008
265 Ga0307515_10015097 3300028794 Bacteria 14257
266 Ga0307515_10049030 3300028794 Bacteria 6370
267 Ga0307515_10102917 3300028794 Bacteria 3429
268 Ga0307515_10112496 3300028794 Bacteria 3166
269 Ga0307515_10189173 3300028794 Bacteria 1976
270 Ga0307512_10015064 3300030522 Bacteria 7186
271 Ga0307513_10004737 3300031456 Bacteria 18072
272 Ga0307513_10051293 3300031456 Bacteria 4452
273 Ga0307513_10185337 3300031456 Bacteria 1939
274 Ga0307513_10397633 3300031456 Bacteria 1113
275 Ga0307509_10007099 3300031507 Bacteria 14778
276 Ga0307509_10081666 3300031507 Bacteria 3338
277 Ga0307508_10000450 3300031616 Bacteria 49283
278 Ga0307508_10201547 3300031616 Bacteria 1590
279 Ga0307405_10068393 3300031731 Bacteria 2273
280 Ga0307410_10183699 3300031852 Bacteria 1585
281 Ga0307411_10023739 3300032005 Bacteria 3640
282 Ga0307507_10060022 3300033179 Bacteria 3555
283 Ga0307507_10160736 3300033179 Bacteria 1661
284 Ga0373926_0106435 3300035083 Bacteria 1052
285 Ga0373923_0015087 3300035111 Bacteria 2912
286 Ga0373932_0014655 3300035112 Bacteria 1975
287 Ga0373936_0000019 3300035113 Bacteria 146661
288 Ga0373936_0116223 3300035113 Bacteria 1139
289 Ga0373945_0020366 3300035116 Bacteria 2269
290 Ga0373945_0056089 3300035116 Bacteria 1460
291 Ga0373953_0089643 3300035117 Bacteria 1285
292 Ga0373954_0023873 3300035118 Bacteria 2785
293 Ga0373954_0080676 3300035118 Bacteria 1554
294 Ga0373956_0185762 3300035119 Bacteria 983
295 Ga0373957_0074464 3300035120 Bacteria 1333
296 Ga0373943_0061181 3300035170 Bacteria 1881
297 Ga0373955_0022164 3300035172 Bacteria 3218
298 Ga0373924_0007292 3300035410 Bacteria 3987
299 Ga0373931_0042202 3300035691 Bacteria 2398
300 Ga0373931_0137794 3300035691 Bacteria 1411
301 Ga0373935_0101357 3300035692 Bacteria 1898
302 Ga0373935_0116942 3300035692 Bacteria 1776
303 Ga0373927_0026990 3300035695 Bacteria 3752
304 Ga0373933_0114404 3300035724 Bacteria 1685
305 Ga0373947_0029907 3300035725 Bacteria 3197
306 Ga0373937_0041755 3300036401 Bacteria 4184
307 Ga0373925_0022320 3300037068 Bacteria 4616
308 Ga0373925_0031332 3300037068 Bacteria 3907
309 Ga0395900_0041299 3300037418 Bacteria 4755
310 Ga0395900_0120076 3300037418 Bacteria 2697
311 Ga0395905_0084070 3300037471 Bacteria 2981
312 Ga0395901_0002929 3300038443 Bacteria 17225
313 Ga0395901_0021600 3300038443 Bacteria 6594
314 Ga0451577_0323900 3300042876 Bacteria 1398
315 Ga0453684_0425355 3300044712 Bacteria 1483
316 Ga0495617_082689 3300046452 Bacteria 1051
317 Ga0495627_070589 3300046453 Bacteria 1021
318 Ga0495603_0010787 3300046455 Bacteria 5542
319 Ga0495590_0000049 3300046457 Bacteria 113002
320 Ga0495591_000456 3300046458 Bacteria 33134
321 Ga0495591_008412 3300046458 Bacteria 4229
322 Ga0495629_0093716 3300046459 Bacteria 2095
323 Ga0495638_0095671 3300046460 Bacteria 1783
324 Ga0495651_0304842 3300046462 Bacteria 1067
325 Ga0495650_0013436 3300046471 Bacteria 4327
326 Ga0495650_0015125 3300046471 Bacteria 3974
327 Ga0495650_0037173 3300046471 Bacteria 2123
328 Ga0495650_0057806 3300046471 Bacteria 1568
329 Ga0495582_0021966 3300046473 Bacteria 3491
330 Ga0495605_0004449 3300046474 Bacteria 8232
331 Ga0495605_0017358 3300046474 Bacteria 3878
332 Ga0495605_0073494 3300046474 Bacteria 1610
333 Ga0495664_0025205 3300046477 Bacteria 3462
334 Ga0495584_0000189 3300046491 Bacteria 43548
335 Ga0495585_0017270 3300046492 Bacteria 4171
336 Ga0495594_0048656 3300046499 Bacteria 2330
337 Ga0495596_0006008 3300046500 Bacteria 5663
338 Ga0495596_0032691 3300046500 Bacteria 2073
339 Ga0495596_0043415 3300046500 Bacteria 1771
340 Ga0495596_0076666 3300046500 Bacteria 1298
341 Ga0495607_0015230 3300046501 Bacteria 4987
342 Ga0495583_0003414 3300046506 Bacteria 12113
343 Ga0495583_0012949 3300046506 Bacteria 4685
344 Ga0495583_0029206 3300046506 Bacteria 2700
345 Ga0495583_0088394 3300046506 Bacteria 1337
346 Ga0495606_0042210 3300046507 Bacteria 3052
347 Ga0495606_0143768 3300046507 Bacteria 1406
348 Ga0495610_0000442 3300046512 Bacteria 42791
349 Ga0495610_0065633 3300046512 Bacteria 1712
350 Ga0495616_0000817 3300046513 Bacteria 22704
351 Ga0495616_0004191 3300046513 Bacteria 9137
352 Ga0495616_0013856 3300046513 Bacteria 4532
353 Ga0495616_0018960 3300046513 Bacteria 3762
354 Ga0495630_0042706 3300046517 Bacteria 3386
355 Ga0495631_0000806 3300046518 Bacteria 20012
356 Ga0495631_0026610 3300046518 Bacteria 2653
357 Ga0495632_0000887 3300046519 Bacteria 26268
358 Ga0495632_0001176 3300046519 Bacteria 22267
359 Ga0495632_0015276 3300046519 Bacteria 4314
360 Ga0495632_0024329 3300046519 Bacteria 3218
361 Ga0495637_0000014 3300046520 Bacteria 228956
362 Ga0495643_0061650 3300046522 Bacteria 1988
363 Ga0495643_0086164 3300046522 Bacteria 1627
364 Ga0495644_0015536 3300046523 Bacteria 2915
365 Ga0495644_0030892 3300046523 Bacteria 2022
366 Ga0495648_0008778 3300046524 Bacteria 7910
367 Ga0495648_0123841 3300046524 Bacteria 1384
368 Ga0495666_0143201 3300046526 Bacteria 1113
369 Ga0495642_0000657 3300046528 Bacteria 17307
370 Ga0495642_0007115 3300046528 Bacteria 4291
371 Ga0495642_0023993 3300046528 Bacteria 2411
372 Ga0495642_0083866 3300046528 Bacteria 1344
373 Ga0495642_0102234 3300046528 Bacteria 1220
374 Ga0495654_0001281 3300046530 Bacteria 17634
375 Ga0495665_0041330 3300046531 Bacteria 2454
376 Ga0495640_0122753 3300046533 Bacteria 1687
