F454095
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 491 | 262 | 982 | 548 |
Family's Representative Sequence
| Representative Sequence | 3300013100|Ga0157373_10000005|Ga0157373_10000005217 |
| Length | 578 |
| Sequence | VIFLEQHLYERKICRTILKRIFAHFALKKQIKMINLILKINHKDNVLVALQDIPAETEIIFEGVTYTTLEAIPAKHKFFMNDMKQGDEIFMYGVLVGKVQYDLAAGTRMTTDNTKHAAEPYYYRDVDYHWTKPDVSRFLHKTFKGYHRSNGDVGTANYWLFIPTVFCENRNLDIIKESLYDNLGYAVDAKYKDYTHQLVEAISKGENIDDLNFSPSNIPAKERVFKNVDGIKFLNHTGGCGGTRQDADTLSKLLASYADHPNVAGVTLLSLGCQHLQIDNFKKDLYNRNPDFDKPLLVFEQQKAVSEETMIKNAIFETLKGLLEINKIEREDAPISKLCVGVKCGGSDGFSGISANPAVGHLADILSVLGAKVLLAEFPELCGVEQELIDRAVDKPTAEKFIRLMTEYDELAHAVGSGFYMNPSPGNIKDGLITDAIKSAGAAKKGGSAPVVDVLDYTEPATKPGLSLVCTPGNDVEATTGKAASGATLILFTTGLGTPTGNPVCPVMKVATNTILATKMSDIIDIDTGAVVRGEKTIQEMGEDILDFCIDVASGNIIPKAVALNQDDFIPWKRGVSL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 2 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 3 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 4 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 5 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 6 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 7 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 8 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 9 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 12 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 14 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 20 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 23 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 37 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 43 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 47 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 49 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 50 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 51 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 52 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 53 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 54 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 55 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 56 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 58 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 59 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 60 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 61 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 62 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 63 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 64 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 66 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 67 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 68 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 88 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 91 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 92 | 3300015682 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 | Metagenome | Rhizosphere |
| 93 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 95 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 96 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 97 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 98 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 99 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 100 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 134 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 135 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 138 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 139 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 140 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 141 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 142 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 143 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 144 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 145 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 146 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 147 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 148 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 149 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 150 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 151 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 152 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 153 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 154 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 155 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 156 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 157 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 158 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 159 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 160 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 161 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 179 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 180 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 181 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 182 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 183 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 184 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 185 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 186 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 187 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 188 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 189 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 190 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 191 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 192 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 193 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 194 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 195 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 196 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 197 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 198 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 199 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 200 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 201 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 202 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 203 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 204 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 205 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 206 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 207 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 208 | 2519899754 | Flavobacterium sp. F52 | Isolate | Rhizosphere |
| 209 | 2585427687 | Pedobacter borealis DSM 19626 | Isolate | Rhizosphere |
| 210 | 2585428061 | Chryseobacterium sp. CF356 | Isolate | Rhizosphere |
| 211 | 2585428095 | Chryseobacterium sp. YR005 | Isolate | Rhizosphere |
| 212 | 2585428115 | Chryseobacterium sp. YR561 | Isolate | Rhizosphere |
| 213 | 2585428187 | Chryseobacterium sp. YR460 | Isolate | Rhizosphere |
| 214 | 2643221667 | Flavobacterium sp. Root420 | Isolate | Unclassified |
| 215 | 2643221725 | Flavobacterium sp. Root935 | Isolate | Unclassified |
| 216 | 2721755487 | Sphingobacterium sp. B29 | Isolate | Rhizosphere |
| 217 | 2738541273 | Elizabethkingia sp. YR214 | Isolate | Unclassified |
