F454095

General Info

Members Datasets Scaffolds Average Seq Length
491 262 982 548

Family's Representative Sequence

Representative Sequence 3300013100|Ga0157373_10000005|Ga0157373_10000005217
Length 578
Sequence VIFLEQHLYERKICRTILKRIFAHFALKKQIKMINLILKINHKDNVLVALQDIPAETEIIFEGVTYTTLEAIPAKHKFFMNDMKQGDEIFMYGVLVGKVQYDLAAGTRMTTDNTKHAAEPYYYRDVDYHWTKPDVSRFLHKTFKGYHRSNGDVGTANYWLFIPTVFCENRNLDIIKESLYDNLGYAVDAKYKDYTHQLVEAISKGENIDDLNFSPSNIPAKERVFKNVDGIKFLNHTGGCGGTRQDADTLSKLLASYADHPNVAGVTLLSLGCQHLQIDNFKKDLYNRNPDFDKPLLVFEQQKAVSEETMIKNAIFETLKGLLEINKIEREDAPISKLCVGVKCGGSDGFSGISANPAVGHLADILSVLGAKVLLAEFPELCGVEQELIDRAVDKPTAEKFIRLMTEYDELAHAVGSGFYMNPSPGNIKDGLITDAIKSAGAAKKGGSAPVVDVLDYTEPATKPGLSLVCTPGNDVEATTGKAASGATLILFTTGLGTPTGNPVCPVMKVATNTILATKMSDIIDIDTGAVVRGEKTIQEMGEDILDFCIDVASGNIIPKAVALNQDDFIPWKRGVSL

Samples

Sample ID Description Type Environment
1 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
4 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
5 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
8 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
9 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
11 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
12 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
60 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
66 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
67 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
68 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
78 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
91 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
92 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
93 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
94 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
95 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
96 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
98 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
99 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
134 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
135 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
138 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
139 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
140 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
141 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
142 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
143 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
144 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
145 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
146 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
147 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
148 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
149 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
150 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
151 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
152 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
153 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
154 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
155 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
156 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
157 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
158 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
159 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
160 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
161 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
162 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
163 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
164 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
165 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
166 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
167 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
168 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
169 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
170 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
171 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
172 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
173 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
174 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
175 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
176 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
177 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
178 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
179 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
180 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
181 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
182 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
183 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
184 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
185 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
186 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
187 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
191 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
192 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
193 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
194 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