377 Ga0495586_0033174 3300046535 Bacteria 2770
378 Ga0495586_0097974 3300046535 Bacteria 1625
379 Ga0495587_0040080 3300046536 Bacteria 2801
380 Ga0495609_0000240 3300046538 Bacteria 52192
381 Ga0495597_0002422 3300046542 Bacteria 11860
382 Ga0495645_0055580 3300046543 Bacteria 2874
383 Ga0495633_0001204 3300046558 Bacteria 20815
384 Ga0495668_0010699 3300046616 Bacteria 5541
385 Ga0495668_0012900 3300046616 Bacteria 4948
386 Ga0495668_0049175 3300046616 Bacteria 2338
387 Ga0495668_0076296 3300046616 Bacteria 1840
388 Ga0495611_0000377 3300046648 Bacteria 28700
389 Ga0495611_0019460 3300046648 Bacteria 2916
390 Ga0495625_0021869 3300046660 Bacteria 4912
391 Ga0495635_0013199 3300046663 Bacteria 5783
392 Ga0495659_0014687 3300046664 Bacteria 2567
393 Ga0495661_0004577 3300046665 Bacteria 9958
394 Ga0495661_0111122 3300046665 Bacteria 1527
395 Ga0495623_0193887 3300046679 Bacteria 1172
396 Ga0495647_0046175 3300046681 Bacteria 1676
397 Ga0495658_0080313 3300046683 Bacteria 1912
398 Ga0495669_0000003 3300046684 Bacteria 267741
399 Ga0495669_0003437 3300046684 Bacteria 6523
400 Ga0495669_0066496 3300046684 Bacteria 1637
401 Ga0495624_0133302 3300046690 Bacteria 1523
402 Ga0495649_0000255 3300046694 Bacteria 47515
403 Ga0495649_0034090 3300046694 Bacteria 2802
404 Ga0495649_0035151 3300046694 Bacteria 2756
405 Ga0495589_0000712 3300046794 Bacteria 21540
406 Ga0495589_0004208 3300046794 Bacteria 7697
407 Ga0495600_0075243 3300046809 Bacteria 2205
408 Ga0495660_0010676 3300046810 Bacteria 5337
409 Ga0495660_0012630 3300046810 Bacteria 4901
410 Ga0495660_0031911 3300046810 Bacteria 2959
411 Ga0495581_0003572 3300047315 Bacteria 8934
412 Ga0495604_0088861 3300047317 Bacteria 2298
413 Ga0495636_0006874 3300047318 Bacteria 4474
414 Ga0495672_0000102 3300047320 Bacteria 137373
415 Ga0495683_0000833 3300047323 Bacteria 21993
416 Ga0495687_000410 3300047443 Bacteria 53080
417 Ga0495687_001323 3300047443 Bacteria 23117
418 Ga0495687_002333 3300047443 Bacteria 15437
419 Ga0495677_0001277 3300047445 Bacteria 10054
420 Ga0495685_001482 3300047447 Bacteria 7187
421 Ga0495685_045200 3300047447 Bacteria 1500
422 Ga0495681_0001235 3300047470 Bacteria 19424
423 Ga0495681_0001809 3300047470 Bacteria 15721
424 Ga0495681_0005375 3300047470 Bacteria 8591
425 Ga0495681_0008325 3300047470 Bacteria 6511
426 Ga0495681_0133011 3300047470 Bacteria 1057
427 Ga0495686_0002274 3300047472 Bacteria 18494
428 Ga0495614_0010684 3300048089 Bacteria 4046
429 Ga0495626_0052825 3300048091 Bacteria 1872
430 Ga0496100_0005318 3300048903 Bacteria 6919
431 Ga0496102_0014323 3300048905 Bacteria 6888
432 Ga0496102_0063193 3300048905 Bacteria 3389
433 Ga0496103_0137879 3300048906 Bacteria 1559
434 Ga0496103_0146883 3300048906 Bacteria 1510
435 Ga0496104_0004782 3300048907 Bacteria 11795
436 Ga0496104_0050757 3300048907 Bacteria 3914
437 Ga0496105_0011354 3300048908 Bacteria 7035
438 Ga0496107_0120460 3300048910 Bacteria 1933
439 Ga0496109_0015165 3300048912 Bacteria 6708
440 Ga0496109_0226492 3300048912 Bacteria 1759
441 Ga0496109_0339193 3300048912 Bacteria 1419
442 Ga0496110_0005159 3300048913 Bacteria 10211
443 Ga0496110_0021666 3300048913 Bacteria 5446
444 Ga0496111_0004659 3300048914 Bacteria 8688
445 Ga0496111_0162107 3300048914 Bacteria 1660
446 Ga0496112_0000172 3300048915 Bacteria 41326
447 Ga0496112_0065635 3300048915 Bacteria 3582
448 Ga0496115_0013465 3300048918 Bacteria 6188
449 Ga0496121_0287846 3300048924 Bacteria 1121
450 Ga0496122_0184795 3300048925 Bacteria 1238
451 Ga0496124_0174470 3300048927 Bacteria 1661
452 Ga0495678_000150 3300049459 Bacteria 84562
453 Ga0495678_000662 3300049459 Bacteria 31617
454 Ga0495678_001529 3300049459 Bacteria 17867
455 Ga0495678_002016 3300049459 Bacteria 14566
456 Ga0495678_047022 3300049459 Bacteria 1692
457 Ga0495678_070927 3300049459 Bacteria 1277
458 Ga0495682_0000494 3300049460 Bacteria 27318
459 Ga0495682_0006847 3300049460 Bacteria 4588
460 Ga0495682_0036638 3300049460 Bacteria 1805
461 Ga0495682_0067228 3300049460 Bacteria 1291
462 Ga0501313_007110 3300049529 Bacteria 1229
463 Ga0501031_0055742 3300049568 Bacteria 2575
464 Ga0501047_0211112 3300049581 Bacteria 1800
465 Ga0501068_0026910 3300049584 Bacteria 3392
466 Ga0501069_0054077 3300049585 Bacteria 2236
467 Ga0501070_0004881 3300049586 Bacteria 11457
468 Ga0501070_0079847 3300049586 Bacteria 2707
469 Ga0501073_0001929 3300049589 Bacteria 15435
470 Ga0501073_0020452 3300049589 Bacteria 4773
471 Ga0501074_0002608 3300049590 Bacteria 12604
472 Ga0501074_0137685 3300049590 Bacteria 1747
473 Ga0501080_0025426 3300049742 Bacteria 5495
474 Ga0501080_0032770 3300049742 Bacteria 4847
475 Ga0501080_0069978 3300049742 Bacteria 3263
476 Ga0501080_0472776 3300049742 Bacteria 1122
477 Ga0501083_0002037 3300049744 Bacteria 13911
478 Ga0501083_0093632 3300049744 Bacteria 1984
479 Ga0501045_0049244 3300049824 Bacteria 3072
480 nmdc:mga0k408_294973_c1 3300050493 Bacteria 968
481 nmdc:mga0k408_65546_c1 3300050493 Bacteria 2114
482 nmdc:mga0k408_9417_c1 3300050493 Bacteria 5263
483 nmdc:mga0rr50_142196_c1 3300050513 Bacteria 1931
484 Ga0495612_0070085 3300053078 Bacteria 1461
485 Ga0495619_0018912 3300053085 Bacteria 4374
486 Ga0500641_0028642 3300053096 Bacteria 2177
487 Ga0500564_089894 3300053138 Bacteria 1368