| 218 | 2738541279 | Flavobacterium sp. GV069 | Isolate | Unclassified |
| 219 | 2738541283 | Pedobacter sp. OK701 | Isolate | Unclassified |
| 220 | 2738541284 | Pedobacter sp. YR016 | Isolate | Unclassified |
| 221 | 2738541285 | Flavobacterium sp. GV030 | Isolate | Unclassified |
| 222 | 2738541302 | Pedobacter sp. CF074 | Isolate | Unclassified |
| 223 | 2738543007 | Flavobacterium sp. GV063 | Isolate | Unclassified |
| 224 | 2738543014 | Elizabethkingia sp. YR191 | Isolate | Unclassified |
| 225 | 2738543023 | Pedobacter sp. OK628 | Isolate | Unclassified |
| 226 | 2739367651 | Pedobacter sp. OK291 | Isolate | Unclassified |
| 227 | 2739367656 | Pedobacter sp. CF523 | Isolate | Unclassified |
| 228 | 2739367663 | Pedobacter sp. YR510 | Isolate | Unclassified |
| 229 | 2775506739 | Chryseobacterium sp. 1335 | Isolate | Unclassified |
| 230 | 2775506987 | Pedobacter ginsengisoli T01R-27 | Isolate | Unclassified |
| 231 | 2802428842 | Flavobacterium sp. S87F.05.LMB.W.Kidney.N | Isolate | Unclassified |
| 232 | 2816332280 | Flavobacterium johnsoniae GSE09 | Isolate | Unclassified |
| 233 | 2818991437 | Pedobacter terrae 518 | Isolate | Unclassified |
| 234 | 2842722452 | Pedobacter sp. R-72249 | Isolate | Unclassified |
| 235 | 2842909656 | Pedobacter sp. R-72393 | Isolate | Unclassified |
| 236 | 2849281842 | Pedobacter sp. AK013 | Isolate | Rhizosphere |
| 237 | 2852627209 | Pedobacter sp. AK017 | Isolate | Rhizosphere |
| 238 | 2857627736 | Pedobacter sp. R-74587 | Isolate | Unclassified |
| 239 | 2881359912 | Flavobacterium ustbae T13 | Isolate | Rhizosphere |
| 240 | 2895498888 | Pseudoxanthomonas sp. SGD-10 | Isolate | Rhizosphere |
| 241 | 2896344016 | Sphingobacterium sp. SGL-16 | Isolate | Rhizosphere |
| 242 | 2902048731 | Pedobacter ureilyticus THG-T11 | Isolate | Rhizosphere |
| 243 | 2903895155 | Flavobacterium sp. HBTb2-11-1 | Isolate | Rhizosphere |
| 244 | 2904445276 | Pedobacter terrae 1734 | Isolate | Rhizosphere |
| 245 | 2904780799 | Sphingobacterium sp. 1304 | Isolate | Rhizosphere |
| 246 | 2910245624 | Adhaeribacter radiodurans KUDC8001 | Isolate | Rhizosphere |
| 247 | 2914759650 | Rhizosphaericola mali | Isolate | Rhizosphere |
| 248 | 2919097161 | Chryseobacterium ginsenosidimutans 1394 | Isolate | Rhizosphere |
| 249 | 2919177583 | Sphingobacterium sp. 2149 | Isolate | Rhizosphere |
| 250 | 2919186247 | Pedobacter africanus 2697 | Isolate | Rhizosphere |
| 251 | 2929150217 | Flavobacterium sp. R-74510 Hybrid assembly | Isolate | Unclassified |
| 252 | 2929154850 | Filimonas sp. R-72421 Hybrid assembly | Isolate | Unclassified |
| 253 | 2939664404 | Pedobacter africanus 2990 | Isolate | Rhizosphere |
| 254 | 2945924605 | Chryseobacterium ginsenosidimutans W1I9 | Isolate | Rhizosphere |
| 255 | 2945997725 | Pedobacter sp. W3I1 | Isolate | Rhizosphere |
| 256 | 2954016120 | Flavobacterium sp. W4I14 | Isolate | Rhizosphere |
| 257 | 2958458903 | Flavobacterium anhuiense RCM74 | Isolate | Rhizosphere |
| 258 | 2958512119 | Flavobacterium sp. Sd200 | Isolate | Rhizosphere |
| 259 | 2977268062 | Flavobacterium sp. SORGH_AS 622 | Isolate | Unclassified |
| 260 | 3003233435 | Sphingobacterium shayense CrR18 | Isolate | Unclassified |
| 261 | 8055419101 | Flavobacterium tyrosinilyticum KCTC 42726 | Isolate | Rhizosphere |
| 262 | 8055592153 | Flavobacterium panacis DCY106 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 86.56 |
| Metatranscriptomes | 0 |
| Isolates | 13.44 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.54 |
| Nodule | 1.02 |
| Rhizoplane | 0.41 |
| Rhizosphere | 81.26 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.02 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0157373_10000005 | 3300013100 | Bacteria | 262158 |
| 2 | JGI24751J29686_10002780 | 3300002459 | Bacteria | 3519 |
| 3 | JGI25152J39213_1000080 | 3300002773 | Bacteria | 65432 |
| 4 | JGI25152J39213_1000173 | 3300002773 | Bacteria | 43619 |
| 5 | JGI25150J39212_1000003 | 3300002774 | Bacteria | 508651 |
| 6 | JGI25150J39212_1000004 | 3300002774 | Bacteria | 417320 |
| 7 | JGI25150J39212_1000015 | 3300002774 | Bacteria | 170613 |
| 8 | JGI25151J46595_10000002 | 3300003187 | Bacteria | 731381 |
| 9 | JGI25151J46595_10000043 | 3300003187 | Bacteria | 170613 |
| 10 | JGI25153J46596_10000009 | 3300003215 | Bacteria | 340925 |
| 11 | JGI25153J46596_10000015 | 3300003215 | Bacteria | 289820 |
| 12 | Ga0055536_1000001 | 3300003781 | Bacteria | 630663 |
| 13 | Ga0055536_1000002 | 3300003781 | Bacteria | 605605 |
| 14 | Ga0055530_10001525 | 3300003791 | Bacteria | 16697 |
| 15 | Ga0065714_10002204 | 3300005288 | Bacteria | 57902 |
| 16 | Ga0065714_10002251 | 3300005288 | Bacteria | 34173 |
| 17 | Ga0065714_10002553 | 3300005288 | Bacteria | 19114 |
| 18 | Ga0065714_10004810 | 3300005288 | Bacteria | 6804 |
| 19 | Ga0065714_10005601 | 3300005288 | Bacteria | 3769 |
| 20 | Ga0065714_10006902 | 3300005288 | Bacteria | 3689 |
| 21 | Ga0065714_10015106 | 3300005288 | Bacteria | 5772 |
| 22 | Ga0065714_10082581 | 3300005288 | Bacteria | 2233 |
| 23 | Ga0065704_10072354 | 3300005289 | Bacteria | 8680 |
| 24 | Ga0065712_10003936 | 3300005290 | Bacteria | 3448 |
| 25 | Ga0065715_10020339 | 3300005293 | Bacteria | 2593 |
| 26 | Ga0065707_10131200 | 3300005295 | Bacteria | 1917 |
| 27 | Ga0070658_10046148 | 3300005327 | Bacteria | 3526 |
| 28 | Ga0070676_10015781 | 3300005328 | Bacteria | 4166 |
| 29 | Ga0070683_100001724 | 3300005329 | Bacteria | 17005 |
| 30 | Ga0070683_100096635 | 3300005329 | Bacteria | 2779 |
| 31 | Ga0070690_100017022 | 3300005330 | Bacteria | 4364 |
| 32 | Ga0070670_100085030 | 3300005331 | Bacteria | 2718 |
| 33 | Ga0070670_100119595 | 3300005331 | Bacteria | 2272 |
| 34 | Ga0068869_100001942 | 3300005334 | Bacteria | 12403 |
| 35 | Ga0068869_100028571 | 3300005334 | Bacteria | 3899 |
| 36 | Ga0068869_100053108 | 3300005334 | Bacteria | 2944 |
| 37 | Ga0068869_100069306 | 3300005334 | Bacteria | 2607 |
| 38 | Ga0068869_100126054 | 3300005334 | Bacteria | 1963 |
| 39 | Ga0070666_10000696 | 3300005335 | Bacteria | 20362 |
| 40 | Ga0070682_100000109 | 3300005337 | Bacteria | 73659 |
| 41 | Ga0068868_100004734 | 3300005338 | Bacteria | 9556 |
| 42 | Ga0070660_100001082 | 3300005339 | Bacteria | 18309 |
| 43 | Ga0070689_100011094 | 3300005340 | Bacteria | 6446 |
| 44 | Ga0070689_100031128 | 3300005340 | Bacteria | 4054 |
| 45 | Ga0070689_100042753 | 3300005340 | Bacteria | 3480 |
| 46 | Ga0070661_100003878 | 3300005344 | Bacteria | 10295 |
| 47 | Ga0070661_100032497 | 3300005344 | Bacteria | 3778 |
| 48 | Ga0070675_100018724 | 3300005354 | Bacteria | 5512 |
| 49 | Ga0070671_100031632 | 3300005355 | Bacteria | 4372 |
| 50 | Ga0070674_100013974 | 3300005356 | Bacteria | 4980 |
| 51 | Ga0070673_100004392 | 3300005364 | Bacteria | 8912 |
| 52 | Ga0070673_100005637 | 3300005364 | Bacteria | 8036 |
| 53 | Ga0070673_100025696 | 3300005364 | Bacteria | 4339 |
| 54 | Ga0070673_100113710 | 3300005364 | Bacteria | 2248 |
| 55 | Ga0070659_100005067 | 3300005366 | Bacteria | 9446 |
| 56 | Ga0070659_100007295 | 3300005366 | Bacteria | 8025 |
| 57 | Ga0070667_100013413 | 3300005367 | Bacteria | 6774 |
| 58 | Ga0070667_100032955 | 3300005367 | Bacteria | 4324 |