195 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
196 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
197 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
198 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
199 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
200 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
201 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
202 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
203 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
204 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
205 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
206 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
207 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
208 2519899754 Flavobacterium sp. F52 Isolate Rhizosphere
209 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
210 2585428061 Chryseobacterium sp. CF356 Isolate Rhizosphere
211 2585428095 Chryseobacterium sp. YR005 Isolate Rhizosphere
212 2585428115 Chryseobacterium sp. YR561 Isolate Rhizosphere
213 2585428187 Chryseobacterium sp. YR460 Isolate Rhizosphere
214 2643221667 Flavobacterium sp. Root420 Isolate Unclassified
215 2643221725 Flavobacterium sp. Root935 Isolate Unclassified
216 2721755487 Sphingobacterium sp. B29 Isolate Rhizosphere
217 2738541273 Elizabethkingia sp. YR214 Isolate Unclassified
218 2738541279 Flavobacterium sp. GV069 Isolate Unclassified
219 2738541283 Pedobacter sp. OK701 Isolate Unclassified
220 2738541284 Pedobacter sp. YR016 Isolate Unclassified
221 2738541285 Flavobacterium sp. GV030 Isolate Unclassified
222 2738541302 Pedobacter sp. CF074 Isolate Unclassified
223 2738543007 Flavobacterium sp. GV063 Isolate Unclassified
224 2738543014 Elizabethkingia sp. YR191 Isolate Unclassified
225 2738543023 Pedobacter sp. OK628 Isolate Unclassified
226 2739367651 Pedobacter sp. OK291 Isolate Unclassified
227 2739367656 Pedobacter sp. CF523 Isolate Unclassified
228 2739367663 Pedobacter sp. YR510 Isolate Unclassified
229 2775506739 Chryseobacterium sp. 1335 Isolate Unclassified
230 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
231 2802428842 Flavobacterium sp. S87F.05.LMB.W.Kidney.N Isolate Unclassified
232 2816332280 Flavobacterium johnsoniae GSE09 Isolate Unclassified
233 2818991437 Pedobacter terrae 518 Isolate Unclassified
234 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
235 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
236 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
237 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
238 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
239 2881359912 Flavobacterium ustbae T13 Isolate Rhizosphere
240 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
241 2896344016 Sphingobacterium sp. SGL-16 Isolate Rhizosphere
242 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
243 2903895155 Flavobacterium sp. HBTb2-11-1 Isolate Rhizosphere
244 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
245 2904780799 Sphingobacterium sp. 1304 Isolate Rhizosphere
246 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere
247 2914759650 Rhizosphaericola mali Isolate Rhizosphere
248 2919097161 Chryseobacterium ginsenosidimutans 1394 Isolate Rhizosphere
249 2919177583 Sphingobacterium sp. 2149 Isolate Rhizosphere
250 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
251 2929150217 Flavobacterium sp. R-74510 Hybrid assembly Isolate Unclassified
252 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
253 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
254 2945924605 Chryseobacterium ginsenosidimutans W1I9 Isolate Rhizosphere
255 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
256 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
257 2958458903 Flavobacterium anhuiense RCM74 Isolate Rhizosphere
258 2958512119 Flavobacterium sp. Sd200 Isolate Rhizosphere
259 2977268062 Flavobacterium sp. SORGH_AS 622 Isolate Unclassified
260 3003233435 Sphingobacterium shayense CrR18 Isolate Unclassified
261 8055419101 Flavobacterium tyrosinilyticum KCTC 42726 Isolate Rhizosphere
262 8055592153 Flavobacterium panacis DCY106 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 86.56
Metatranscriptomes 0
Isolates 13.44

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.54
Nodule 1.02
Rhizoplane 0.41
Rhizosphere 81.26
Stem 0
Stem Tuber 0
Unclassified 1.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157373_10000005 3300013100 Bacteria 262158
2 JGI24751J29686_10002780 3300002459 Bacteria 3519
3 JGI25152J39213_1000080 3300002773 Bacteria 65432
4 JGI25152J39213_1000173 3300002773 Bacteria 43619
5 JGI25150J39212_1000003 3300002774 Bacteria 508651
6 JGI25150J39212_1000004 3300002774 Bacteria 417320
7 JGI25150J39212_1000015 3300002774 Bacteria 170613
8 JGI25151J46595_10000002 3300003187 Bacteria 731381
9 JGI25151J46595_10000043 3300003187 Bacteria 170613
10 JGI25153J46596_10000009 3300003215 Bacteria 340925
11 JGI25153J46596_10000015 3300003215 Bacteria 289820
12 Ga0055536_1000001 3300003781 Bacteria 630663
13 Ga0055536_1000002 3300003781 Bacteria 605605
14 Ga0055530_10001525 3300003791 Bacteria 16697
15 Ga0065714_10002204 3300005288 Bacteria 57902