488 Ga0500587_004045 3300053739 Bacteria 2025
489 Ga0501084_0106023 3300054114 Bacteria 2361
490 Ga0501082_0162645 3300060353 Bacteria 1940

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050493 nmdc:mga0k408_294973_c1 nmdc:mga0k408_294973_c1_30_794 231
2 3300049744 Ga0501083_0093632 Ga0501083_0093632_41_811 236
3 3300006038 Ga0075365_10206125 Ga0075365_102061252 244
4 3300046453 Ga0495627_070589 Ga0495627_070589_155_964 244
5 3300005842 Ga0068858_100248899 Ga0068858_1002488992 246
6 3300028794 Ga0307515_10102917 Ga0307515_101029173 246
7 3300046522 Ga0495643_0061650 Ga0495643_0061650_555_1415 246
8 3300046660 Ga0495625_0021869 Ga0495625_0021869_761_1621 246
9 3300028794 Ga0307515_10015097 Ga0307515_1001509715 247
10 3300031456 Ga0307513_10051293 Ga0307513_100512932 247
11 3300035113 Ga0373936_0000019 Ga0373936_0000019_36416_37330 247
12 3300006051 Ga0075364_10002745 Ga0075364_1000274510 248
13 3300006186 Ga0075369_10008272 Ga0075369_100082722 248
14 3300006195 Ga0075366_10002720 Ga0075366_100027202 248
15 3300026035 Ga0207703_10220883 Ga0207703_102208832 248
16 3300046512 Ga0495610_0065633 Ga0495610_0065633_309_1169 248
17 3300046519 Ga0495632_0015276 Ga0495632_0015276_1451_2311 248
18 3300050493 nmdc:mga0k408_9417_c1 nmdc:mga0k408_9417_c1_460_1299 248
19 3300053739 Ga0500587_004045 Ga0500587_004045_432_1292 248
20 3300005841 Ga0068863_100483666 Ga0068863_1004836661 250
21 3300048914 Ga0496111_0162107 Ga0496111_0162107_485_1351 251
22 3300049584 Ga0501068_0026910 Ga0501068_0026910_542_1399 251
23 3300049586 Ga0501070_0079847 Ga0501070_0079847_1023_1880 251
24 3300049589 Ga0501073_0020452 Ga0501073_0020452_984_1841 251
25 3300049590 Ga0501074_0137685 Ga0501074_0137685_271_1128 251
26 3300049742 Ga0501080_0025426 Ga0501080_0025426_1861_2718 251
27 3300054114 Ga0501084_0106023 Ga0501084_0106023_1340_2197 251
28 3300026118 Ga0207675_100539841 Ga0207675_1005398412 253
29 3300005548 Ga0070665_100074027 Ga0070665_1000740272 254
30 3300005841 Ga0068863_100071639 Ga0068863_1000716392 254
31 3300006237 Ga0097621_100456961 Ga0097621_1004569611 254
32 3300009177 Ga0105248_10589438 Ga0105248_105894382 254
33 3300014968 Ga0157379_10174199 Ga0157379_101741992 254
34 3300026035 Ga0207703_10011028 Ga0207703_100110284 254
35 3300026088 Ga0207641_10080649 Ga0207641_100806493 254
36 3300031852 Ga0307410_10183699 Ga0307410_101836992 254
37 3300032005 Ga0307411_10023739 Ga0307411_100237392 254
38 3300047443 Ga0495687_001323 Ga0495687_001323_717_1556 254
39 3300048091 Ga0495626_0052825 Ga0495626_0052825_676_1515 254
40 3300048907 Ga0496104_0050757 Ga0496104_0050757_1363_2313 254
41 3300048912 Ga0496109_0339193 Ga0496109_0339193_255_1205 254
42 3300048914 Ga0496111_0004659 Ga0496111_0004659_2300_3250 254
43 3300013308 Ga0157375_10112478 Ga0157375_101124784 255
44 3300031456 Ga0307513_10004737 Ga0307513_100047372 255
45 3300044712 Ga0453684_0425355 Ga0453684_0425355_310_1149 255
46 3300014969 Ga0157376_10115241 Ga0157376_101152413 256
47 3300028381 Ga0268264_10059127 Ga0268264_100591272 256
48 3300042876 Ga0451577_0323900 Ga0451577_0323900_352_1197 256
49 3300049529 Ga0501313_007110 Ga0501313_007110_343_1200 256
50 3300005330 Ga0070690_100000556 Ga0070690_1000005568 257
51 3300005335 Ga0070666_10004185 Ga0070666_100041856 257
52 3300005338 Ga0068868_100001860 Ga0068868_1000018608 257
53 3300005340 Ga0070689_100005236 Ga0070689_1000052367 257
54 3300005343 Ga0070687_100014545 Ga0070687_1000145452 257
55 3300005354 Ga0070675_100173019 Ga0070675_1001730192 257
56 3300005355 Ga0070671_100007172 Ga0070671_1000071722 257
57 3300005364 Ga0070673_100000463 Ga0070673_10000046310 257
58 3300005364 Ga0070673_100018977 Ga0070673_1000189775 257
59 3300005365 Ga0070688_100000789 Ga0070688_10000078911 257
60 3300005367 Ga0070667_100007690 Ga0070667_1000076908 257
61 3300005434 Ga0070709_10057610 Ga0070709_100576102 257
62 3300005436 Ga0070713_100067320 Ga0070713_1000673202 257
63 3300005437 Ga0070710_10009223 Ga0070710_100092234 257
64 3300005438 Ga0070701_10182996 Ga0070701_101829961 257
65 3300005439 Ga0070711_100003838 Ga0070711_1000038388 257
66 3300005466 Ga0070685_10001482 Ga0070685_1000148211 257
67 3300005543 Ga0070672_100025360 Ga0070672_1000253604 257
68 3300005544 Ga0070686_100105167 Ga0070686_1001051672 257
69 3300005548 Ga0070665_100001903 Ga0070665_1000019031 257
70 3300005617 Ga0068859_100000849 Ga0068859_10000084910 257
71 3300005618 Ga0068864_100004136 Ga0068864_1000041362 257
72 3300005841 Ga0068863_100002625 Ga0068863_10000262512 257
73 3300005842 Ga0068858_100004378 Ga0068858_1000043788 257
74 3300005843 Ga0068860_100030877 Ga0068860_1000308774 257
75 3300006163 Ga0070715_10033974 Ga0070715_100339742 257
76 3300006358 Ga0068871_100059282 Ga0068871_1000592823 257
77 3300006871 Ga0075434_100158687 Ga0075434_1001586872 257
78 3300006931 Ga0097620_100000849 Ga0097620_10000084921 257
79 3300007076 Ga0075435_100148347 Ga0075435_1001483471 257
80 3300009098 Ga0105245_10003896 Ga0105245_100038966 257
81 3300009101 Ga0105247_10015842 Ga0105247_100158422 257
82 3300009177 Ga0105248_10175034 Ga0105248_101750342 257
83 3300009551 Ga0105238_10046326 Ga0105238_100463263 257
84 3300011119 Ga0105246_10026028 Ga0105246_100260282 257
85 3300013296 Ga0157374_10000101 Ga0157374_1000010116 257