| 59 | Ga0070667_100057511 | 3300005367 | Bacteria | 3287 |
| 60 | Ga0070667_100081014 | 3300005367 | Bacteria | 2777 |
| 61 | Ga0070713_100093706 | 3300005436 | Bacteria | 2588 |
| 62 | Ga0070678_100077865 | 3300005456 | Bacteria | 2502 |
| 63 | Ga0070662_100008428 | 3300005457 | Bacteria | 6720 |
| 64 | Ga0070662_100022494 | 3300005457 | Bacteria | 4318 |
| 65 | Ga0070662_100066034 | 3300005457 | Bacteria | 2654 |
| 66 | Ga0070681_10234334 | 3300005458 | Bacteria | 1750 |
| 67 | Ga0068867_100012501 | 3300005459 | Bacteria | 6008 |
| 68 | Ga0068867_100016386 | 3300005459 | Bacteria | 5261 |
| 69 | Ga0070685_10019145 | 3300005466 | Bacteria | 3691 |
| 70 | Ga0070685_10059655 | 3300005466 | Bacteria | 2228 |
| 71 | Ga0070698_100004841 | 3300005471 | Bacteria | 14779 |
| 72 | Ga0070698_100005154 | 3300005471 | Bacteria | 14294 |
| 73 | Ga0070698_100006108 | 3300005471 | Bacteria | 13114 |
| 74 | Ga0070698_100022314 | 3300005471 | Bacteria | 6622 |
| 75 | Ga0070698_100070417 | 3300005471 | Bacteria | 3510 |
| 76 | Ga0070699_100097249 | 3300005518 | Bacteria | 2579 |
| 77 | Ga0070679_100046381 | 3300005530 | Bacteria | 4331 |
| 78 | Ga0070684_100000417 | 3300005535 | Bacteria | 29183 |
| 79 | Ga0070684_100014019 | 3300005535 | Bacteria | 6481 |
| 80 | Ga0070684_100034633 | 3300005535 | Bacteria | 4318 |
| 81 | Ga0068853_100040143 | 3300005539 | Bacteria | 3992 |
| 82 | Ga0068853_100180196 | 3300005539 | Bacteria | 1916 |
| 83 | Ga0070686_100020608 | 3300005544 | Bacteria | 3904 |
| 84 | Ga0070665_100022051 | 3300005548 | Bacteria | 6407 |
| 85 | Ga0070704_100032638 | 3300005549 | Bacteria | 3514 |
| 86 | Ga0068855_100019915 | 3300005563 | Bacteria | 8057 |
| 87 | Ga0070664_100000360 | 3300005564 | Bacteria | 33570 |
| 88 | Ga0070664_100012371 | 3300005564 | Bacteria | 6935 |
| 89 | Ga0070664_100018647 | 3300005564 | Bacteria | 5705 |
| 90 | Ga0070664_100062016 | 3300005564 | Bacteria | 3187 |
| 91 | Ga0068857_100044096 | 3300005577 | Bacteria | 3955 |
| 92 | Ga0068859_100000098 | 3300005617 | Bacteria | 80555 |
| 93 | Ga0068859_100000285 | 3300005617 | Bacteria | 50405 |
| 94 | Ga0068859_100013654 | 3300005617 | Bacteria | 8143 |
| 95 | Ga0068861_100011359 | 3300005719 | Bacteria | 6186 |
| 96 | Ga0068861_100015969 | 3300005719 | Bacteria | 5302 |
| 97 | Ga0068861_100092712 | 3300005719 | Bacteria | 2386 |
| 98 | Ga0068861_100101180 | 3300005719 | Bacteria | 2292 |
| 99 | Ga0068851_10051166 | 3300005834 | Bacteria | 2099 |
| 100 | Ga0068863_100001430 | 3300005841 | Bacteria | 23658 |
| 101 | Ga0068863_100005978 | 3300005841 | Bacteria | 11939 |
| 102 | Ga0068863_100017784 | 3300005841 | Bacteria | 6803 |
| 103 | Ga0068863_100056220 | 3300005841 | Bacteria | 3726 |
| 104 | Ga0068860_100003920 | 3300005843 | Bacteria | 15287 |
| 105 | Ga0068860_100100682 | 3300005843 | Bacteria | 2757 |
| 106 | Ga0068862_100026893 | 3300005844 | Bacteria | 4838 |
| 107 | Ga0075366_10013752 | 3300006195 | Bacteria | 4612 |
| 108 | Ga0097621_100001501 | 3300006237 | Bacteria | 15978 |
| 109 | Ga0097621_100052525 | 3300006237 | Unclassified | 3321 |
| 110 | Ga0097621_100121898 | 3300006237 | Bacteria | 2212 |
| 111 | Ga0068871_100004024 | 3300006358 | Bacteria | 10153 |
| 112 | Ga0068871_100018358 | 3300006358 | Bacteria | 5314 |
| 113 | Ga0068871_100035985 | 3300006358 | Bacteria | 3938 |
| 114 | Ga0068871_100088297 | 3300006358 | Bacteria | 2579 |
| 115 | Ga0075428_100018917 | 3300006844 | Bacteria | 7617 |
| 116 | Ga0075428_100023631 | 3300006844 | Bacteria | 6804 |
| 117 | Ga0075428_100030907 | 3300006844 | Bacteria | 5922 |
| 118 | Ga0075428_100036418 | 3300006844 | Bacteria | 5419 |
| 119 | Ga0075430_100009461 | 3300006846 | Bacteria | 8235 |
| 120 | Ga0075430_100013447 | 3300006846 | Bacteria | 6977 |
| 121 | Ga0075431_100024790 | 3300006847 | Bacteria | 6149 |
| 122 | Ga0075431_100027720 | 3300006847 | Bacteria | 5814 |
| 123 | Ga0075434_100253555 | 3300006871 | Bacteria | 1778 |
| 124 | Ga0075429_100000557 | 3300006880 | Bacteria | 28537 |
| 125 | Ga0068865_100001792 | 3300006881 | Bacteria | 12609 |
| 126 | Ga0097620_100000098 | 3300006931 | Bacteria | 80555 |
| 127 | Ga0097620_100000285 | 3300006931 | Bacteria | 50405 |
| 128 | Ga0097620_100013654 | 3300006931 | Bacteria | 8143 |
| 129 | Ga0099824_1004036 | 3300006942 | Bacteria | 21249 |
| 130 | Ga0079104_1000079 | 3300006946 | Bacteria | 141480 |
| 131 | Ga0099826_10026672 | 3300006948 | Bacteria | 4257 |
| 132 | Ga0105251_10035098 | 3300009011 | Bacteria | 2476 |
| 133 | Ga0105240_10068320 | 3300009093 | Bacteria | 4402 |
| 134 | Ga0111539_10004863 | 3300009094 | Bacteria | 17500 |
| 135 | Ga0114129_10004260 | 3300009147 | Bacteria | 20220 |
| 136 | Ga0114129_10247196 | 3300009147 | Bacteria | 2396 |
| 137 | Ga0105241_10006435 | 3300009174 | Bacteria | 8656 |
| 138 | Ga0105241_10102000 | 3300009174 | Bacteria | 2283 |
| 139 | Ga0105242_10115112 | 3300009176 | Bacteria | 2299 |
| 140 | Ga0105237_10003809 | 3300009545 | Bacteria | 17731 |
| 141 | Ga0105237_10011376 | 3300009545 | Bacteria | 9413 |
| 142 | Ga0105249_10001120 | 3300009553 | Bacteria | 23848 |
| 143 | Ga0105249_10001157 | 3300009553 | Bacteria | 23330 |
| 144 | Ga0105249_10001277 | 3300009553 | Bacteria | 22079 |
| 145 | Ga0105249_10021242 | 3300009553 | Bacteria | 5813 |
| 146 | Ga0105249_10021677 | 3300009553 | Bacteria | 5752 |
| 147 | Ga0105249_10062412 | 3300009553 | Bacteria | 3422 |
| 148 | Ga0105239_10064256 | 3300010375 | Bacteria | 4029 |
| 149 | Ga0105239_10275530 | 3300010375 | Bacteria | 1893 |
| 150 | Ga0157373_10000035 | 3300013100 | Bacteria | 123284 |
| 151 | Ga0157373_10003444 | 3300013100 | Bacteria | 11972 |
| 152 | Ga0157373_10008374 | 3300013100 | Bacteria | 7681 |
| 153 | Ga0157373_10045547 | 3300013100 | Bacteria | 3131 |
| 154 | Ga0157371_10000021 | 3300013102 | Bacteria | 301017 |
| 155 | Ga0157371_10000025 | 3300013102 | Bacteria | 279746 |
| 156 | Ga0157371_10001207 | 3300013102 | Bacteria | 27564 |
| 157 | Ga0157371_10006892 | 3300013102 | Bacteria | 9275 |
| 158 | Ga0157371_10007560 | 3300013102 | Bacteria | 8777 |
| 159 | Ga0157370_10000383 | 3300013104 | Bacteria | 55670 |
| 160 | Ga0157370_10001800 | 3300013104 | Bacteria | 26427 |
| 161 | Ga0157370_10003591 | 3300013104 | Bacteria | 18145 |
| 162 | Ga0157370_10015356 | 3300013104 | Bacteria | 7784 |
| 163 | Ga0157370_10024060 | 3300013104 | Bacteria | 6038 |
| 164 | Ga0157370_10037772 | 3300013104 | Bacteria | 4677 |
| 165 | Ga0157370_10052091 | 3300013104 | Bacteria | 3908 |
| 166 | Ga0157370_10067718 | 3300013104 | Bacteria | 3375 |
| 167 | Ga0157370_10155103 | 3300013104 | Bacteria | 2130 |
| 168 | Ga0157370_10181478 | 3300013104 | Bacteria | 1956 |
| 169 | Ga0157369_10000008 | 3300013105 | Bacteria | 309315 |
| 170 | Ga0157369_10000038 | 3300013105 | Bacteria | 189078 |
| 171 | Ga0157369_10039587 | 3300013105 | Bacteria | 5151 |
| 172 | Ga0157369_10150971 | 3300013105 | Bacteria | 2455 |
| 173 | Ga0157369_10240920 | 3300013105 | Bacteria | 1889 |
| 174 | Ga0157374_10007311 | 3300013296 | Bacteria | 9415 |
| 175 | Ga0157374_10017645 | 3300013296 | Bacteria | 6288 |
| 176 | Ga0157378_10026991 | 3300013297 | Bacteria | 5065 |
| 177 | Ga0157378_10037267 | 3300013297 | Bacteria | 4306 |
| 178 | Ga0157378_10071514 | 3300013297 | Bacteria | 3115 |