16 Ga0065714_10002251 3300005288 Bacteria 34173
17 Ga0065714_10002553 3300005288 Bacteria 19114
18 Ga0065714_10004810 3300005288 Bacteria 6804
19 Ga0065714_10005601 3300005288 Bacteria 3769
20 Ga0065714_10006902 3300005288 Bacteria 3689
21 Ga0065714_10015106 3300005288 Bacteria 5772
22 Ga0065714_10082581 3300005288 Bacteria 2233
23 Ga0065704_10072354 3300005289 Bacteria 8680
24 Ga0065712_10003936 3300005290 Bacteria 3448
25 Ga0065715_10020339 3300005293 Bacteria 2593
26 Ga0065707_10131200 3300005295 Bacteria 1917
27 Ga0070658_10046148 3300005327 Bacteria 3526
28 Ga0070676_10015781 3300005328 Bacteria 4166
29 Ga0070683_100001724 3300005329 Bacteria 17005
30 Ga0070683_100096635 3300005329 Bacteria 2779
31 Ga0070690_100017022 3300005330 Bacteria 4364
32 Ga0070670_100085030 3300005331 Bacteria 2718
33 Ga0070670_100119595 3300005331 Bacteria 2272
34 Ga0068869_100001942 3300005334 Bacteria 12403
35 Ga0068869_100028571 3300005334 Bacteria 3899
36 Ga0068869_100053108 3300005334 Bacteria 2944
37 Ga0068869_100069306 3300005334 Bacteria 2607
38 Ga0068869_100126054 3300005334 Bacteria 1963
39 Ga0070666_10000696 3300005335 Bacteria 20362
40 Ga0070682_100000109 3300005337 Bacteria 73659
41 Ga0068868_100004734 3300005338 Bacteria 9556
42 Ga0070660_100001082 3300005339 Bacteria 18309
43 Ga0070689_100011094 3300005340 Bacteria 6446
44 Ga0070689_100031128 3300005340 Bacteria 4054
45 Ga0070689_100042753 3300005340 Bacteria 3480
46 Ga0070661_100003878 3300005344 Bacteria 10295
47 Ga0070661_100032497 3300005344 Bacteria 3778
48 Ga0070675_100018724 3300005354 Bacteria 5512
49 Ga0070671_100031632 3300005355 Bacteria 4372
50 Ga0070674_100013974 3300005356 Bacteria 4980
51 Ga0070673_100004392 3300005364 Bacteria 8912
52 Ga0070673_100005637 3300005364 Bacteria 8036
53 Ga0070673_100025696 3300005364 Bacteria 4339
54 Ga0070673_100113710 3300005364 Bacteria 2248
55 Ga0070659_100005067 3300005366 Bacteria 9446
56 Ga0070659_100007295 3300005366 Bacteria 8025
57 Ga0070667_100013413 3300005367 Bacteria 6774
58 Ga0070667_100032955 3300005367 Bacteria 4324
59 Ga0070667_100057511 3300005367 Bacteria 3287
60 Ga0070667_100081014 3300005367 Bacteria 2777
61 Ga0070713_100093706 3300005436 Bacteria 2588
62 Ga0070678_100077865 3300005456 Bacteria 2502
63 Ga0070662_100008428 3300005457 Bacteria 6720
64 Ga0070662_100022494 3300005457 Bacteria 4318
65 Ga0070662_100066034 3300005457 Bacteria 2654
66 Ga0070681_10234334 3300005458 Bacteria 1750
67 Ga0068867_100012501 3300005459 Bacteria 6008
68 Ga0068867_100016386 3300005459 Bacteria 5261
69 Ga0070685_10019145 3300005466 Bacteria 3691
70 Ga0070685_10059655 3300005466 Bacteria 2228
71 Ga0070698_100004841 3300005471 Bacteria 14779
72 Ga0070698_100005154 3300005471 Bacteria 14294
73 Ga0070698_100006108 3300005471 Bacteria 13114
74 Ga0070698_100022314 3300005471 Bacteria 6622
75 Ga0070698_100070417 3300005471 Bacteria 3510
76 Ga0070699_100097249 3300005518 Bacteria 2579
77 Ga0070679_100046381 3300005530 Bacteria 4331
78 Ga0070684_100000417 3300005535 Bacteria 29183
79 Ga0070684_100014019 3300005535 Bacteria 6481
80 Ga0070684_100034633 3300005535 Bacteria 4318
81 Ga0068853_100040143 3300005539 Bacteria 3992
82 Ga0068853_100180196 3300005539 Bacteria 1916
83 Ga0070686_100020608 3300005544 Bacteria 3904
84 Ga0070665_100022051 3300005548 Bacteria 6407
85 Ga0070704_100032638 3300005549 Bacteria 3514
86 Ga0068855_100019915 3300005563 Bacteria 8057
87 Ga0070664_100000360 3300005564 Bacteria 33570
88 Ga0070664_100012371 3300005564 Bacteria 6935
89 Ga0070664_100018647 3300005564 Bacteria 5705
90 Ga0070664_100062016 3300005564 Bacteria 3187
91 Ga0068857_100044096 3300005577 Bacteria 3955
92 Ga0068859_100000098 3300005617 Bacteria 80555
93 Ga0068859_100000285 3300005617 Bacteria 50405
94 Ga0068859_100013654 3300005617 Bacteria 8143
95 Ga0068861_100011359 3300005719 Bacteria 6186
96 Ga0068861_100015969 3300005719 Bacteria 5302
97 Ga0068861_100092712 3300005719 Bacteria 2386
98 Ga0068861_100101180 3300005719 Bacteria 2292
99 Ga0068851_10051166 3300005834 Bacteria 2099
100 Ga0068863_100001430 3300005841 Bacteria 23658
101 Ga0068863_100005978 3300005841 Bacteria 11939
102 Ga0068863_100017784 3300005841 Bacteria 6803
103 Ga0068863_100056220 3300005841 Bacteria 3726
104 Ga0068860_100003920 3300005843 Bacteria 15287
105 Ga0068860_100100682 3300005843 Bacteria 2757
106 Ga0068862_100026893 3300005844 Bacteria 4838
107 Ga0075366_10013752 3300006195 Bacteria 4612
108 Ga0097621_100001501 3300006237 Bacteria 15978
109 Ga0097621_100052525 3300006237 Unclassified 3321
110 Ga0097621_100121898 3300006237 Bacteria 2212
111 Ga0068871_100004024 3300006358 Bacteria 10153
112 Ga0068871_100018358 3300006358 Bacteria 5314
113 Ga0068871_100035985 3300006358 Bacteria 3938
114 Ga0068871_100088297 3300006358 Bacteria 2579
115 Ga0075428_100018917 3300006844 Bacteria 7617
116 Ga0075428_100023631 3300006844 Bacteria 6804
117 Ga0075428_100030907 3300006844 Bacteria 5922
118 Ga0075428_100036418 3300006844 Bacteria 5419
119 Ga0075430_100009461 3300006846 Bacteria 8235
120 Ga0075430_100013447 3300006846 Bacteria 6977
121 Ga0075431_100024790 3300006847 Bacteria 6149
122 Ga0075431_100027720 3300006847 Bacteria 5814
123 Ga0075434_100253555 3300006871 Bacteria 1778