86 3300013297 Ga0157378_10010931 Ga0157378_100109312 257
87 3300013306 Ga0163162_10004614 Ga0163162_100046147 257
88 3300013308 Ga0157375_10005750 Ga0157375_100057503 257
89 3300014325 Ga0163163_10009687 Ga0163163_100096875 257
90 3300014968 Ga0157379_10007662 Ga0157379_100076627 257
91 3300014969 Ga0157376_10002075 Ga0157376_1000207510 257
92 3300025903 Ga0207680_10000645 Ga0207680_100006455 257
93 3300025915 Ga0207693_10031152 Ga0207693_100311523 257
94 3300025916 Ga0207663_10085088 Ga0207663_100850882 257
95 3300025918 Ga0207662_10013341 Ga0207662_100133413 257
96 3300025924 Ga0207694_10270016 Ga0207694_102700161 257
97 3300025926 Ga0207659_10120382 Ga0207659_101203822 257
98 3300025927 Ga0207687_10002914 Ga0207687_100029145 257
99 3300025931 Ga0207644_10005984 Ga0207644_100059843 257
100 3300025933 Ga0207706_10020278 Ga0207706_100202782 257
101 3300025936 Ga0207670_10001304 Ga0207670_100013046 257
102 3300025940 Ga0207691_10040567 Ga0207691_100405673 257
103 3300025940 Ga0207691_10122637 Ga0207691_101226372 257
104 3300025941 Ga0207711_10000164 Ga0207711_1000016410 257
105 3300025960 Ga0207651_10001215 Ga0207651_100012155 257
106 3300025960 Ga0207651_10050585 Ga0207651_100505852 257
107 3300025986 Ga0207658_10012245 Ga0207658_100122452 257
108 3300026023 Ga0207677_10000092 Ga0207677_1000009260 257
109 3300026035 Ga0207703_10001684 Ga0207703_100016846 257
110 3300026078 Ga0207702_10169502 Ga0207702_101695022 257
111 3300026088 Ga0207641_10005675 Ga0207641_100056751 257
112 3300026095 Ga0207676_10000121 Ga0207676_1000012132 257
113 3300028379 Ga0268266_10021698 Ga0268266_100216985 257
114 3300028381 Ga0268264_10000837 Ga0268264_100008376 257
115 3300028794 Ga0307515_10112496 Ga0307515_101124962 257
116 3300031456 Ga0307513_10397633 Ga0307513_103976332 257
117 3300035083 Ga0373926_0106435 Ga0373926_0106435_123_968 257
118 3300035111 Ga0373923_0015087 Ga0373923_0015087_191_1036 257
119 3300035113 Ga0373936_0116223 Ga0373936_0116223_112_957 257
120 3300035116 Ga0373945_0020366 Ga0373945_0020366_1003_1848 257
121 3300035117 Ga0373953_0089643 Ga0373953_0089643_175_1020 257
122 3300035118 Ga0373954_0023873 Ga0373954_0023873_1755_2600 257
123 3300035118 Ga0373954_0080676 Ga0373954_0080676_507_1352 257
124 3300035119 Ga0373956_0185762 Ga0373956_0185762_95_940 257
125 3300035120 Ga0373957_0074464 Ga0373957_0074464_217_1062 257
126 3300035170 Ga0373943_0061181 Ga0373943_0061181_608_1453 257
127 3300035172 Ga0373955_0022164 Ga0373955_0022164_222_1067 257
128 3300035410 Ga0373924_0007292 Ga0373924_0007292_244_1089 257
129 3300035691 Ga0373931_0137794 Ga0373931_0137794_141_986 257
130 3300035692 Ga0373935_0101357 Ga0373935_0101357_726_1571 257
131 3300035692 Ga0373935_0116942 Ga0373935_0116942_853_1698 257
132 3300035724 Ga0373933_0114404 Ga0373933_0114404_575_1420 257
133 3300035725 Ga0373947_0029907 Ga0373947_0029907_1623_2468 257
134 3300036401 Ga0373937_0041755 Ga0373937_0041755_1984_2829 257
135 3300037068 Ga0373925_0022320 Ga0373925_0022320_3449_4294 257
136 3300046459 Ga0495629_0093716 Ga0495629_0093716_908_1753 257
137 3300046462 Ga0495651_0304842 Ga0495651_0304842_200_1045 257
138 3300046473 Ga0495582_0021966 Ga0495582_0021966_703_1548 257
139 3300046477 Ga0495664_0025205 Ga0495664_0025205_831_1676 257
140 3300046499 Ga0495594_0048656 Ga0495594_0048656_961_1806 257
141 3300046517 Ga0495630_0042706 Ga0495630_0042706_581_1426 257
142 3300046531 Ga0495665_0041330 Ga0495665_0041330_626_1471 257
143 3300046533 Ga0495640_0122753 Ga0495640_0122753_223_1068 257
144 3300046535 Ga0495586_0097974 Ga0495586_0097974_354_1199 257
145 3300046536 Ga0495587_0040080 Ga0495587_0040080_866_1711 257
146 3300046543 Ga0495645_0055580 Ga0495645_0055580_1502_2347 257
147 3300046663 Ga0495635_0013199 Ga0495635_0013199_2419_3264 257
148 3300046679 Ga0495623_0193887 Ga0495623_0193887_161_1006 257
149 3300046681 Ga0495647_0046175 Ga0495647_0046175_159_1004 257
150 3300046683 Ga0495658_0080313 Ga0495658_0080313_159_1004 257
151 3300046809 Ga0495600_0075243 Ga0495600_0075243_676_1521 257
152 3300047315 Ga0495581_0003572 Ga0495581_0003572_4723_5568 257
153 3300048089 Ga0495614_0010684 Ga0495614_0010684_852_1697 257
154 3300048903 Ga0496100_0005318 Ga0496100_0005318_4529_5374 257
155 3300048907 Ga0496104_0004782 Ga0496104_0004782_907_1752 257
156 3300048908 Ga0496105_0011354 Ga0496105_0011354_677_1522 257
157 3300048910 Ga0496107_0120460 Ga0496107_0120460_465_1310 257
158 3300048912 Ga0496109_0015165 Ga0496109_0015165_4674_5519 257
159 3300048915 Ga0496112_0000172 Ga0496112_0000172_13712_14557 257
160 3300048918 Ga0496115_0013465 Ga0496115_0013465_3573_4418 257
161 3300050513 nmdc:mga0rr50_142196_c1 nmdc:mga0rr50_142196_c1_340_1185 257
162 3300053078 Ga0495612_0070085 Ga0495612_0070085_357_1202 257
163 3300053085 Ga0495619_0018912 Ga0495619_0018912_1687_2532 257
164 3300005334 Ga0068869_100211372 Ga0068869_1002113721 258
165 3300005335 Ga0070666_10127108 Ga0070666_101271082 258
166 3300005336 Ga0070680_100018637 Ga0070680_1000186375 258
167 3300005337 Ga0070682_100020115 Ga0070682_1000201152 258
168 3300005338 Ga0068868_100199152 Ga0068868_1001991522 258
169 3300005339 Ga0070660_100008574 Ga0070660_1000085743 258
170 3300005344 Ga0070661_100016566 Ga0070661_1000165662 258
171 3300005345 Ga0070692_10007483 Ga0070692_100074834 258