| 179 | Ga0157378_10094244 | 3300013297 | Bacteria | 2726 |
| 180 | Ga0163162_10000050 | 3300013306 | Bacteria | 120151 |
| 181 | Ga0163162_10000155 | 3300013306 | Bacteria | 63251 |
| 182 | Ga0163162_10006015 | 3300013306 | Bacteria | 11744 |
| 183 | Ga0157372_10032190 | 3300013307 | Bacteria | 5747 |
| 184 | Ga0157372_10047069 | 3300013307 | Bacteria | 4790 |
| 185 | Ga0157375_10002645 | 3300013308 | Bacteria | 15517 |
| 186 | Ga0157375_10004308 | 3300013308 | Bacteria | 12343 |
| 187 | Ga0157375_10016379 | 3300013308 | Bacteria | 6657 |
| 188 | Ga0163163_10003073 | 3300014325 | Bacteria | 14131 |
| 189 | Ga0163163_10006182 | 3300014325 | Bacteria | 10440 |
| 190 | Ga0157380_10009601 | 3300014326 | Bacteria | 6941 |
| 191 | Ga0157380_10096760 | 3300014326 | Unclassified | 2448 |
| 192 | Ga0157380_10187997 | 3300014326 | Bacteria | 1821 |
| 193 | Ga0182008_10000020 | 3300014497 | Bacteria | 228333 |
| 194 | Ga0182008_10000037 | 3300014497 | Bacteria | 129884 |
| 195 | Ga0182008_10000309 | 3300014497 | Bacteria | 38347 |
| 196 | Ga0182008_10000603 | 3300014497 | Bacteria | 26394 |
| 197 | Ga0182008_10003307 | 3300014497 | Bacteria | 9801 |
| 198 | Ga0182008_10012375 | 3300014497 | Bacteria | 4504 |
| 199 | Ga0182008_10050715 | 3300014497 | Bacteria | 2060 |
| 200 | Ga0157379_10015571 | 3300014968 | Bacteria | 6676 |
| 201 | Ga0157379_10193420 | 3300014968 | Bacteria | 1838 |
| 202 | Ga0157376_10001928 | 3300014969 | Bacteria | 13861 |
| 203 | Ga0157376_10002899 | 3300014969 | Bacteria | 11760 |
| 204 | Ga0157376_10008614 | 3300014969 | Bacteria | 7373 |
| 205 | Ga0157376_10031148 | 3300014969 | Unclassified | 4267 |
| 206 | Ga0157376_10041397 | 3300014969 | Bacteria | 3771 |
| 207 | Ga0157376_10074721 | 3300014969 | Bacteria | 2890 |
| 208 | Ga0182006_1000109 | 3300015261 | Bacteria | 89541 |
| 209 | Ga0182006_1000127 | 3300015261 | Bacteria | 81679 |
| 210 | Ga0182006_1000227 | 3300015261 | Bacteria | 53817 |
| 211 | Ga0182006_1000888 | 3300015261 | Bacteria | 20046 |
| 212 | Ga0182006_1001210 | 3300015261 | Bacteria | 16125 |
| 213 | Ga0182006_1002244 | 3300015261 | Bacteria | 10677 |
| 214 | Ga0182006_1009706 | 3300015261 | Bacteria | 4305 |
| 215 | Ga0182007_10000003 | 3300015262 | Bacteria | 548244 |
| 216 | Ga0182007_10000024 | 3300015262 | Bacteria | 181761 |
| 217 | Ga0182007_10002394 | 3300015262 | Bacteria | 9379 |
| 218 | Ga0183373_1001 | 3300015682 | Bacteria | 1410374 |
| 219 | Ga0183373_1002 | 3300015682 | Bacteria | 990153 |
| 220 | Ga0163161_10000136 | 3300017792 | Bacteria | 69043 |
| 221 | Ga0163161_10000470 | 3300017792 | Bacteria | 33480 |
| 222 | Ga0163161_10000815 | 3300017792 | Bacteria | 24459 |
| 223 | Ga0163161_10001151 | 3300017792 | Bacteria | 19912 |
| 224 | Ga0163161_10001518 | 3300017792 | Bacteria | 17178 |
| 225 | Ga0163161_10010250 | 3300017792 | Bacteria | 6489 |
| 226 | Ga0163161_10035915 | 3300017792 | Bacteria | 3548 |
| 227 | Ga0163161_10096055 | 3300017792 | Bacteria | 2199 |
| 228 | Ga0207425_1000003 | 3300025245 | Bacteria | 1145342 |
| 229 | Ga0207425_1000023 | 3300025245 | Bacteria | 341339 |
| 230 | Ga0209129_1000014 | 3300025258 | Bacteria | 509018 |
| 231 | Ga0209129_1000032 | 3300025258 | Bacteria | 341150 |
| 232 | Ga0209676_1000008 | 3300025292 | Bacteria | 991778 |
| 233 | Ga0209676_1000022 | 3300025292 | Bacteria | 605659 |
| 234 | Ga0209025_1000007 | 3300025294 | Bacteria | 1145109 |
| 235 | Ga0209025_1000047 | 3300025294 | Bacteria | 341150 |
| 236 | Ga0209758_1000012 | 3300025297 | Bacteria | 949866 |
| 237 | Ga0209758_1000144 | 3300025297 | Bacteria | 170724 |
| 238 | Ga0209050_1000020 | 3300025298 | Bacteria | 605671 |
| 239 | Ga0209050_1000343 | 3300025298 | Bacteria | 92045 |
| 240 | Ga0207680_10000120 | 3300025903 | Bacteria | 36545 |
| 241 | Ga0207680_10073094 | 3300025903 | Bacteria | 2131 |
| 242 | Ga0207647_10022367 | 3300025904 | Bacteria | 4200 |
| 243 | Ga0207645_10000334 | 3300025907 | Bacteria | 39321 |
| 244 | Ga0207645_10028538 | 3300025907 | Bacteria | 3602 |
| 245 | Ga0207654_10001306 | 3300025911 | Bacteria | 13282 |
| 246 | Ga0207671_10001247 | 3300025914 | Bacteria | 29996 |
| 247 | Ga0207671_10016536 | 3300025914 | Bacteria | 5729 |
| 248 | Ga0207657_10001634 | 3300025919 | Bacteria | 24147 |
| 249 | Ga0207649_10078781 | 3300025920 | Bacteria | 2127 |
| 250 | Ga0207650_10030282 | 3300025925 | Bacteria | 3897 |
| 251 | Ga0207650_10047930 | 3300025925 | Bacteria | 3150 |
| 252 | Ga0207650_10061601 | 3300025925 | Bacteria | 2801 |
| 253 | Ga0207650_10083152 | 3300025925 | Bacteria | 2431 |
| 254 | Ga0207644_10034862 | 3300025931 | Bacteria | 3523 |
| 255 | Ga0207644_10151665 | 3300025931 | Bacteria | 1794 |
| 256 | Ga0207690_10003665 | 3300025932 | Bacteria | 9145 |
| 257 | Ga0207706_10006057 | 3300025933 | Bacteria | 11244 |
| 258 | Ga0207706_10020425 | 3300025933 | Bacteria | 5955 |
| 259 | Ga0207686_10000405 | 3300025934 | Bacteria | 29880 |
| 260 | Ga0207686_10005263 | 3300025934 | Bacteria | 6943 |
| 261 | Ga0207670_10044244 | 3300025936 | Bacteria | 2945 |
| 262 | Ga0207670_10111807 | 3300025936 | Bacteria | 1970 |
| 263 | Ga0207669_10043503 | 3300025937 | Bacteria | 2631 |
| 264 | Ga0207691_10065090 | 3300025940 | Bacteria | 3301 |
| 265 | Ga0207691_10109635 | 3300025940 | Bacteria | 2456 |
| 266 | Ga0207689_10003219 | 3300025942 | Bacteria | 14956 |
| 267 | Ga0207689_10005450 | 3300025942 | Bacteria | 11387 |
| 268 | Ga0207689_10012712 | 3300025942 | Bacteria | 7192 |
| 269 | Ga0207689_10019387 | 3300025942 | Bacteria | 5734 |
| 270 | Ga0207689_10046567 | 3300025942 | Bacteria | 3584 |
| 271 | Ga0207689_10096391 | 3300025942 | Bacteria | 2429 |
| 272 | Ga0207661_10048895 | 3300025944 | Bacteria | 3363 |
| 273 | Ga0207661_10078337 | 3300025944 | Bacteria | 2720 |
| 274 | Ga0207679_10007831 | 3300025945 | Bacteria | 6789 |
| 275 | Ga0207679_10064690 | 3300025945 | Bacteria | 2734 |
| 276 | Ga0207667_10010203 | 3300025949 | Bacteria | 11001 |
| 277 | Ga0207651_10023979 | 3300025960 | Bacteria | 3765 |
| 278 | Ga0207651_10040522 | 3300025960 | Bacteria | 3082 |
| 279 | Ga0207651_10043655 | 3300025960 | Bacteria | 2994 |
| 280 | Ga0207651_10151296 | 3300025960 | Bacteria | 1807 |
| 281 | Ga0207712_10000821 | 3300025961 | Bacteria | 22848 |
| 282 | Ga0207712_10004491 | 3300025961 | Bacteria | 8811 |
| 283 | Ga0207712_10007724 | 3300025961 | Bacteria | 6802 |
| 284 | Ga0207712_10016604 | 3300025961 | Bacteria | 4772 |
| 285 | Ga0207712_10082854 | 3300025961 | Unclassified | 2339 |
| 286 | Ga0207640_10054545 | 3300025981 | Bacteria | 2614 |
| 287 | Ga0207658_10026332 | 3300025986 | Bacteria | 4077 |
| 288 | Ga0207658_10075616 | 3300025986 | Bacteria | 2563 |
| 289 | Ga0207703_10100305 | 3300026035 | Bacteria | 2453 |
| 290 | Ga0207703_10208091 | 3300026035 | Bacteria | 1742 |
| 291 | Ga0207639_10006556 | 3300026041 | Bacteria | 7914 |
| 292 | Ga0207639_10103832 | 3300026041 | Bacteria | 2303 |
| 293 | Ga0207639_10167908 | 3300026041 | Bacteria | 1855 |
| 294 | Ga0207678_10099642 | 3300026067 | Bacteria | 2482 |
| 295 | Ga0207641_10001054 | 3300026088 | Bacteria | 27824 |
| 296 | Ga0207641_10001908 | 3300026088 | Bacteria | 20026 |
| 297 | Ga0207641_10021870 | 3300026088 | Bacteria | 5258 |
| 298 | Ga0207641_10063206 | 3300026088 | Bacteria | 3162 |