124 Ga0075429_100000557 3300006880 Bacteria 28537
125 Ga0068865_100001792 3300006881 Bacteria 12609
126 Ga0097620_100000098 3300006931 Bacteria 80555
127 Ga0097620_100000285 3300006931 Bacteria 50405
128 Ga0097620_100013654 3300006931 Bacteria 8143
129 Ga0099824_1004036 3300006942 Bacteria 21249
130 Ga0079104_1000079 3300006946 Bacteria 141480
131 Ga0099826_10026672 3300006948 Bacteria 4257
132 Ga0105251_10035098 3300009011 Bacteria 2476
133 Ga0105240_10068320 3300009093 Bacteria 4402
134 Ga0111539_10004863 3300009094 Bacteria 17500
135 Ga0114129_10004260 3300009147 Bacteria 20220
136 Ga0114129_10247196 3300009147 Bacteria 2396
137 Ga0105241_10006435 3300009174 Bacteria 8656
138 Ga0105241_10102000 3300009174 Bacteria 2283
139 Ga0105242_10115112 3300009176 Bacteria 2299
140 Ga0105237_10003809 3300009545 Bacteria 17731
141 Ga0105237_10011376 3300009545 Bacteria 9413
142 Ga0105249_10001120 3300009553 Bacteria 23848
143 Ga0105249_10001157 3300009553 Bacteria 23330
144 Ga0105249_10001277 3300009553 Bacteria 22079
145 Ga0105249_10021242 3300009553 Bacteria 5813
146 Ga0105249_10021677 3300009553 Bacteria 5752
147 Ga0105249_10062412 3300009553 Bacteria 3422
148 Ga0105239_10064256 3300010375 Bacteria 4029
149 Ga0105239_10275530 3300010375 Bacteria 1893
150 Ga0157373_10000035 3300013100 Bacteria 123284
151 Ga0157373_10003444 3300013100 Bacteria 11972
152 Ga0157373_10008374 3300013100 Bacteria 7681
153 Ga0157373_10045547 3300013100 Bacteria 3131
154 Ga0157371_10000021 3300013102 Bacteria 301017
155 Ga0157371_10000025 3300013102 Bacteria 279746
156 Ga0157371_10001207 3300013102 Bacteria 27564
157 Ga0157371_10006892 3300013102 Bacteria 9275
158 Ga0157371_10007560 3300013102 Bacteria 8777
159 Ga0157370_10000383 3300013104 Bacteria 55670
160 Ga0157370_10001800 3300013104 Bacteria 26427
161 Ga0157370_10003591 3300013104 Bacteria 18145
162 Ga0157370_10015356 3300013104 Bacteria 7784
163 Ga0157370_10024060 3300013104 Bacteria 6038
164 Ga0157370_10037772 3300013104 Bacteria 4677
165 Ga0157370_10052091 3300013104 Bacteria 3908
166 Ga0157370_10067718 3300013104 Bacteria 3375
167 Ga0157370_10155103 3300013104 Bacteria 2130
168 Ga0157370_10181478 3300013104 Bacteria 1956
169 Ga0157369_10000008 3300013105 Bacteria 309315
170 Ga0157369_10000038 3300013105 Bacteria 189078
171 Ga0157369_10039587 3300013105 Bacteria 5151
172 Ga0157369_10150971 3300013105 Bacteria 2455
173 Ga0157369_10240920 3300013105 Bacteria 1889
174 Ga0157374_10007311 3300013296 Bacteria 9415
175 Ga0157374_10017645 3300013296 Bacteria 6288
176 Ga0157378_10026991 3300013297 Bacteria 5065
177 Ga0157378_10037267 3300013297 Bacteria 4306
178 Ga0157378_10071514 3300013297 Bacteria 3115
179 Ga0157378_10094244 3300013297 Bacteria 2726
180 Ga0163162_10000050 3300013306 Bacteria 120151
181 Ga0163162_10000155 3300013306 Bacteria 63251
182 Ga0163162_10006015 3300013306 Bacteria 11744
183 Ga0157372_10032190 3300013307 Bacteria 5747
184 Ga0157372_10047069 3300013307 Bacteria 4790
185 Ga0157375_10002645 3300013308 Bacteria 15517
186 Ga0157375_10004308 3300013308 Bacteria 12343
187 Ga0157375_10016379 3300013308 Bacteria 6657
188 Ga0163163_10003073 3300014325 Bacteria 14131
189 Ga0163163_10006182 3300014325 Bacteria 10440
190 Ga0157380_10009601 3300014326 Bacteria 6941
191 Ga0157380_10096760 3300014326 Unclassified 2448
192 Ga0157380_10187997 3300014326 Bacteria 1821
193 Ga0182008_10000020 3300014497 Bacteria 228333
194 Ga0182008_10000037 3300014497 Bacteria 129884
195 Ga0182008_10000309 3300014497 Bacteria 38347
196 Ga0182008_10000603 3300014497 Bacteria 26394
197 Ga0182008_10003307 3300014497 Bacteria 9801
198 Ga0182008_10012375 3300014497 Bacteria 4504
199 Ga0182008_10050715 3300014497 Bacteria 2060
200 Ga0157379_10015571 3300014968 Bacteria 6676
201 Ga0157379_10193420 3300014968 Bacteria 1838
202 Ga0157376_10001928 3300014969 Bacteria 13861
203 Ga0157376_10002899 3300014969 Bacteria 11760
204 Ga0157376_10008614 3300014969 Bacteria 7373
205 Ga0157376_10031148 3300014969 Unclassified 4267
206 Ga0157376_10041397 3300014969 Bacteria 3771
207 Ga0157376_10074721 3300014969 Bacteria 2890
208 Ga0182006_1000109 3300015261 Bacteria 89541
209 Ga0182006_1000127 3300015261 Bacteria 81679
210 Ga0182006_1000227 3300015261 Bacteria 53817
211 Ga0182006_1000888 3300015261 Bacteria 20046
212 Ga0182006_1001210 3300015261 Bacteria 16125
213 Ga0182006_1002244 3300015261 Bacteria 10677
214 Ga0182006_1009706 3300015261 Bacteria 4305
215 Ga0182007_10000003 3300015262 Bacteria 548244
216 Ga0182007_10000024 3300015262 Bacteria 181761
217 Ga0182007_10002394 3300015262 Bacteria 9379
218 Ga0183373_1001 3300015682 Bacteria 1410374
219 Ga0183373_1002 3300015682 Bacteria 990153
220 Ga0163161_10000136 3300017792 Bacteria 69043
221 Ga0163161_10000470 3300017792 Bacteria 33480
222 Ga0163161_10000815 3300017792 Bacteria 24459
223 Ga0163161_10001151 3300017792 Bacteria 19912
224 Ga0163161_10001518 3300017792 Bacteria 17178
225 Ga0163161_10010250 3300017792 Bacteria 6489
226 Ga0163161_10035915 3300017792 Bacteria 3548
227 Ga0163161_10096055 3300017792 Bacteria 2199
228 Ga0207425_1000003 3300025245 Bacteria 1145342
229 Ga0207425_1000023 3300025245 Bacteria 341339
230 Ga0209129_1000014 3300025258 Bacteria 509018