172 3300005355 Ga0070671_100173783 Ga0070671_1001737832 258
173 3300005356 Ga0070674_100012875 Ga0070674_1000128753 258
174 3300005366 Ga0070659_100195556 Ga0070659_1001955562 258
175 3300005440 Ga0070705_100408939 Ga0070705_1004089391 258
176 3300005455 Ga0070663_100038978 Ga0070663_1000389782 258
177 3300005456 Ga0070678_100003701 Ga0070678_1000037012 258
178 3300005457 Ga0070662_100040493 Ga0070662_1000404933 258
179 3300005459 Ga0068867_100096535 Ga0068867_1000965352 258
180 3300005468 Ga0070707_100073845 Ga0070707_1000738452 258
181 3300005518 Ga0070699_100083396 Ga0070699_1000833962 258
182 3300005530 Ga0070679_100047595 Ga0070679_1000475953 258
183 3300005535 Ga0070684_100052968 Ga0070684_1000529683 258
184 3300005545 Ga0070695_100007028 Ga0070695_1000070283 258
185 3300005546 Ga0070696_100025968 Ga0070696_1000259682 258
186 3300005546 Ga0070696_100273179 Ga0070696_1002731792 258
187 3300005547 Ga0070693_100016005 Ga0070693_1000160052 258
188 3300005549 Ga0070704_100018383 Ga0070704_1000183832 258
189 3300005578 Ga0068854_100003266 Ga0068854_1000032668 258
190 3300005578 Ga0068854_100018348 Ga0068854_1000183482 258
191 3300005614 Ga0068856_100661151 Ga0068856_1006611512 258
192 3300005615 Ga0070702_100042486 Ga0070702_1000424862 258
193 3300005718 Ga0068866_10005817 Ga0068866_100058174 258
194 3300005719 Ga0068861_100064127 Ga0068861_1000641272 258
195 3300005834 Ga0068851_10055836 Ga0068851_100558362 258
196 3300006175 Ga0070712_100083417 Ga0070712_1000834172 258
197 3300006881 Ga0068865_100071552 Ga0068865_1000715522 258
198 3300009098 Ga0105245_10008880 Ga0105245_100088803 258
199 3300009176 Ga0105242_10030559 Ga0105242_100305594 258
200 3300009545 Ga0105237_10590438 Ga0105237_105904382 258
201 3300009551 Ga0105238_10114293 Ga0105238_101142932 258
202 3300010375 Ga0105239_10110858 Ga0105239_101108582 258
203 3300011119 Ga0105246_10036662 Ga0105246_100366621 258
204 3300013100 Ga0157373_10242720 Ga0157373_102427201 258
205 3300013104 Ga0157370_10083407 Ga0157370_100834073 258
206 3300013297 Ga0157378_10011929 Ga0157378_100119292 258
207 3300014969 Ga0157376_10199931 Ga0157376_101999312 258
208 3300025899 Ga0207642_10000954 Ga0207642_100009546 258
209 3300025903 Ga0207680_10057363 Ga0207680_100573632 258
210 3300025910 Ga0207684_10031839 Ga0207684_100318393 258
211 3300025913 Ga0207695_10085161 Ga0207695_100851612 258
212 3300025915 Ga0207693_10077483 Ga0207693_100774833 258
213 3300025919 Ga0207657_10001395 Ga0207657_100013959 258
214 3300025920 Ga0207649_10443715 Ga0207649_104437151 258
215 3300025922 Ga0207646_10408627 Ga0207646_104086272 258
216 3300025927 Ga0207687_10003878 Ga0207687_100038783 258
217 3300025933 Ga0207706_10120028 Ga0207706_101200282 258
218 3300025933 Ga0207706_10162258 Ga0207706_101622582 258
219 3300025934 Ga0207686_10000362 Ga0207686_100003627 258
220 3300025937 Ga0207669_10062261 Ga0207669_100622612 258
221 3300025942 Ga0207689_10033170 Ga0207689_100331702 258
222 3300025945 Ga0207679_10139547 Ga0207679_101395471 258
223 3300025949 Ga0207667_10227305 Ga0207667_102273051 258
224 3300025981 Ga0207640_10556888 Ga0207640_105568881 258
225 3300026023 Ga0207677_10550677 Ga0207677_105506771 258
226 3300026041 Ga0207639_10512809 Ga0207639_105128091 258
227 3300026067 Ga0207678_10036823 Ga0207678_100368232 258
228 3300026078 Ga0207702_10042911 Ga0207702_100429112 258
229 3300026089 Ga0207648_10115490 Ga0207648_101154902 258
230 3300026116 Ga0207674_10016595 Ga0207674_100165955 258
231 3300026121 Ga0207683_10000281 Ga0207683_1000028132 258
232 3300028381 Ga0268264_10041138 Ga0268264_100411382 258
233 3300035691 Ga0373931_0042202 Ga0373931_0042202_505_1356 258
234 3300046684 Ga0495669_0000003 Ga0495669_0000003_76058_76912 258
235 3300048905 Ga0496102_0063193 Ga0496102_0063193_1851_2696 258
236 3300048906 Ga0496103_0146883 Ga0496103_0146883_206_1051 258
237 3300048915 Ga0496112_0065635 Ga0496112_0065635_1003_1848 258
238 3300005331 Ga0070670_100114501 Ga0070670_1001145011 259
239 3300005335 Ga0070666_10004013 Ga0070666_100040133 259
240 3300005338 Ga0068868_100001782 Ga0068868_1000017826 259
241 3300005340 Ga0070689_100014610 Ga0070689_1000146103 259
242 3300005344 Ga0070661_100219480 Ga0070661_1002194802 259
243 3300005354 Ga0070675_100000866 Ga0070675_1000008668 259
244 3300005355 Ga0070671_100015965 Ga0070671_1000159656 259
245 3300005356 Ga0070674_100054392 Ga0070674_1000543924 259
246 3300005365 Ga0070688_100020322 Ga0070688_1000203223 259
247 3300005367 Ga0070667_100002208 Ga0070667_10000220810 259
248 3300005456 Ga0070678_100007865 Ga0070678_1000078656 259
249 3300005459 Ga0068867_100049798 Ga0068867_1000497983 259
250 3300005459 Ga0068867_100052950 Ga0068867_1000529502 259
251 3300005543 Ga0070672_100046989 Ga0070672_1000469892 259
252 3300005616 Ga0068852_100064415 Ga0068852_1000644151 259
253 3300005617 Ga0068859_100003928 Ga0068859_10000392810 259
254 3300005618 Ga0068864_100002466 Ga0068864_1000024666 259
255 3300005719 Ga0068861_100049269 Ga0068861_1000492692 259
256 3300005841 Ga0068863_100015509 Ga0068863_1000155096 259
257 3300005842 Ga0068858_100009190 Ga0068858_1000091906 259
258 3300005844 Ga0068862_100394558 Ga0068862_1003945582 259
259 3300006195 Ga0075366_10234701 Ga0075366_102347012 259
260 3300006358 Ga0068871_100040783 Ga0068871_1000407835 259