| 299 | Ga0207641_10093210 | 3300026088 | Bacteria | 2639 |
| 300 | Ga0207641_10180517 | 3300026088 | Bacteria | 1933 |
| 301 | Ga0207648_10004255 | 3300026089 | Bacteria | 14783 |
| 302 | Ga0207648_10036523 | 3300026089 | Bacteria | 4328 |
| 303 | Ga0207648_10062347 | 3300026089 | Bacteria | 3250 |
| 304 | Ga0207676_10004127 | 3300026095 | Bacteria | 10254 |
| 305 | Ga0207676_10012612 | 3300026095 | Bacteria | 6062 |
| 306 | Ga0207676_10035567 | 3300026095 | Bacteria | 3782 |
| 307 | Ga0207674_10045060 | 3300026116 | Bacteria | 4540 |
| 308 | Ga0207674_10062516 | 3300026116 | Bacteria | 3761 |
| 309 | Ga0207675_100002484 | 3300026118 | Bacteria | 18257 |
| 310 | Ga0207675_100029305 | 3300026118 | Bacteria | 5129 |
| 311 | Ga0207675_100069416 | 3300026118 | Bacteria | 3294 |
| 312 | Ga0207675_100121459 | 3300026118 | Bacteria | 2472 |
| 313 | Ga0207683_10031001 | 3300026121 | Bacteria | 4639 |
| 314 | Ga0207698_10024279 | 3300026142 | Bacteria | 4252 |
| 315 | Ga0209281_1000367 | 3300027111 | Bacteria | 73152 |
| 316 | Ga0209489_111689 | 3300027361 | Bacteria | 8728 |
| 317 | Ga0268266_10131878 | 3300028379 | Bacteria | 2236 |
| 318 | Ga0268264_10009194 | 3300028381 | Bacteria | 8187 |
| 319 | Ga0268264_10080005 | 3300028381 | Bacteria | 2790 |
| 320 | Ga0268264_10139747 | 3300028381 | Bacteria | 2158 |
| 321 | Ga0307515_10000001 | 3300028794 | Bacteria | 4259510 |
| 322 | Ga0307515_10000002 | 3300028794 | Bacteria | 1231751 |
| 323 | Ga0307515_10001521 | 3300028794 | Bacteria | 51888 |
| 324 | Ga0307515_10053353 | 3300028794 | Bacteria | 5968 |
| 325 | Ga0316181_1190315 | 3300030744 | Bacteria | 3579 |
| 326 | Ga0265327_10000488 | 3300031251 | Bacteria | 69809 |
| 327 | Ga0307509_10045625 | 3300031507 | Bacteria | 4724 |
| 328 | Ga0307509_10068760 | 3300031507 | Bacteria | 3705 |
| 329 | Ga0307508_10001227 | 3300031616 | Bacteria | 29288 |
| 330 | Ga0307405_10000008 | 3300031731 | Bacteria | 264953 |
| 331 | Ga0307405_10000011 | 3300031731 | Bacteria | 241071 |
| 332 | Ga0307407_10000018 | 3300031903 | Bacteria | 135979 |
| 333 | Ga0307407_10000026 | 3300031903 | Bacteria | 108029 |
| 334 | Ga0307412_10000001 | 3300031911 | Bacteria | 822691 |
| 335 | Ga0307412_10000283 | 3300031911 | Bacteria | 32305 |
| 336 | Ga0307412_10004974 | 3300031911 | Bacteria | 7428 |
| 337 | Ga0307409_100001787 | 3300031995 | Bacteria | 10863 |
| 338 | Ga0307416_100000053 | 3300032002 | Bacteria | 108029 |
| 339 | Ga0307416_100000066 | 3300032002 | Bacteria | 94549 |
| 340 | Ga0307416_100000081 | 3300032002 | Bacteria | 65986 |
| 341 | Ga0307414_10000046 | 3300032004 | Bacteria | 133496 |
| 342 | Ga0307414_10000474 | 3300032004 | Bacteria | 21053 |
| 343 | Ga0307414_10000947 | 3300032004 | Bacteria | 14835 |
| 344 | Ga0307414_10002029 | 3300032004 | Bacteria | 10513 |
| 345 | Ga0307414_10003034 | 3300032004 | Bacteria | 8901 |
| 346 | Ga0307414_10012708 | 3300032004 | Bacteria | 4991 |
| 347 | Ga0307414_10014405 | 3300032004 | Bacteria | 4740 |
| 348 | Ga0307411_10056560 | 3300032005 | Bacteria | 2586 |
| 349 | Ga0373924_0010001 | 3300035410 | Bacteria | 3491 |
| 350 | Ga0373937_0032091 | 3300036401 | Bacteria | 4762 |
| 351 | Ga0395900_0012957 | 3300037418 | Bacteria | 8520 |
| 352 | Ga0395905_0002019 | 3300037471 | Bacteria | 23194 |
| 353 | Ga0395905_0098703 | 3300037471 | Bacteria | 2743 |
| 354 | Ga0439439_0006352 | 3300041406 | Bacteria | 2733 |
| 355 | Ga0439439_0007265 | 3300041406 | Bacteria | 2587 |
| 356 | Ga0439465_0000153 | 3300041413 | Bacteria | 17071 |
| 357 | Ga0451853_0006869 | 3300041512 | Bacteria | 2965 |
| 358 | Ga0451853_3749989 | 3300041512 | Unclassified | 4943 |
| 359 | Ga0451577_0122689 | 3300042876 | Bacteria | 2327 |
| 360 | Ga0466969_0000151 | 3300044656 | Bacteria | 37632 |
| 361 | Ga0466966_0000113 | 3300044684 | Bacteria | 49984 |
| 362 | Ga0453684_0077574 | 3300044712 | Bacteria | 4162 |
| 363 | Ga0453684_0144202 | 3300044712 | Bacteria | 2839 |
| 364 | Ga0466959_0000015 | 3300045049 | Bacteria | 149242 |
| 365 | Ga0495627_000002 | 3300046453 | Bacteria | 903861 |
| 366 | Ga0495606_0006357 | 3300046507 | Bacteria | 10922 |
| 367 | Ga0495606_0028372 | 3300046507 | Bacteria | 3949 |
| 368 | Ga0495610_0000037 | 3300046512 | Bacteria | 186354 |
| 369 | Ga0495610_0000049 | 3300046512 | Bacteria | 149009 |
| 370 | Ga0495610_0000747 | 3300046512 | Bacteria | 30695 |
| 371 | Ga0495610_0001062 | 3300046512 | Bacteria | 25264 |
| 372 | Ga0495616_0014695 | 3300046513 | Bacteria | 4375 |
| 373 | Ga0495628_0021869 | 3300046516 | Bacteria | 5257 |
| 374 | Ga0495630_0036974 | 3300046517 | Bacteria | 3650 |
| 375 | Ga0495632_0005245 | 3300046519 | Bacteria | 8619 |
| 376 | Ga0495643_0001223 | 3300046522 | Bacteria | 24830 |
| 377 | Ga0495654_0000056 | 3300046530 | Bacteria | 140658 |
| 378 | Ga0495609_0000025 | 3300046538 | Bacteria | 256898 |
| 379 | Ga0495633_0000562 | 3300046558 | Bacteria | 36317 |
| 380 | Ga0495633_0015264 | 3300046558 | Bacteria | 3989 |
| 381 | Ga0495668_0001808 | 3300046616 | Bacteria | 19480 |
| 382 | Ga0495634_0041482 | 3300046642 | Bacteria | 3125 |
| 383 | Ga0495625_0002377 | 3300046660 | Bacteria | 20476 |
| 384 | Ga0495625_0043937 | 3300046660 | Bacteria | 3237 |
| 385 | Ga0495657_0092337 | 3300046675 | Bacteria | 1940 |
| 386 | Ga0495672_0027850 | 3300047320 | Bacteria | 3585 |
| 387 | Ga0495686_0000386 | 3300047472 | Bacteria | 70225 |
| 388 | Ga0495686_0001452 | 3300047472 | Bacteria | 25815 |
| 389 | Ga0495686_0011295 | 3300047472 | Bacteria | 6296 |
| 390 | Ga0496114_0091923 | 3300048917 | Bacteria | 2578 |
| 391 | Ga0496115_0046659 | 3300048918 | Bacteria | 3464 |
| 392 | Ga0496116_0001157 | 3300048919 | Bacteria | 31125 |
| 393 | Ga0496117_0000980 | 3300048920 | Bacteria | 43732 |
| 394 | Ga0496121_0009909 | 3300048924 | Bacteria | 10846 |
| 395 | Ga0496122_0002730 | 3300048925 | Bacteria | 24410 |
| 396 | Ga0496122_0003059 | 3300048925 | Bacteria | 22617 |
| 397 | Ga0496123_0003661 | 3300048926 | Bacteria | 16971 |
| 398 | Ga0496124_0027614 | 3300048927 | Bacteria | 5091 |
| 399 | Ga0496125_0023543 | 3300048928 | Bacteria | 5683 |
| 400 | Ga0501034_0027850 | 3300049571 | Bacteria | 5746 |
| 401 | Ga0501034_0028044 | 3300049571 | Bacteria | 5726 |
| 402 | Ga0501038_0023587 | 3300049574 | Bacteria | 5498 |
| 403 | Ga0501043_0024414 | 3300049579 | Bacteria | 4744 |
| 404 | Ga0501043_0066386 | 3300049579 | Bacteria | 2833 |
| 405 | Ga0501241_000020 | 3300049758 | Bacteria | 83005 |
| 406 | Ga0501241_005760 | 3300049758 | Bacteria | 2300 |
| 407 | Ga0501269_000181 | 3300049766 | Bacteria | 19450 |
| 408 | Ga0501044_0061545 | 3300049823 | Bacteria | 3840 |
| 409 | nmdc:mga0k408_3695_c2 | 3300050493 | Bacteria | 5638 |
| 410 | nmdc:mga05p37_2426_c2 | 3300050507 | Bacteria | 15408 |
| 411 | nmdc:mga09592_4890_c1 | 3300050508 | Bacteria | 10852 |
| 412 | nmdc:mga0qj67_13768_c1 | 3300050509 | Bacteria | 6105 |
| 413 | nmdc:mga08y16_41578_c1 | 3300050511 | Bacteria | 4815 |
| 414 | nmdc:mga0n895_213443_c1 | 3300050512 | Bacteria | 1960 |
| 415 | Ga0500646_0004164 | 3300053090 | Bacteria | 3670 |
| 416 | Ga0500583_0000028 | 3300053092 | Bacteria | 108276 |
| 417 | Ga0500583_0002283 | 3300053092 | Bacteria | 5721 |
| 418 | Ga0500651_0000357 | 3300053093 | Bacteria | 25575 |