231 Ga0209129_1000032 3300025258 Bacteria 341150
232 Ga0209676_1000008 3300025292 Bacteria 991778
233 Ga0209676_1000022 3300025292 Bacteria 605659
234 Ga0209025_1000007 3300025294 Bacteria 1145109
235 Ga0209025_1000047 3300025294 Bacteria 341150
236 Ga0209758_1000012 3300025297 Bacteria 949866
237 Ga0209758_1000144 3300025297 Bacteria 170724
238 Ga0209050_1000020 3300025298 Bacteria 605671
239 Ga0209050_1000343 3300025298 Bacteria 92045
240 Ga0207680_10000120 3300025903 Bacteria 36545
241 Ga0207680_10073094 3300025903 Bacteria 2131
242 Ga0207647_10022367 3300025904 Bacteria 4200
243 Ga0207645_10000334 3300025907 Bacteria 39321
244 Ga0207645_10028538 3300025907 Bacteria 3602
245 Ga0207654_10001306 3300025911 Bacteria 13282
246 Ga0207671_10001247 3300025914 Bacteria 29996
247 Ga0207671_10016536 3300025914 Bacteria 5729
248 Ga0207657_10001634 3300025919 Bacteria 24147
249 Ga0207649_10078781 3300025920 Bacteria 2127
250 Ga0207650_10030282 3300025925 Bacteria 3897
251 Ga0207650_10047930 3300025925 Bacteria 3150
252 Ga0207650_10061601 3300025925 Bacteria 2801
253 Ga0207650_10083152 3300025925 Bacteria 2431
254 Ga0207644_10034862 3300025931 Bacteria 3523
255 Ga0207644_10151665 3300025931 Bacteria 1794
256 Ga0207690_10003665 3300025932 Bacteria 9145
257 Ga0207706_10006057 3300025933 Bacteria 11244
258 Ga0207706_10020425 3300025933 Bacteria 5955
259 Ga0207686_10000405 3300025934 Bacteria 29880
260 Ga0207686_10005263 3300025934 Bacteria 6943
261 Ga0207670_10044244 3300025936 Bacteria 2945
262 Ga0207670_10111807 3300025936 Bacteria 1970
263 Ga0207669_10043503 3300025937 Bacteria 2631
264 Ga0207691_10065090 3300025940 Bacteria 3301
265 Ga0207691_10109635 3300025940 Bacteria 2456
266 Ga0207689_10003219 3300025942 Bacteria 14956
267 Ga0207689_10005450 3300025942 Bacteria 11387
268 Ga0207689_10012712 3300025942 Bacteria 7192
269 Ga0207689_10019387 3300025942 Bacteria 5734
270 Ga0207689_10046567 3300025942 Bacteria 3584
271 Ga0207689_10096391 3300025942 Bacteria 2429
272 Ga0207661_10048895 3300025944 Bacteria 3363
273 Ga0207661_10078337 3300025944 Bacteria 2720
274 Ga0207679_10007831 3300025945 Bacteria 6789
275 Ga0207679_10064690 3300025945 Bacteria 2734
276 Ga0207667_10010203 3300025949 Bacteria 11001
277 Ga0207651_10023979 3300025960 Bacteria 3765
278 Ga0207651_10040522 3300025960 Bacteria 3082
279 Ga0207651_10043655 3300025960 Bacteria 2994
280 Ga0207651_10151296 3300025960 Bacteria 1807
281 Ga0207712_10000821 3300025961 Bacteria 22848
282 Ga0207712_10004491 3300025961 Bacteria 8811
283 Ga0207712_10007724 3300025961 Bacteria 6802
284 Ga0207712_10016604 3300025961 Bacteria 4772
285 Ga0207712_10082854 3300025961 Unclassified 2339
286 Ga0207640_10054545 3300025981 Bacteria 2614
287 Ga0207658_10026332 3300025986 Bacteria 4077
288 Ga0207658_10075616 3300025986 Bacteria 2563
289 Ga0207703_10100305 3300026035 Bacteria 2453
290 Ga0207703_10208091 3300026035 Bacteria 1742
291 Ga0207639_10006556 3300026041 Bacteria 7914
292 Ga0207639_10103832 3300026041 Bacteria 2303
293 Ga0207639_10167908 3300026041 Bacteria 1855
294 Ga0207678_10099642 3300026067 Bacteria 2482
295 Ga0207641_10001054 3300026088 Bacteria 27824
296 Ga0207641_10001908 3300026088 Bacteria 20026
297 Ga0207641_10021870 3300026088 Bacteria 5258
298 Ga0207641_10063206 3300026088 Bacteria 3162
299 Ga0207641_10093210 3300026088 Bacteria 2639
300 Ga0207641_10180517 3300026088 Bacteria 1933
301 Ga0207648_10004255 3300026089 Bacteria 14783
302 Ga0207648_10036523 3300026089 Bacteria 4328
303 Ga0207648_10062347 3300026089 Bacteria 3250
304 Ga0207676_10004127 3300026095 Bacteria 10254
305 Ga0207676_10012612 3300026095 Bacteria 6062
306 Ga0207676_10035567 3300026095 Bacteria 3782
307 Ga0207674_10045060 3300026116 Bacteria 4540
308 Ga0207674_10062516 3300026116 Bacteria 3761
309 Ga0207675_100002484 3300026118 Bacteria 18257
310 Ga0207675_100029305 3300026118 Bacteria 5129
311 Ga0207675_100069416 3300026118 Bacteria 3294
312 Ga0207675_100121459 3300026118 Bacteria 2472
313 Ga0207683_10031001 3300026121 Bacteria 4639
314 Ga0207698_10024279 3300026142 Bacteria 4252
315 Ga0209281_1000367 3300027111 Bacteria 73152
316 Ga0209489_111689 3300027361 Bacteria 8728
317 Ga0268266_10131878 3300028379 Bacteria 2236
318 Ga0268264_10009194 3300028381 Bacteria 8187
319 Ga0268264_10080005 3300028381 Bacteria 2790
320 Ga0268264_10139747 3300028381 Bacteria 2158
321 Ga0307515_10000001 3300028794 Bacteria 4259510
322 Ga0307515_10000002 3300028794 Bacteria 1231751
323 Ga0307515_10001521 3300028794 Bacteria 51888
324 Ga0307515_10053353 3300028794 Bacteria 5968
325 Ga0316181_1190315 3300030744 Bacteria 3579
326 Ga0265327_10000488 3300031251 Bacteria 69809
327 Ga0307509_10045625 3300031507 Bacteria 4724
328 Ga0307509_10068760 3300031507 Bacteria 3705
329 Ga0307508_10001227 3300031616 Bacteria 29288
330 Ga0307405_10000008 3300031731 Bacteria 264953
331 Ga0307405_10000011 3300031731 Bacteria 241071
332 Ga0307407_10000018 3300031903 Bacteria 135979
333 Ga0307407_10000026 3300031903 Bacteria 108029
334 Ga0307412_10000001 3300031911 Bacteria 822691
335 Ga0307412_10000283 3300031911 Bacteria 32305
336 Ga0307412_10004974 3300031911 Bacteria 7428
337 Ga0307409_100001787 3300031995 Bacteria 10863