261 3300006931 Ga0097620_100003928 Ga0097620_10000392810 259
262 3300009177 Ga0105248_10118413 Ga0105248_101184132 259
263 3300013104 Ga0157370_10005376 Ga0157370_100053764 259
264 3300013296 Ga0157374_10071144 Ga0157374_100711443 259
265 3300013306 Ga0163162_10038948 Ga0163162_100389485 259
266 3300013306 Ga0163162_10297244 Ga0163162_102972442 259
267 3300013308 Ga0157375_10022507 Ga0157375_100225075 259
268 3300013308 Ga0157375_10170367 Ga0157375_101703673 259
269 3300014325 Ga0163163_10010019 Ga0163163_100100195 259
270 3300014968 Ga0157379_10013450 Ga0157379_100134505 259
271 3300025923 Ga0207681_10146744 Ga0207681_101467442 259
272 3300025926 Ga0207659_10000204 Ga0207659_1000020428 259
273 3300025931 Ga0207644_10000730 Ga0207644_1000073014 259
274 3300025936 Ga0207670_10009452 Ga0207670_100094523 259
275 3300025938 Ga0207704_10134102 Ga0207704_101341021 259
276 3300025940 Ga0207691_10023343 Ga0207691_100233433 259
277 3300025940 Ga0207691_10036067 Ga0207691_100360673 259
278 3300025942 Ga0207689_10032911 Ga0207689_100329114 259
279 3300025960 Ga0207651_10002573 Ga0207651_100025735 259
280 3300025961 Ga0207712_10354346 Ga0207712_103543462 259
281 3300025986 Ga0207658_10001441 Ga0207658_100014415 259
282 3300026023 Ga0207677_10005547 Ga0207677_100055473 259
283 3300026035 Ga0207703_10003576 Ga0207703_100035768 259
284 3300026088 Ga0207641_10003140 Ga0207641_100031403 259
285 3300026089 Ga0207648_10031475 Ga0207648_100314753 259
286 3300026089 Ga0207648_10056724 Ga0207648_100567242 259
287 3300026095 Ga0207676_10000459 Ga0207676_1000045924 259
288 3300026121 Ga0207683_10019913 Ga0207683_100199135 259
289 3300028794 Ga0307515_10004453 Ga0307515_1000445310 259
290 3300037471 Ga0395905_0084070 Ga0395905_0084070_391_1233 259
291 3300048912 Ga0496109_0226492 Ga0496109_0226492_505_1362 259
292 3300048913 Ga0496110_0021666 Ga0496110_0021666_349_1299 259
293 3300050493 nmdc:mga0k408_65546_c1 nmdc:mga0k408_65546_c1_406_1248 259
294 3300031616 Ga0307508_10201547 Ga0307508_102015472 260
295 3300049742 Ga0501080_0472776 Ga0501080_0472776_86_934 260
296 3300049824 Ga0501045_0049244 Ga0501045_0049244_1795_2643 260
297 3300005330 Ga0070690_100064684 Ga0070690_1000646841 261
298 3300005331 Ga0070670_100059016 Ga0070670_1000590162 261
299 3300005438 Ga0070701_10001887 Ga0070701_100018872 261
300 3300005441 Ga0070700_100051424 Ga0070700_1000514242 261
301 3300005459 Ga0068867_100009459 Ga0068867_1000094595 261
302 3300005459 Ga0068867_100216061 Ga0068867_1002160612 261
303 3300005544 Ga0070686_100038942 Ga0070686_1000389422 261
304 3300005546 Ga0070696_100092373 Ga0070696_1000923732 261
305 3300005615 Ga0070702_100005067 Ga0070702_1000050672 261
306 3300005718 Ga0068866_10048775 Ga0068866_100487752 261
307 3300005719 Ga0068861_100027238 Ga0068861_1000272383 261
308 3300005842 Ga0068858_100068343 Ga0068858_1000683432 261
309 3300005843 Ga0068860_100050288 Ga0068860_1000502882 261
310 3300006881 Ga0068865_100016550 Ga0068865_1000165504 261
311 3300009098 Ga0105245_10040577 Ga0105245_100405773 261
312 3300025899 Ga0207642_10029866 Ga0207642_100298663 261
313 3300025921 Ga0207652_10171965 Ga0207652_101719652 261
314 3300025935 Ga0207709_10021554 Ga0207709_100215542 261
315 3300025942 Ga0207689_10243558 Ga0207689_102435582 261
316 3300026075 Ga0207708_10014710 Ga0207708_100147102 261
317 3300026089 Ga0207648_10005377 Ga0207648_1000537710 261
318 3300026089 Ga0207648_10465601 Ga0207648_104656012 261
319 3300026118 Ga0207675_100075529 Ga0207675_1000755292 261
320 3300026121 Ga0207683_10136369 Ga0207683_101363691 261
321 3300028381 Ga0268264_10034523 Ga0268264_100345234 261
322 3300005338 Ga0068868_100009574 Ga0068868_1000095742 262
323 3300005355 Ga0070671_100084005 Ga0070671_1000840053 262
324 3300005548 Ga0070665_100166797 Ga0070665_1001667972 262
325 3300005564 Ga0070664_100244989 Ga0070664_1002449892 262
326 3300005618 Ga0068864_100041763 Ga0068864_1000417633 262
327 3300005841 Ga0068863_100024238 Ga0068863_1000242384 262
328 3300005843 Ga0068860_100065958 Ga0068860_1000659582 262
329 3300005843 Ga0068860_100157231 Ga0068860_1001572313 262
330 3300005844 Ga0068862_100312451 Ga0068862_1003124512 262
331 3300009098 Ga0105245_10044119 Ga0105245_100441192 262
332 3300009545 Ga0105237_10023895 Ga0105237_100238956 262
333 3300014325 Ga0163163_10067828 Ga0163163_100678283 262
334 3300014968 Ga0157379_10271323 Ga0157379_102713232 262
335 3300025927 Ga0207687_10016582 Ga0207687_100165825 262
336 3300026023 Ga0207677_10025142 Ga0207677_100251424 262
337 3300026088 Ga0207641_10022128 Ga0207641_100221282 262
338 3300026095 Ga0207676_10031138 Ga0207676_100311382 262
339 3300027876 Ga0209974_10009647 Ga0209974_100096474 262
340 3300028379 Ga0268266_10200405 Ga0268266_102004052 262
341 3300028381 Ga0268264_10150118 Ga0268264_101501182 262
342 3300028794 Ga0307515_10049030 Ga0307515_100490301 262
343 3300028794 Ga0307515_10189173 Ga0307515_101891732 262
344 3300030522 Ga0307512_10015064 Ga0307512_100150644 262
345 3300031456 Ga0307513_10185337 Ga0307513_101853372 262
346 3300031507 Ga0307509_10007099 Ga0307509_1000709912 262
347 3300031507 Ga0307509_10081666 Ga0307509_100816662 262
348 3300031616 Ga0307508_10000450 Ga0307508_1000045013 262
349 3300031731 Ga0307405_10068393 Ga0307405_100683932 262