| 419 | Ga0500641_0000040 | 3300053096 | Bacteria | 68174 |
| 420 | Ga0500562_000047 | 3300053108 | Bacteria | 62430 |
| 421 | Ga0500616_0001915 | 3300053153 | Bacteria | 18592 |
| 422 | Ga0500622_0000751 | 3300053156 | Bacteria | 28221 |
| 423 | Ga0500611_000002 | 3300053727 | Bacteria | 345991 |
| 424 | Ga0500611_000008 | 3300053727 | Bacteria | 198346 |
| 425 | Ga0500661_001831 | 3300055283 | Bacteria | 4014 |
| 426 | 2520880520 | 2519899754 | Bacteria | 5336938 |
| 427 | 2586208889 | 2585427687 | Bacteria | 5544917 |
| 428 | 2586208942 | 2585427687 | Bacteria | 5544917 |
| 429 | 2587751788 | 2585428061 | Bacteria | 3939663 |
| 430 | 2587865787 | 2585428095 | Bacteria | 3789702 |
| 431 | 2587943945 | 2585428115 | Bacteria | 4420269 |
| 432 | 2588231824 | 2585428187 | Bacteria | 4629388 |
| 433 | 2644373259 | 2643221667 | Bacteria | 5627472 |
| 434 | 2644682526 | 2643221725 | Bacteria | 5087956 |
| 435 | 2722731051 | 2721755487 | Bacteria | 6357185 |
| 436 | 2738698315 | 2738541273 | Bacteria | 4048577 |
| 437 | 2738734414 | 2738541279 | Bacteria | 6149495 |
| 438 | 2738759393 | 2738541283 | Bacteria | 7222293 |
| 439 | 2738763273 | 2738541284 | Bacteria | 5199923 |
| 440 | 2738767172 | 2738541285 | Bacteria | 6150075 |
| 441 | 2738852540 | 2738541302 | Bacteria | 5944758 |
| 442 | 2738856292 | 2738541302 | Bacteria | 5944758 |
| 443 | 2739215995 | 2738543007 | Bacteria | 6149845 |
| 444 | 2739252641 | 2738543014 | Bacteria | 4048139 |
| 445 | 2739304184 | 2738543023 | Bacteria | 6767879 |
| 446 | 2739590472 | 2739367651 | Bacteria | 6359826 |
| 447 | 2739591348 | 2739367651 | Bacteria | 6359826 |
| 448 | 2739614787 | 2739367656 | Bacteria | 5152243 |
| 449 | 2739646080 | 2739367663 | Bacteria | 5040914 |
| 450 | 2775672153 | 2775506739 | Bacteria | 3855222 |
| 451 | 2776616121 | 2775506987 | Bacteria | 5373360 |
| 452 | 2802651300 | 2802428842 | Bacteria | 4926114 |
| 453 | 2817414184 | 2816332280 | Bacteria | 5109718 |
| 454 | 2819549384 | 2818991437 | Bacteria | 5805520 |
| 455 | 2819549611 | 2818991437 | Bacteria | 5805520 |
| 456 | 2842724757 | 2842722452 | Bacteria | 6263924 |
| 457 | 2842727429 | 2842722452 | Bacteria | 6263924 |
| 458 | 2842913217 | 2842909656 | Bacteria | 6185908 |
| 459 | 2842913825 | 2842909656 | Bacteria | 6185908 |
| 460 | 2849283490 | 2849281842 | Bacteria | 6065644 |
| 461 | 2849285526 | 2849281842 | Bacteria | 6065644 |
| 462 | 2852630641 | 2852627209 | Bacteria | 5896285 |
| 463 | 2857631950 | 2857627736 | Bacteria | 5625397 |
| 464 | 2881361486 | 2881359912 | Bacteria | 4935907 |
| 465 | 2895501697 | 2895498888 | Bacteria | 5283788 |
| 466 | 2896345246 | 2896344016 | Bacteria | 3811746 |
| 467 | 2902048924 | 2902048731 | Bacteria | 4976191 |
| 468 | 2903895260 | 2903895155 | Bacteria | 5258610 |
| 469 | 2904447209 | 2904445276 | Bacteria | 5310396 |
| 470 | 2904449852 | 2904445276 | Bacteria | 5310396 |
| 471 | 2904783415 | 2904780799 | Bacteria | 5840761 |
| 472 | 2910248442 | 2910245624 | Bacteria | 6935613 |
| 473 | 2914761567 | 2914759650 | Bacteria | 4701441 |
| 474 | 2914761858 | 2914759650 | Bacteria | 4701441 |
| 475 | 2919099240 | 2919097161 | Bacteria | 3860339 |
| 476 | 2919181281 | 2919177583 | Bacteria | 5641607 |
| 477 | 2919190601 | 2919186247 | Bacteria | 6244071 |
| 478 | 2929153820 | 2929150217 | Bacteria | 5462483 |
| 479 | 2929155313 | 2929154850 | Bacteria | 6753285 |
| 480 | 2939669189 | 2939664404 | Bacteria | 6364494 |
| 481 | 2945926540 | 2945924605 | Bacteria | 4296724 |
| 482 | 2945998254 | 2945997725 | Bacteria | 6404843 |
| 483 | 2946001770 | 2945997725 | Bacteria | 6404843 |
| 484 | 2954018592 | 2954016120 | Bacteria | 6446024 |
| 485 | 2954020718 | 2954016120 | Bacteria | 6446024 |
| 486 | 2958459607 | 2958458903 | Bacteria | 5301041 |
| 487 | 2958513695 | 2958512119 | Bacteria | 4528530 |
| 488 | 2977272714 | 2977268062 | Bacteria | 5243061 |
| 489 | 3003237164 | 3003233435 | Bacteria | 4458031 |
| 490 | 8055420069 | 8055419101 | Bacteria | 5289643 |
| 491 | 8055596959 | 8055592153 | Bacteria | 5961247 |
| 492 | Ga0157373_10000005 | |||
| 493 | JGI24751J29686_10002780 | |||
| 494 | JGI25152J39213_1000080 | |||
| 495 | JGI25152J39213_1000173 | |||
| 496 | JGI25150J39212_1000003 | |||
| 497 | JGI25150J39212_1000004 | |||
| 498 | JGI25150J39212_1000015 | |||
| 499 | JGI25151J46595_10000002 | |||
| 500 | JGI25151J46595_10000043 | |||
| 501 | JGI25153J46596_10000009 | |||
| 502 | JGI25153J46596_10000015 | |||
| 503 | Ga0055536_1000001 | |||
| 504 | Ga0055536_1000002 | |||
| 505 | Ga0055530_10001525 | |||
| 506 | Ga0065714_10002204 | |||
| 507 | Ga0065714_10002251 | |||
| 508 | Ga0065714_10002553 | |||
| 509 | Ga0065714_10004810 | |||
| 510 | Ga0065714_10005601 | |||
| 511 | Ga0065714_10006902 | |||
| 512 | Ga0065714_10015106 | |||
| 513 | Ga0065714_10082581 | |||
| 514 | Ga0065704_10072354 | |||
| 515 | Ga0065712_10003936 | |||
| 516 | Ga0065715_10020339 | |||
| 517 | Ga0065707_10131200 | |||
| 518 | Ga0070658_10046148 | |||
| 519 | Ga0070676_10015781 | |||
| 520 | Ga0070683_100001724 | |||
| 521 | Ga0070683_100096635 | |||
| 522 | Ga0070690_100017022 | |||
| 523 | Ga0070670_100085030 | |||
| 524 | Ga0070670_100119595 | |||
| 525 | Ga0068869_100001942 | |||
| 526 | Ga0068869_100028571 | |||
| 527 | Ga0068869_100053108 | |||
| 528 | Ga0068869_100069306 | |||
| 529 | Ga0068869_100126054 | |||
| 530 | Ga0070666_10000696 | |||
| 531 | Ga0070682_100000109 | |||
| 532 | Ga0068868_100004734 | |||
| 533 | Ga0070660_100001082 | |||
| 534 | Ga0070689_100011094 | |||
| 535 | Ga0070689_100031128 | |||
| 536 | Ga0070689_100042753 | |||
| 537 | Ga0070661_100003878 | |||
| 538 | Ga0070661_100032497 | |||
| 539 | Ga0070675_100018724 | |||
| 540 | Ga0070671_100031632 | |||
| 541 | Ga0070674_100013974 | |||
| 542 | Ga0070673_100004392 | |||
| 543 | Ga0070673_100005637 | |||
| 544 | Ga0070673_100025696 | |||
| 545 | Ga0070673_100113710 | |||
| 546 | Ga0070659_100005067 | |||
| 547 | Ga0070659_100007295 | |||
| 548 | Ga0070667_100013413 | |||
| 549 | Ga0070667_100032955 | |||
| 550 | Ga0070667_100057511 | |||
| 551 | Ga0070667_100081014 | |||
| 552 | Ga0070713_100093706 | |||
| 553 | Ga0070678_100077865 | |||
| 554 | Ga0070662_100008428 | |||
| 555 | Ga0070662_100022494 | |||
| 556 | Ga0070662_100066034 | |||
| 557 | Ga0070681_10234334 | |||
| 558 | Ga0068867_100012501 | |||
| 559 | Ga0068867_100016386 | |||
| 560 | Ga0070685_10019145 | |||
| 561 | Ga0070685_10059655 | |||
| 562 | Ga0070698_100004841 | |||
| 563 | Ga0070698_100005154 | |||
| 564 | Ga0070698_100006108 | |||
| 565 | Ga0070698_100022314 | |||
| 566 | Ga0070698_100070417 | |||
| 567 | Ga0070699_100097249 | |||
| 568 | Ga0070679_100046381 | |||
| 569 | Ga0070684_100000417 | |||
| 570 | Ga0070684_100014019 | |||
| 571 | Ga0070684_100034633 | |||
| 572 | Ga0068853_100040143 | |||
| 573 | Ga0068853_100180196 | |||
| 574 | Ga0070686_100020608 | |||
| 575 | Ga0070665_100022051 | |||
| 576 | Ga0070704_100032638 | |||
| 577 | Ga0068855_100019915 | |||
| 578 | Ga0070664_100000360 | |||
| 579 | Ga0070664_100012371 | |||
| 580 | Ga0070664_100018647 | |||
| 581 | Ga0070664_100062016 | |||
| 582 | Ga0068857_100044096 | |||
| 583 | Ga0068859_100000098 | |||
| 584 | Ga0068859_100000285 | |||