338 Ga0307416_100000053 3300032002 Bacteria 108029
339 Ga0307416_100000066 3300032002 Bacteria 94549
340 Ga0307416_100000081 3300032002 Bacteria 65986
341 Ga0307414_10000046 3300032004 Bacteria 133496
342 Ga0307414_10000474 3300032004 Bacteria 21053
343 Ga0307414_10000947 3300032004 Bacteria 14835
344 Ga0307414_10002029 3300032004 Bacteria 10513
345 Ga0307414_10003034 3300032004 Bacteria 8901
346 Ga0307414_10012708 3300032004 Bacteria 4991
347 Ga0307414_10014405 3300032004 Bacteria 4740
348 Ga0307411_10056560 3300032005 Bacteria 2586
349 Ga0373924_0010001 3300035410 Bacteria 3491
350 Ga0373937_0032091 3300036401 Bacteria 4762
351 Ga0395900_0012957 3300037418 Bacteria 8520
352 Ga0395905_0002019 3300037471 Bacteria 23194
353 Ga0395905_0098703 3300037471 Bacteria 2743
354 Ga0439439_0006352 3300041406 Bacteria 2733
355 Ga0439439_0007265 3300041406 Bacteria 2587
356 Ga0439465_0000153 3300041413 Bacteria 17071
357 Ga0451853_0006869 3300041512 Bacteria 2965
358 Ga0451853_3749989 3300041512 Unclassified 4943
359 Ga0451577_0122689 3300042876 Bacteria 2327
360 Ga0466969_0000151 3300044656 Bacteria 37632
361 Ga0466966_0000113 3300044684 Bacteria 49984
362 Ga0453684_0077574 3300044712 Bacteria 4162
363 Ga0453684_0144202 3300044712 Bacteria 2839
364 Ga0466959_0000015 3300045049 Bacteria 149242
365 Ga0495627_000002 3300046453 Bacteria 903861
366 Ga0495606_0006357 3300046507 Bacteria 10922
367 Ga0495606_0028372 3300046507 Bacteria 3949
368 Ga0495610_0000037 3300046512 Bacteria 186354
369 Ga0495610_0000049 3300046512 Bacteria 149009
370 Ga0495610_0000747 3300046512 Bacteria 30695
371 Ga0495610_0001062 3300046512 Bacteria 25264
372 Ga0495616_0014695 3300046513 Bacteria 4375
373 Ga0495628_0021869 3300046516 Bacteria 5257
374 Ga0495630_0036974 3300046517 Bacteria 3650
375 Ga0495632_0005245 3300046519 Bacteria 8619
376 Ga0495643_0001223 3300046522 Bacteria 24830
377 Ga0495654_0000056 3300046530 Bacteria 140658
378 Ga0495609_0000025 3300046538 Bacteria 256898
379 Ga0495633_0000562 3300046558 Bacteria 36317
380 Ga0495633_0015264 3300046558 Bacteria 3989
381 Ga0495668_0001808 3300046616 Bacteria 19480
382 Ga0495634_0041482 3300046642 Bacteria 3125
383 Ga0495625_0002377 3300046660 Bacteria 20476
384 Ga0495625_0043937 3300046660 Bacteria 3237
385 Ga0495657_0092337 3300046675 Bacteria 1940
386 Ga0495672_0027850 3300047320 Bacteria 3585
387 Ga0495686_0000386 3300047472 Bacteria 70225
388 Ga0495686_0001452 3300047472 Bacteria 25815
389 Ga0495686_0011295 3300047472 Bacteria 6296
390 Ga0496114_0091923 3300048917 Bacteria 2578
391 Ga0496115_0046659 3300048918 Bacteria 3464
392 Ga0496116_0001157 3300048919 Bacteria 31125
393 Ga0496117_0000980 3300048920 Bacteria 43732
394 Ga0496121_0009909 3300048924 Bacteria 10846
395 Ga0496122_0002730 3300048925 Bacteria 24410
396 Ga0496122_0003059 3300048925 Bacteria 22617
397 Ga0496123_0003661 3300048926 Bacteria 16971
398 Ga0496124_0027614 3300048927 Bacteria 5091
399 Ga0496125_0023543 3300048928 Bacteria 5683
400 Ga0501034_0027850 3300049571 Bacteria 5746
401 Ga0501034_0028044 3300049571 Bacteria 5726
402 Ga0501038_0023587 3300049574 Bacteria 5498
403 Ga0501043_0024414 3300049579 Bacteria 4744
404 Ga0501043_0066386 3300049579 Bacteria 2833
405 Ga0501241_000020 3300049758 Bacteria 83005
406 Ga0501241_005760 3300049758 Bacteria 2300
407 Ga0501269_000181 3300049766 Bacteria 19450
408 Ga0501044_0061545 3300049823 Bacteria 3840
409 nmdc:mga0k408_3695_c2 3300050493 Bacteria 5638
410 nmdc:mga05p37_2426_c2 3300050507 Bacteria 15408
411 nmdc:mga09592_4890_c1 3300050508 Bacteria 10852
412 nmdc:mga0qj67_13768_c1 3300050509 Bacteria 6105
413 nmdc:mga08y16_41578_c1 3300050511 Bacteria 4815
414 nmdc:mga0n895_213443_c1 3300050512 Bacteria 1960
415 Ga0500646_0004164 3300053090 Bacteria 3670
416 Ga0500583_0000028 3300053092 Bacteria 108276
417 Ga0500583_0002283 3300053092 Bacteria 5721
418 Ga0500651_0000357 3300053093 Bacteria 25575
419 Ga0500641_0000040 3300053096 Bacteria 68174
420 Ga0500562_000047 3300053108 Bacteria 62430
421 Ga0500616_0001915 3300053153 Bacteria 18592
422 Ga0500622_0000751 3300053156 Bacteria 28221
423 Ga0500611_000002 3300053727 Bacteria 345991
424 Ga0500611_000008 3300053727 Bacteria 198346
425 Ga0500661_001831 3300055283 Bacteria 4014
426 2520880520 2519899754 Bacteria 5336938
427 2586208889 2585427687 Bacteria 5544917
428 2586208942 2585427687 Bacteria 5544917
429 2587751788 2585428061 Bacteria 3939663
430 2587865787 2585428095 Bacteria 3789702
431 2587943945 2585428115 Bacteria 4420269
432 2588231824 2585428187 Bacteria 4629388
433 2644373259 2643221667 Bacteria 5627472
434 2644682526 2643221725 Bacteria 5087956
435 2722731051 2721755487 Bacteria 6357185
436 2738698315 2738541273 Bacteria 4048577
437 2738734414 2738541279 Bacteria 6149495
438 2738759393 2738541283 Bacteria 7222293
439 2738763273 2738541284 Bacteria 5199923
440 2738767172 2738541285 Bacteria 6150075
441 2738852540 2738541302 Bacteria 5944758
442 2738856292 2738541302 Bacteria 5944758
443 2739215995 2738543007 Bacteria 6149845
444 2739252641 2738543014 Bacteria 4048139
445 2739304184 2738543023 Bacteria 6767879
446 2739590472 2739367651 Bacteria 6359826
447 2739591348 2739367651 Bacteria 6359826
448 2739614787 2739367656 Bacteria 5152243