350 3300033179 Ga0307507_10060022 Ga0307507_100600223 262
351 3300033179 Ga0307507_10160736 Ga0307507_101607361 262
352 3300035112 Ga0373932_0014655 Ga0373932_0014655_430_1293 262
353 3300035116 Ga0373945_0056089 Ga0373945_0056089_483_1352 262
354 3300035695 Ga0373927_0026990 Ga0373927_0026990_440_1309 262
355 3300037068 Ga0373925_0031332 Ga0373925_0031332_1924_2796 262
356 3300046471 Ga0495650_0013436 Ga0495650_0013436_3108_3965 262
357 3300046471 Ga0495650_0015125 Ga0495650_0015125_330_1187 262
358 3300046526 Ga0495666_0143201 Ga0495666_0143201_203_1087 262
359 3300046535 Ga0495586_0033174 Ga0495586_0033174_571_1440 262
360 3300047317 Ga0495604_0088861 Ga0495604_0088861_1118_1978 262
361 3300048924 Ga0496121_0287846 Ga0496121_0287846_188_1075 262
362 3300049459 Ga0495678_000662 Ga0495678_000662_8633_9490 262
363 3300049581 Ga0501047_0211112 Ga0501047_0211112_697_1548 262
364 3300053096 Ga0500641_0028642 Ga0500641_0028642_1062_1913 262
365 3300053138 Ga0500564_089894 Ga0500564_089894_407_1333 262
366 iso_pu_bacteria 2585428062 2587759067 262
367 3300005262 Ga0065165_1002482 Ga0065165_100248216 263
368 3300025941 Ga0207711_10556664 Ga0207711_105566641 263
369 3300037418 Ga0395900_0041299 Ga0395900_0041299_3629_4489 263
370 3300038443 Ga0395901_0021600 Ga0395901_0021600_1647_2507 263
371 3300046452 Ga0495617_082689 Ga0495617_082689_119_985 263
372 3300046455 Ga0495603_0010787 Ga0495603_0010787_3824_4702 263
373 3300046457 Ga0495590_0000049 Ga0495590_0000049_21812_22678 263
374 3300046458 Ga0495591_000456 Ga0495591_000456_10586_11452 263
375 3300046458 Ga0495591_008412 Ga0495591_008412_411_1280 263
376 3300046471 Ga0495650_0037173 Ga0495650_0037173_327_1193 263
377 3300046471 Ga0495650_0057806 Ga0495650_0057806_541_1407 263
378 3300046474 Ga0495605_0004449 Ga0495605_0004449_655_1533 263
379 3300046474 Ga0495605_0017358 Ga0495605_0017358_652_1518 263
380 3300046474 Ga0495605_0073494 Ga0495605_0073494_655_1524 263
381 3300046491 Ga0495584_0000189 Ga0495584_0000189_9072_9938 263
382 3300046492 Ga0495585_0017270 Ga0495585_0017270_767_1633 263
383 3300046500 Ga0495596_0006008 Ga0495596_0006008_4662_5540 263
384 3300046500 Ga0495596_0032691 Ga0495596_0032691_293_1162 263
385 3300046500 Ga0495596_0043415 Ga0495596_0043415_164_1030 263
386 3300046500 Ga0495596_0076666 Ga0495596_0076666_172_1038 263
387 3300046506 Ga0495583_0003414 Ga0495583_0003414_1131_1997 263
388 3300046506 Ga0495583_0029206 Ga0495583_0029206_1276_2142 263
389 3300046506 Ga0495583_0088394 Ga0495583_0088394_301_1170 263
390 3300046507 Ga0495606_0042210 Ga0495606_0042210_1985_2851 263
391 3300046507 Ga0495606_0143768 Ga0495606_0143768_243_1109 263
392 3300046512 Ga0495610_0000442 Ga0495610_0000442_12832_13698 263
393 3300046513 Ga0495616_0000817 Ga0495616_0000817_10296_11174 263
394 3300046513 Ga0495616_0004191 Ga0495616_0004191_355_1221 263
395 3300046513 Ga0495616_0013856 Ga0495616_0013856_3373_4242 263
396 3300046513 Ga0495616_0018960 Ga0495616_0018960_2656_3522 263
397 3300046518 Ga0495631_0000806 Ga0495631_0000806_17223_18089 263
398 3300046518 Ga0495631_0026610 Ga0495631_0026610_642_1508 263
399 3300046519 Ga0495632_0000887 Ga0495632_0000887_19882_20760 263
400 3300046519 Ga0495632_0001176 Ga0495632_0001176_656_1522 263
401 3300046519 Ga0495632_0024329 Ga0495632_0024329_131_997 263
402 3300046520 Ga0495637_0000014 Ga0495637_0000014_112017_112883 263
403 3300046522 Ga0495643_0086164 Ga0495643_0086164_417_1283 263
404 3300046523 Ga0495644_0015536 Ga0495644_0015536_1742_2611 263
405 3300046523 Ga0495644_0030892 Ga0495644_0030892_320_1186 263
406 3300046524 Ga0495648_0008778 Ga0495648_0008778_6799_7668 263
407 3300046524 Ga0495648_0123841 Ga0495648_0123841_44_910 263
408 3300046528 Ga0495642_0000657 Ga0495642_0000657_7057_7935 263
409 3300046528 Ga0495642_0007115 Ga0495642_0007115_3068_3934 263
410 3300046528 Ga0495642_0023993 Ga0495642_0023993_300_1166 263
411 3300046528 Ga0495642_0083866 Ga0495642_0083866_148_1017 263
412 3300046528 Ga0495642_0102234 Ga0495642_0102234_158_1024 263
413 3300046530 Ga0495654_0001281 Ga0495654_0001281_9365_10243 263
414 3300046542 Ga0495597_0002422 Ga0495597_0002422_4369_5235 263
415 3300046558 Ga0495633_0001204 Ga0495633_0001204_848_1714 263
416 3300046616 Ga0495668_0012900 Ga0495668_0012900_3323_4189 263
417 3300046616 Ga0495668_0049175 Ga0495668_0049175_727_1596 263
418 3300046616 Ga0495668_0076296 Ga0495668_0076296_798_1664 263
419 3300046648 Ga0495611_0000377 Ga0495611_0000377_11642_12508 263
420 3300046648 Ga0495611_0019460 Ga0495611_0019460_232_1101 263
421 3300046665 Ga0495661_0111122 Ga0495661_0111122_132_998 263
422 3300046684 Ga0495669_0066496 Ga0495669_0066496_555_1421 263
423 3300046694 Ga0495649_0000255 Ga0495649_0000255_20450_21316 263
424 3300046694 Ga0495649_0035151 Ga0495649_0035151_515_1381 263
425 3300046794 Ga0495589_0000712 Ga0495589_0000712_573_1439 263
426 3300046794 Ga0495589_0004208 Ga0495589_0004208_6512_7378 263
427 3300046810 Ga0495660_0010676 Ga0495660_0010676_2940_3809 263
428 3300046810 Ga0495660_0012630 Ga0495660_0012630_205_1071 263
429 3300046810 Ga0495660_0031911 Ga0495660_0031911_1273_2139 263
430 3300047320 Ga0495672_0000102 Ga0495672_0000102_23566_24432 263
431 3300047323 Ga0495683_0000833 Ga0495683_0000833_10674_11540 263
432 3300047443 Ga0495687_000410 Ga0495687_000410_31378_32244 263