| 585 | Ga0068859_100013654 | |||
| 586 | Ga0068861_100011359 | |||
| 587 | Ga0068861_100015969 | |||
| 588 | Ga0068861_100092712 | |||
| 589 | Ga0068861_100101180 | |||
| 590 | Ga0068851_10051166 | |||
| 591 | Ga0068863_100001430 | |||
| 592 | Ga0068863_100005978 | |||
| 593 | Ga0068863_100017784 | |||
| 594 | Ga0068863_100056220 | |||
| 595 | Ga0068860_100003920 | |||
| 596 | Ga0068860_100100682 | |||
| 597 | Ga0068862_100026893 | |||
| 598 | Ga0075366_10013752 | |||
| 599 | Ga0097621_100001501 | |||
| 600 | Ga0097621_100052525 | |||
| 601 | Ga0097621_100121898 | |||
| 602 | Ga0068871_100004024 | |||
| 603 | Ga0068871_100018358 | |||
| 604 | Ga0068871_100035985 | |||
| 605 | Ga0068871_100088297 | |||
| 606 | Ga0075428_100018917 | |||
| 607 | Ga0075428_100023631 | |||
| 608 | Ga0075428_100030907 | |||
| 609 | Ga0075428_100036418 | |||
| 610 | Ga0075430_100009461 | |||
| 611 | Ga0075430_100013447 | |||
| 612 | Ga0075431_100024790 | |||
| 613 | Ga0075431_100027720 | |||
| 614 | Ga0075434_100253555 | |||
| 615 | Ga0075429_100000557 | |||
| 616 | Ga0068865_100001792 | |||
| 617 | Ga0097620_100000098 | |||
| 618 | Ga0097620_100000285 | |||
| 619 | Ga0097620_100013654 | |||
| 620 | Ga0099824_1004036 | |||
| 621 | Ga0079104_1000079 | |||
| 622 | Ga0099826_10026672 | |||
| 623 | Ga0105251_10035098 | |||
| 624 | Ga0105240_10068320 | |||
| 625 | Ga0111539_10004863 | |||
| 626 | Ga0114129_10004260 | |||
| 627 | Ga0114129_10247196 | |||
| 628 | Ga0105241_10006435 | |||
| 629 | Ga0105241_10102000 | |||
| 630 | Ga0105242_10115112 | |||
| 631 | Ga0105237_10003809 | |||
| 632 | Ga0105237_10011376 | |||
| 633 | Ga0105249_10001120 | |||
| 634 | Ga0105249_10001157 | |||
| 635 | Ga0105249_10001277 | |||
| 636 | Ga0105249_10021242 | |||
| 637 | Ga0105249_10021677 | |||
| 638 | Ga0105249_10062412 | |||
| 639 | Ga0105239_10064256 | |||
| 640 | Ga0105239_10275530 | |||
| 641 | Ga0157373_10000035 | |||
| 642 | Ga0157373_10003444 | |||
| 643 | Ga0157373_10008374 | |||
| 644 | Ga0157373_10045547 | |||
| 645 | Ga0157371_10000021 | |||
| 646 | Ga0157371_10000025 | |||
| 647 | Ga0157371_10001207 | |||
| 648 | Ga0157371_10006892 | |||
| 649 | Ga0157371_10007560 | |||
| 650 | Ga0157370_10000383 | |||
| 651 | Ga0157370_10001800 | |||
| 652 | Ga0157370_10003591 | |||
| 653 | Ga0157370_10015356 | |||
| 654 | Ga0157370_10024060 | |||
| 655 | Ga0157370_10037772 | |||
| 656 | Ga0157370_10052091 | |||
| 657 | Ga0157370_10067718 | |||
| 658 | Ga0157370_10155103 | |||
| 659 | Ga0157370_10181478 | |||
| 660 | Ga0157369_10000008 | |||
| 661 | Ga0157369_10000038 | |||
| 662 | Ga0157369_10039587 | |||
| 663 | Ga0157369_10150971 | |||
| 664 | Ga0157369_10240920 | |||
| 665 | Ga0157374_10007311 | |||
| 666 | Ga0157374_10017645 | |||
| 667 | Ga0157378_10026991 | |||
| 668 | Ga0157378_10037267 | |||
| 669 | Ga0157378_10071514 | |||
| 670 | Ga0157378_10094244 | |||
| 671 | Ga0163162_10000050 | |||
| 672 | Ga0163162_10000155 | |||
| 673 | Ga0163162_10006015 | |||
| 674 | Ga0157372_10032190 | |||
| 675 | Ga0157372_10047069 | |||
| 676 | Ga0157375_10002645 | |||
| 677 | Ga0157375_10004308 | |||
| 678 | Ga0157375_10016379 | |||
| 679 | Ga0163163_10003073 | |||
| 680 | Ga0163163_10006182 | |||
| 681 | Ga0157380_10009601 | |||
| 682 | Ga0157380_10096760 | |||
| 683 | Ga0157380_10187997 | |||
| 684 | Ga0182008_10000020 | |||
| 685 | Ga0182008_10000037 | |||
| 686 | Ga0182008_10000309 | |||
| 687 | Ga0182008_10000603 | |||
| 688 | Ga0182008_10003307 | |||
| 689 | Ga0182008_10012375 | |||
| 690 | Ga0182008_10050715 | |||
| 691 | Ga0157379_10015571 | |||
| 692 | Ga0157379_10193420 | |||
| 693 | Ga0157376_10001928 | |||
| 694 | Ga0157376_10002899 | |||
| 695 | Ga0157376_10008614 | |||
| 696 | Ga0157376_10031148 | |||
| 697 | Ga0157376_10041397 | |||
| 698 | Ga0157376_10074721 | |||
| 699 | Ga0182006_1000109 | |||
| 700 | Ga0182006_1000127 | |||
| 701 | Ga0182006_1000227 | |||
| 702 | Ga0182006_1000888 | |||
| 703 | Ga0182006_1001210 | |||
| 704 | Ga0182006_1002244 | |||
| 705 | Ga0182006_1009706 | |||
| 706 | Ga0182007_10000003 | |||
| 707 | Ga0182007_10000024 | |||
| 708 | Ga0182007_10002394 | |||
| 709 | Ga0183373_1001 | |||
| 710 | Ga0183373_1002 | |||
| 711 | Ga0163161_10000136 | |||
| 712 | Ga0163161_10000470 | |||
| 713 | Ga0163161_10000815 | |||
| 714 | Ga0163161_10001151 | |||
| 715 | Ga0163161_10001518 | |||
| 716 | Ga0163161_10010250 | |||
| 717 | Ga0163161_10035915 | |||
| 718 | Ga0163161_10096055 | |||
| 719 | Ga0207425_1000003 | |||
| 720 | Ga0207425_1000023 | |||
| 721 | Ga0209129_1000014 | |||
| 722 | Ga0209129_1000032 | |||
| 723 | Ga0209676_1000008 | |||
| 724 | Ga0209676_1000022 | |||
| 725 | Ga0209025_1000007 | |||
| 726 | Ga0209025_1000047 | |||
| 727 | Ga0209758_1000012 | |||
| 728 | Ga0209758_1000144 | |||
| 729 | Ga0209050_1000020 | |||
| 730 | Ga0209050_1000343 | |||
| 731 | Ga0207680_10000120 | |||
| 732 | Ga0207680_10073094 | |||
| 733 | Ga0207647_10022367 | |||
| 734 | Ga0207645_10000334 | |||
| 735 | Ga0207645_10028538 | |||
| 736 | Ga0207654_10001306 | |||
| 737 | Ga0207671_10001247 | |||
| 738 | Ga0207671_10016536 | |||
| 739 | Ga0207657_10001634 | |||
| 740 | Ga0207649_10078781 | |||
| 741 | Ga0207650_10030282 | |||
| 742 | Ga0207650_10047930 | |||
| 743 | Ga0207650_10061601 | |||
| 744 | Ga0207650_10083152 | |||
| 745 | Ga0207644_10034862 | |||
| 746 | Ga0207644_10151665 | |||
| 747 | Ga0207690_10003665 | |||
| 748 | Ga0207706_10006057 | |||
| 749 | Ga0207706_10020425 | |||
| 750 | Ga0207686_10000405 | |||
| 751 | Ga0207686_10005263 | |||
| 752 | Ga0207670_10044244 | |||
| 753 | Ga0207670_10111807 | |||
| 754 | Ga0207669_10043503 | |||
| 755 | Ga0207691_10065090 | |||
| 756 | Ga0207691_10109635 | |||
| 757 | Ga0207689_10003219 | |||
| 758 | Ga0207689_10005450 | |||
| 759 | Ga0207689_10012712 | |||
| 760 | Ga0207689_10019387 | |||
| 761 | Ga0207689_10046567 | |||
| 762 | Ga0207689_10096391 | |||
| 763 | Ga0207661_10048895 | |||
| 764 | Ga0207661_10078337 | |||
| 765 | Ga0207679_10007831 | |||
| 766 | Ga0207679_10064690 | |||
| 767 | Ga0207667_10010203 | |||
| 768 | Ga0207651_10023979 | |||
| 769 | Ga0207651_10040522 | |||
| 770 | Ga0207651_10043655 | |||
| 771 | Ga0207651_10151296 | |||
| 772 | Ga0207712_10000821 | |||
| 773 | Ga0207712_10004491 | |||
| 774 | Ga0207712_10007724 | |||
| 775 | Ga0207712_10016604 | |||
| 776 | Ga0207712_10082854 | |||
| 777 | Ga0207640_10054545 | |||
| 778 | Ga0207658_10026332 | |||
| 779 | Ga0207658_10075616 | |||
| 780 | Ga0207703_10100305 | |||
| 781 | Ga0207703_10208091 | |||
| 782 | Ga0207639_10006556 | |||
| 783 | Ga0207639_10103832 | |||
| 784 | Ga0207639_10167908 | |||
| 785 | Ga0207678_10099642 | |||
| 786 | Ga0207641_10001054 | |||
| 787 | Ga0207641_10001908 | |||
| 788 | Ga0207641_10021870 | |||
| 789 | Ga0207641_10063206 | |||
| 790 | Ga0207641_10093210 | |||
| 791 | Ga0207641_10180517 | |||
| 792 | Ga0207648_10004255 | |||
| 793 | Ga0207648_10036523 | |||
| 794 | Ga0207648_10062347 | |||
| 795 | Ga0207676_10004127 | |||
| 796 | Ga0207676_10012612 | |||
| 797 | Ga0207676_10035567 | |||
| 798 | Ga0207674_10045060 | |||
| 799 | Ga0207674_10062516 | |||
| 800 | Ga0207675_100002484 | |||
| 801 | Ga0207675_100029305 | |||
| 802 | Ga0207675_100069416 | |||
| 803 | Ga0207675_100121459 | |||
| 804 | Ga0207683_10031001 | |||