449 2739646080 2739367663 Bacteria 5040914
450 2775672153 2775506739 Bacteria 3855222
451 2776616121 2775506987 Bacteria 5373360
452 2802651300 2802428842 Bacteria 4926114
453 2817414184 2816332280 Bacteria 5109718
454 2819549384 2818991437 Bacteria 5805520
455 2819549611 2818991437 Bacteria 5805520
456 2842724757 2842722452 Bacteria 6263924
457 2842727429 2842722452 Bacteria 6263924
458 2842913217 2842909656 Bacteria 6185908
459 2842913825 2842909656 Bacteria 6185908
460 2849283490 2849281842 Bacteria 6065644
461 2849285526 2849281842 Bacteria 6065644
462 2852630641 2852627209 Bacteria 5896285
463 2857631950 2857627736 Bacteria 5625397
464 2881361486 2881359912 Bacteria 4935907
465 2895501697 2895498888 Bacteria 5283788
466 2896345246 2896344016 Bacteria 3811746
467 2902048924 2902048731 Bacteria 4976191
468 2903895260 2903895155 Bacteria 5258610
469 2904447209 2904445276 Bacteria 5310396
470 2904449852 2904445276 Bacteria 5310396
471 2904783415 2904780799 Bacteria 5840761
472 2910248442 2910245624 Bacteria 6935613
473 2914761567 2914759650 Bacteria 4701441
474 2914761858 2914759650 Bacteria 4701441
475 2919099240 2919097161 Bacteria 3860339
476 2919181281 2919177583 Bacteria 5641607
477 2919190601 2919186247 Bacteria 6244071
478 2929153820 2929150217 Bacteria 5462483
479 2929155313 2929154850 Bacteria 6753285
480 2939669189 2939664404 Bacteria 6364494
481 2945926540 2945924605 Bacteria 4296724
482 2945998254 2945997725 Bacteria 6404843
483 2946001770 2945997725 Bacteria 6404843
484 2954018592 2954016120 Bacteria 6446024
485 2954020718 2954016120 Bacteria 6446024
486 2958459607 2958458903 Bacteria 5301041
487 2958513695 2958512119 Bacteria 4528530
488 2977272714 2977268062 Bacteria 5243061
489 3003237164 3003233435 Bacteria 4458031
490 8055420069 8055419101 Bacteria 5289643
491 8055596959 8055592153 Bacteria 5961247
492 Ga0157373_10000005
493 JGI24751J29686_10002780
494 JGI25152J39213_1000080
495 JGI25152J39213_1000173
496 JGI25150J39212_1000003
497 JGI25150J39212_1000004
498 JGI25150J39212_1000015
499 JGI25151J46595_10000002
500 JGI25151J46595_10000043
501 JGI25153J46596_10000009
502 JGI25153J46596_10000015
503 Ga0055536_1000001
504 Ga0055536_1000002
505 Ga0055530_10001525
506 Ga0065714_10002204
507 Ga0065714_10002251
508 Ga0065714_10002553
509 Ga0065714_10004810
510 Ga0065714_10005601
511 Ga0065714_10006902
512 Ga0065714_10015106
513 Ga0065714_10082581
514 Ga0065704_10072354
515 Ga0065712_10003936
516 Ga0065715_10020339
517 Ga0065707_10131200
518 Ga0070658_10046148
519 Ga0070676_10015781
520 Ga0070683_100001724
521 Ga0070683_100096635
522 Ga0070690_100017022
523 Ga0070670_100085030
524 Ga0070670_100119595
525 Ga0068869_100001942
526 Ga0068869_100028571
527 Ga0068869_100053108
528 Ga0068869_100069306
529 Ga0068869_100126054
530 Ga0070666_10000696
531 Ga0070682_100000109
532 Ga0068868_100004734
533 Ga0070660_100001082
534 Ga0070689_100011094
535 Ga0070689_100031128
536 Ga0070689_100042753
537 Ga0070661_100003878
538 Ga0070661_100032497
539 Ga0070675_100018724
540 Ga0070671_100031632
541 Ga0070674_100013974
542 Ga0070673_100004392
543 Ga0070673_100005637
544 Ga0070673_100025696
545 Ga0070673_100113710
546 Ga0070659_100005067
547 Ga0070659_100007295
548 Ga0070667_100013413
549 Ga0070667_100032955
550 Ga0070667_100057511
551 Ga0070667_100081014
552 Ga0070713_100093706
553 Ga0070678_100077865
554 Ga0070662_100008428
555 Ga0070662_100022494
556 Ga0070662_100066034
557 Ga0070681_10234334
558 Ga0068867_100012501
559 Ga0068867_100016386
560 Ga0070685_10019145
561 Ga0070685_10059655
562 Ga0070698_100004841
563 Ga0070698_100005154
564 Ga0070698_100006108
565 Ga0070698_100022314
566 Ga0070698_100070417
567 Ga0070699_100097249
568 Ga0070679_100046381
569 Ga0070684_100000417
570 Ga0070684_100014019
571 Ga0070684_100034633
572 Ga0068853_100040143
573 Ga0068853_100180196
574 Ga0070686_100020608
575 Ga0070665_100022051
576 Ga0070704_100032638
577 Ga0068855_100019915
578 Ga0070664_100000360
579 Ga0070664_100012371
580 Ga0070664_100018647
581 Ga0070664_100062016
582 Ga0068857_100044096
583 Ga0068859_100000098
584 Ga0068859_100000285
585 Ga0068859_100013654
586 Ga0068861_100011359
587 Ga0068861_100015969
588 Ga0068861_100092712
589 Ga0068861_100101180
590 Ga0068851_10051166
591 Ga0068863_100001430
592 Ga0068863_100005978
593 Ga0068863_100017784
594 Ga0068863_100056220
595 Ga0068860_100003920
596 Ga0068860_100100682
597 Ga0068862_100026893
598 Ga0075366_10013752
599 Ga0097621_100001501
600 Ga0097621_100052525
601 Ga0097621_100121898
602 Ga0068871_100004024
603 Ga0068871_100018358
604 Ga0068871_100035985
605 Ga0068871_100088297
606 Ga0075428_100018917
607 Ga0075428_100023631
608 Ga0075428_100030907
609 Ga0075428_100036418
610 Ga0075430_100009461
611 Ga0075430_100013447
612 Ga0075431_100024790
613 Ga0075431_100027720
614 Ga0075434_100253555
615 Ga0075429_100000557
616 Ga0068865_100001792
617 Ga0097620_100000098
618 Ga0097620_100000285
619 Ga0097620_100013654
620 Ga0099824_1004036
621 Ga0079104_1000079
622 Ga0099826_10026672
623 Ga0105251_10035098
624 Ga0105240_10068320
625 Ga0111539_10004863
626 Ga0114129_10004260
627 Ga0114129_10247196
628 Ga0105241_10006435
629 Ga0105241_10102000
630 Ga0105242_10115112
631 Ga0105237_10003809