433 3300047443 Ga0495687_002333 Ga0495687_002333_7019_7885 263
434 3300047445 Ga0495677_0001277 Ga0495677_0001277_182_1048 263
435 3300047447 Ga0495685_001482 Ga0495685_001482_1116_1985 263
436 3300047470 Ga0495681_0001235 Ga0495681_0001235_8738_9607 263
437 3300047470 Ga0495681_0001809 Ga0495681_0001809_13638_14504 263
438 3300047470 Ga0495681_0008325 Ga0495681_0008325_2914_3780 263
439 3300047470 Ga0495681_0133011 Ga0495681_0133011_80_946 263
440 3300047472 Ga0495686_0002274 Ga0495686_0002274_7086_7955 263
441 3300048905 Ga0496102_0014323 Ga0496102_0014323_679_1545 263
442 3300048906 Ga0496103_0137879 Ga0496103_0137879_22_888 263
443 3300048913 Ga0496110_0005159 Ga0496110_0005159_714_1580 263
444 3300048925 Ga0496122_0184795 Ga0496122_0184795_26_895 263
445 3300048927 Ga0496124_0174470 Ga0496124_0174470_470_1339 263
446 3300049459 Ga0495678_000150 Ga0495678_000150_10503_11369 263
447 3300049459 Ga0495678_001529 Ga0495678_001529_16416_17282 263
448 3300049459 Ga0495678_002016 Ga0495678_002016_6963_7829 263
449 3300049459 Ga0495678_047022 Ga0495678_047022_572_1441 263
450 3300049459 Ga0495678_070927 Ga0495678_070927_41_907 263
451 3300049460 Ga0495682_0000494 Ga0495682_0000494_22317_23183 263
452 3300049460 Ga0495682_0006847 Ga0495682_0006847_3447_4316 263
453 3300049460 Ga0495682_0036638 Ga0495682_0036638_564_1430 263
454 3300049460 Ga0495682_0067228 Ga0495682_0067228_259_1128 263
455 3300049585 Ga0501069_0054077 Ga0501069_0054077_1322_2173 263
456 3300049586 Ga0501070_0004881 Ga0501070_0004881_910_1761 263
457 3300049589 Ga0501073_0001929 Ga0501073_0001929_14484_15335 263
458 3300049590 Ga0501074_0002608 Ga0501074_0002608_11266_12117 263
459 3300049742 Ga0501080_0032770 Ga0501080_0032770_3278_4132 263
460 3300049742 Ga0501080_0069978 Ga0501080_0069978_884_1735 263
461 3300049744 Ga0501083_0002037 Ga0501083_0002037_12788_13639 263
462 3300060353 Ga0501082_0162645 Ga0501082_0162645_813_1664 263
463 3300003771 Ga0055526_1004060 Ga0055526_10040607 264
464 3300003773 Ga0055537_1000060 Ga0055537_100006061 264
465 3300003775 Ga0055524_1006567 Ga0055524_10065674 264
466 3300003784 Ga0055534_1000009 Ga0055534_1000009101 264
467 3300003790 Ga0055528_1000012 Ga0055528_100001279 264
468 3300003792 Ga0055540_1009756 Ga0055540_10097562 264
469 3300025263 Ga0209565_1000015 Ga0209565_1000015377 264
470 3300025273 Ga0209673_1000017 Ga0209673_1000017268 264
471 3300025291 Ga0209675_1000012 Ga0209675_1000012105 264
472 3300025295 Ga0209564_1000016 Ga0209564_1000016218 264
473 3300025299 Ga0209256_1000346 Ga0209256_100034626 264
474 3300025303 Ga0209051_1001760 Ga0209051_10017609 264
475 3300025949 Ga0207667_10054701 Ga0207667_100547014 264
476 3300037418 Ga0395900_0120076 Ga0395900_0120076_972_1841 264
477 3300038443 Ga0395901_0002929 Ga0395901_0002929_14331_15191 264
478 3300046460 Ga0495638_0095671 Ga0495638_0095671_570_1478 264
479 3300046501 Ga0495607_0015230 Ga0495607_0015230_586_1428 264
480 3300046506 Ga0495583_0012949 Ga0495583_0012949_3258_4100 264
481 3300046538 Ga0495609_0000240 Ga0495609_0000240_7764_8606 264
482 3300046616 Ga0495668_0010699 Ga0495668_0010699_885_1727 264
483 3300046664 Ga0495659_0014687 Ga0495659_0014687_977_1819 264
484 3300046665 Ga0495661_0004577 Ga0495661_0004577_8552_9394 264
485 3300046684 Ga0495669_0003437 Ga0495669_0003437_675_1583 264
486 3300046690 Ga0495624_0133302 Ga0495624_0133302_637_1512 264
487 3300046694 Ga0495649_0034090 Ga0495649_0034090_286_1194 264
488 3300047318 Ga0495636_0006874 Ga0495636_0006874_303_1145 264
489 3300047447 Ga0495685_045200 Ga0495685_045200_175_1017 264
490 3300047470 Ga0495681_0005375 Ga0495681_0005375_6607_7449 264
491 3300049568 Ga0501031_0055742 Ga0501031_0055742_1338_2234 264

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13452

MaoC_dehydrat_N

N-terminal half of MaoC dehydratase

64

168

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
8huc-assembly1.cif.gz_C crystal structure of paich (pec1) 0.9118 15 264
8huc-assembly2.cif.gz_B crystal structure of paich (pec1) 0.9072 14 264
8huc-assembly2.cif.gz_D crystal structure of paich (pec1) 0.9053 12 264
5wh9-assembly2.cif.gz_D-3 structure of bh1999 gentisyl-coenzyme a thioesterase 0.8996 83 141
8huc-assembly1.cif.gz_A crystal structure of paich (pec1) 0.8986 12 264
ID Description Score Start End Superfamily
af_Q2FXM2_325_429_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9007 83 141 3.10.129.10
5eo2A01 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8837 192 264 3.10.129.10
af_Q4E140_13_154_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8837 192 263 3.10.129.10
af_Q5A0N4_66_202_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8807 213 263 3.10.129.10
1z54D00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8768 87 141 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A520HAF0-F1-model_v4 Acyl-CoA dehydrogenase 0.9821 176 264 GO:0019171
AF-A0A520HAF0-F1-model_v4 Acyl-CoA dehydrogenase 0.9713 176 264 GO:0019171
AF-X1C6A7-F1-model_v4 MaoC-like domain-containing protein 0.9531 147 264 GO:0019171
AF-A0A6I1VV85-F1-model_v4 Transposase 0.9493 155 264 GO:0019171
AF-A0A2E7P2G3-F1-model_v4 Acyl-CoA dehydrogenase 0.9472 1 264 GO:0019171

Feature Viewer

pLDDT pTM Quality
81.97 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map