| 805 | Ga0207698_10024279 | |||
| 806 | Ga0209281_1000367 | |||
| 807 | Ga0209489_111689 | |||
| 808 | Ga0268266_10131878 | |||
| 809 | Ga0268264_10009194 | |||
| 810 | Ga0268264_10080005 | |||
| 811 | Ga0268264_10139747 | |||
| 812 | Ga0307515_10000001 | |||
| 813 | Ga0307515_10000002 | |||
| 814 | Ga0307515_10001521 | |||
| 815 | Ga0307515_10053353 | |||
| 816 | Ga0316181_1190315 | |||
| 817 | Ga0265327_10000488 | |||
| 818 | Ga0307509_10045625 | |||
| 819 | Ga0307509_10068760 | |||
| 820 | Ga0307508_10001227 | |||
| 821 | Ga0307405_10000008 | |||
| 822 | Ga0307405_10000011 | |||
| 823 | Ga0307407_10000018 | |||
| 824 | Ga0307407_10000026 | |||
| 825 | Ga0307412_10000001 | |||
| 826 | Ga0307412_10000283 | |||
| 827 | Ga0307412_10004974 | |||
| 828 | Ga0307409_100001787 | |||
| 829 | Ga0307416_100000053 | |||
| 830 | Ga0307416_100000066 | |||
| 831 | Ga0307416_100000081 | |||
| 832 | Ga0307414_10000046 | |||
| 833 | Ga0307414_10000474 | |||
| 834 | Ga0307414_10000947 | |||
| 835 | Ga0307414_10002029 | |||
| 836 | Ga0307414_10003034 | |||
| 837 | Ga0307414_10012708 | |||
| 838 | Ga0307414_10014405 | |||
| 839 | Ga0307411_10056560 | |||
| 840 | Ga0373924_0010001 | |||
| 841 | Ga0373937_0032091 | |||
| 842 | Ga0395900_0012957 | |||
| 843 | Ga0395905_0002019 | |||
| 844 | Ga0395905_0098703 | |||
| 845 | Ga0439439_0006352 | |||
| 846 | Ga0439439_0007265 | |||
| 847 | Ga0439465_0000153 | |||
| 848 | Ga0451853_0006869 | |||
| 849 | Ga0451853_3749989 | |||
| 850 | Ga0451577_0122689 | |||
| 851 | Ga0466969_0000151 | |||
| 852 | Ga0466966_0000113 | |||
| 853 | Ga0453684_0077574 | |||
| 854 | Ga0453684_0144202 | |||
| 855 | Ga0466959_0000015 | |||
| 856 | Ga0495627_000002 | |||
| 857 | Ga0495606_0006357 | |||
| 858 | Ga0495606_0028372 | |||
| 859 | Ga0495610_0000037 | |||
| 860 | Ga0495610_0000049 | |||
| 861 | Ga0495610_0000747 | |||
| 862 | Ga0495610_0001062 | |||
| 863 | Ga0495616_0014695 | |||
| 864 | Ga0495628_0021869 | |||
| 865 | Ga0495630_0036974 | |||
| 866 | Ga0495632_0005245 | |||
| 867 | Ga0495643_0001223 | |||
| 868 | Ga0495654_0000056 | |||
| 869 | Ga0495609_0000025 | |||
| 870 | Ga0495633_0000562 | |||
| 871 | Ga0495633_0015264 | |||
| 872 | Ga0495668_0001808 | |||
| 873 | Ga0495634_0041482 | |||
| 874 | Ga0495625_0002377 | |||
| 875 | Ga0495625_0043937 | |||
| 876 | Ga0495657_0092337 | |||
| 877 | Ga0495672_0027850 | |||
| 878 | Ga0495686_0000386 | |||
| 879 | Ga0495686_0001452 | |||
| 880 | Ga0495686_0011295 | |||
| 881 | Ga0496114_0091923 | |||
| 882 | Ga0496115_0046659 | |||
| 883 | Ga0496116_0001157 | |||
| 884 | Ga0496117_0000980 | |||
| 885 | Ga0496121_0009909 | |||
| 886 | Ga0496122_0002730 | |||
| 887 | Ga0496122_0003059 | |||
| 888 | Ga0496123_0003661 | |||
| 889 | Ga0496124_0027614 | |||
| 890 | Ga0496125_0023543 | |||
| 891 | Ga0501034_0027850 | |||
| 892 | Ga0501034_0028044 | |||
| 893 | Ga0501038_0023587 | |||
| 894 | Ga0501043_0024414 | |||
| 895 | Ga0501043_0066386 | |||
| 896 | Ga0501241_000020 | |||
| 897 | Ga0501241_005760 | |||
| 898 | Ga0501269_000181 | |||
| 899 | Ga0501044_0061545 | |||
| 900 | nmdc:mga0k408_3695_c2 | |||
| 901 | nmdc:mga05p37_2426_c2 | |||
| 902 | nmdc:mga09592_4890_c1 | |||
| 903 | nmdc:mga0qj67_13768_c1 | |||
| 904 | nmdc:mga08y16_41578_c1 | |||
| 905 | nmdc:mga0n895_213443_c1 | |||
| 906 | Ga0500646_0004164 | |||
| 907 | Ga0500583_0000028 | |||
| 908 | Ga0500583_0002283 | |||
| 909 | Ga0500651_0000357 | |||
| 910 | Ga0500641_0000040 | |||
| 911 | Ga0500562_000047 | |||
| 912 | Ga0500616_0001915 | |||
| 913 | Ga0500622_0000751 | |||
| 914 | Ga0500611_000002 | |||
| 915 | Ga0500611_000008 | |||
| 916 | Ga0500661_001831 | |||
| 917 | 2520880520 | |||
| 918 | 2586208889 | |||
| 919 | 2586208942 | |||
| 920 | 2587751788 | |||
| 921 | 2587865787 | |||
| 922 | 2587943945 | |||
| 923 | 2588231824 | |||
| 924 | 2644373259 | |||
| 925 | 2644682526 | |||
| 926 | 2722731051 | |||
| 927 | 2738698315 | |||
| 928 | 2738734414 | |||
| 929 | 2738759393 | |||
| 930 | 2738763273 | |||
| 931 | 2738767172 | |||
| 932 | 2738852540 | |||
| 933 | 2738856292 | |||
| 934 | 2739215995 | |||
| 935 | 2739252641 | |||
| 936 | 2739304184 | |||
| 937 | 2739590472 | |||
| 938 | 2739591348 | |||
| 939 | 2739614787 | |||
| 940 | 2739646080 | |||
| 941 | 2775672153 | |||
| 942 | 2776616121 | |||
| 943 | 2802651300 | |||
| 944 | 2817414184 | |||
| 945 | 2819549384 | |||
| 946 | 2819549611 | |||
| 947 | 2842724757 | |||
| 948 | 2842727429 | |||
| 949 | 2842913217 | |||
| 950 | 2842913825 | |||
| 951 | 2849283490 | |||
| 952 | 2849285526 | |||
| 953 | 2852630641 | |||
| 954 | 2857631950 | |||
| 955 | 2881361486 | |||
| 956 | 2895501697 | |||
| 957 | 2896345246 | |||
| 958 | 2902048924 | |||
| 959 | 2903895260 | |||
| 960 | 2904447209 | |||
| 961 | 2904449852 | |||
| 962 | 2904783415 | |||
| 963 | 2910248442 | |||
| 964 | 2914761567 | |||
| 965 | 2914761858 | |||
| 966 | 2919099240 | |||
| 967 | 2919181281 | |||
| 968 | 2919190601 | |||
| 969 | 2929153820 | |||
| 970 | 2929155313 | |||
| 971 | 2939669189 | |||
| 972 | 2945926540 | |||
| 973 | 2945998254 | |||
| 974 | 2946001770 | |||
| 975 | 2954018592 | |||
| 976 | 2954020718 | |||
| 977 | 2958459607 | |||
| 978 | 2958513695 | |||
| 979 | 2977272714 | |||
| 980 | 3003237164 | |||
| 981 | 8055420069 | |||
| 982 | 8055596959 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3k3s-assembly3.cif.gz_C | crystal structure of altronate hydrolase (fragment 1-84) from shigella flexneri. | 0.9785 | 4 | 84 |
| 3k3s-assembly3.cif.gz_C | crystal structure of altronate hydrolase (fragment 1-84) from shigella flexneri. | 0.9227 | 4 | 84 |
| 6u7l-assembly1.cif.gz_A | 2.75 angstrom crystal structure of galactarate dehydratase from escherichia coli. | 0.8704 | 5 | 547 |
| 6u7l-assembly2.cif.gz_C | 2.75 angstrom crystal structure of galactarate dehydratase from escherichia coli. | 0.8701 | 5 | 547 |
| 6u7l-assembly1.cif.gz_B | 2.75 angstrom crystal structure of galactarate dehydratase from escherichia coli. | 0.8673 | 5 | 547 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3k3sD01 | Mainly Beta;Roll;Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4; | 0.9615 | 5 | 84 | 2.30.130.110 |
| 3k3sD01 | Mainly Beta;Roll;Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4; | 0.9173 | 5 | 84 | 2.30.130.110 |
| af_P39829_14_92_2.30.130.110 | Mainly Beta;Roll;Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4; | 0.8724 | 5 | 83 | 2.30.130.110 |
| af_P39829_14_92_2.30.130.110 | Mainly Beta;Roll;Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4; | 0.8518 | 5 | 83 | 2.30.130.110 |
| af_Q9VEN6_71_200_3.30.420.80 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribosomal protein S11/S14 | 0.5851 | 211 | 272 | 3.30.420.80 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Q5QFK8-F1-model_v4 | Altronate dehydratase | 1.003 | 1 | 85 |
GO:0016829
GO:0019698 |
| AF-A0A2V9BGE4-F1-model_v4 | Altronate hydrolase | 1.002 | 1 | 75 |
GO:0016787
GO:0016829 |
| AF-A0A4Q5QFK8-F1-model_v4 | Altronate dehydratase | 0.9917 | 1 | 85 |
GO:0016829
GO:0019698 |
| AF-A0A2V9BGE4-F1-model_v4 | Altronate hydrolase | 0.9887 | 1 | 75 |
GO:0016787
GO:0016829 |
| AF-A0A5J4RPN1-F1-model_v4 | Altronate dehydratase (EC 4.2.1.7) | 0.9833 | 3 | 84 |
GO:0008789
GO:0019698 |