632 Ga0105237_10011376
633 Ga0105249_10001120
634 Ga0105249_10001157
635 Ga0105249_10001277
636 Ga0105249_10021242
637 Ga0105249_10021677
638 Ga0105249_10062412
639 Ga0105239_10064256
640 Ga0105239_10275530
641 Ga0157373_10000035
642 Ga0157373_10003444
643 Ga0157373_10008374
644 Ga0157373_10045547
645 Ga0157371_10000021
646 Ga0157371_10000025
647 Ga0157371_10001207
648 Ga0157371_10006892
649 Ga0157371_10007560
650 Ga0157370_10000383
651 Ga0157370_10001800
652 Ga0157370_10003591
653 Ga0157370_10015356
654 Ga0157370_10024060
655 Ga0157370_10037772
656 Ga0157370_10052091
657 Ga0157370_10067718
658 Ga0157370_10155103
659 Ga0157370_10181478
660 Ga0157369_10000008
661 Ga0157369_10000038
662 Ga0157369_10039587
663 Ga0157369_10150971
664 Ga0157369_10240920
665 Ga0157374_10007311
666 Ga0157374_10017645
667 Ga0157378_10026991
668 Ga0157378_10037267
669 Ga0157378_10071514
670 Ga0157378_10094244
671 Ga0163162_10000050
672 Ga0163162_10000155
673 Ga0163162_10006015
674 Ga0157372_10032190
675 Ga0157372_10047069
676 Ga0157375_10002645
677 Ga0157375_10004308
678 Ga0157375_10016379
679 Ga0163163_10003073
680 Ga0163163_10006182
681 Ga0157380_10009601
682 Ga0157380_10096760
683 Ga0157380_10187997
684 Ga0182008_10000020
685 Ga0182008_10000037
686 Ga0182008_10000309
687 Ga0182008_10000603
688 Ga0182008_10003307
689 Ga0182008_10012375
690 Ga0182008_10050715
691 Ga0157379_10015571
692 Ga0157379_10193420
693 Ga0157376_10001928
694 Ga0157376_10002899
695 Ga0157376_10008614
696 Ga0157376_10031148
697 Ga0157376_10041397
698 Ga0157376_10074721
699 Ga0182006_1000109
700 Ga0182006_1000127
701 Ga0182006_1000227
702 Ga0182006_1000888
703 Ga0182006_1001210
704 Ga0182006_1002244
705 Ga0182006_1009706
706 Ga0182007_10000003
707 Ga0182007_10000024
708 Ga0182007_10002394
709 Ga0183373_1001
710 Ga0183373_1002
711 Ga0163161_10000136
712 Ga0163161_10000470
713 Ga0163161_10000815
714 Ga0163161_10001151
715 Ga0163161_10001518
716 Ga0163161_10010250
717 Ga0163161_10035915
718 Ga0163161_10096055
719 Ga0207425_1000003
720 Ga0207425_1000023
721 Ga0209129_1000014
722 Ga0209129_1000032
723 Ga0209676_1000008
724 Ga0209676_1000022
725 Ga0209025_1000007
726 Ga0209025_1000047
727 Ga0209758_1000012
728 Ga0209758_1000144
729 Ga0209050_1000020
730 Ga0209050_1000343
731 Ga0207680_10000120
732 Ga0207680_10073094
733 Ga0207647_10022367
734 Ga0207645_10000334
735 Ga0207645_10028538
736 Ga0207654_10001306
737 Ga0207671_10001247
738 Ga0207671_10016536
739 Ga0207657_10001634
740 Ga0207649_10078781
741 Ga0207650_10030282
742 Ga0207650_10047930
743 Ga0207650_10061601
744 Ga0207650_10083152
745 Ga0207644_10034862
746 Ga0207644_10151665
747 Ga0207690_10003665
748 Ga0207706_10006057
749 Ga0207706_10020425
750 Ga0207686_10000405
751 Ga0207686_10005263
752 Ga0207670_10044244
753 Ga0207670_10111807
754 Ga0207669_10043503
755 Ga0207691_10065090
756 Ga0207691_10109635
757 Ga0207689_10003219
758 Ga0207689_10005450
759 Ga0207689_10012712
760 Ga0207689_10019387
761 Ga0207689_10046567
762 Ga0207689_10096391
763 Ga0207661_10048895
764 Ga0207661_10078337
765 Ga0207679_10007831
766 Ga0207679_10064690
767 Ga0207667_10010203
768 Ga0207651_10023979
769 Ga0207651_10040522
770 Ga0207651_10043655
771 Ga0207651_10151296
772 Ga0207712_10000821
773 Ga0207712_10004491
774 Ga0207712_10007724
775 Ga0207712_10016604
776 Ga0207712_10082854
777 Ga0207640_10054545
778 Ga0207658_10026332
779 Ga0207658_10075616
780 Ga0207703_10100305
781 Ga0207703_10208091
782 Ga0207639_10006556
783 Ga0207639_10103832
784 Ga0207639_10167908
785 Ga0207678_10099642
786 Ga0207641_10001054
787 Ga0207641_10001908
788 Ga0207641_10021870
789 Ga0207641_10063206
790 Ga0207641_10093210
791 Ga0207641_10180517
792 Ga0207648_10004255
793 Ga0207648_10036523
794 Ga0207648_10062347
795 Ga0207676_10004127
796 Ga0207676_10012612
797 Ga0207676_10035567
798 Ga0207674_10045060
799 Ga0207674_10062516
800 Ga0207675_100002484
801 Ga0207675_100029305
802 Ga0207675_100069416
803 Ga0207675_100121459
804 Ga0207683_10031001
805 Ga0207698_10024279
806 Ga0209281_1000367
807 Ga0209489_111689
808 Ga0268266_10131878
809 Ga0268264_10009194
810 Ga0268264_10080005
811 Ga0268264_10139747
812 Ga0307515_10000001
813 Ga0307515_10000002
814 Ga0307515_10001521
815 Ga0307515_10053353
816 Ga0316181_1190315
817 Ga0265327_10000488
818 Ga0307509_10045625
819 Ga0307509_10068760
820 Ga0307508_10001227
821 Ga0307405_10000008
822 Ga0307405_10000011
823 Ga0307407_10000018
824 Ga0307407_10000026
825 Ga0307412_10000001
826 Ga0307412_10000283
827 Ga0307412_10004974
828 Ga0307409_100001787
829 Ga0307416_100000053
830 Ga0307416_100000066
831 Ga0307416_100000081
832 Ga0307414_10000046
833 Ga0307414_10000474
834 Ga0307414_10000947
835 Ga0307414_10002029
836 Ga0307414_10003034
837 Ga0307414_10012708
838 Ga0307414_10014405
839 Ga0307411_10056560
840 Ga0373924_0010001
841 Ga0373937_0032091
842 Ga0395900_0012957
843 Ga0395905_0002019
844 Ga0395905_0098703
845 Ga0439439_0006352
846 Ga0439439_0007265
847 Ga0439465_0000153
848 Ga0451853_0006869
849 Ga0451853_3749989
850 Ga0451577_0122689
851 Ga0466969_0000151
852 Ga0466966_0000113
853 Ga0453684_0077574
854 Ga0453684_0144202
855 Ga0466959_0000015
856 Ga0495627_000002
857 Ga0495606_0006357
858 Ga0495606_0028372
859 Ga0495610_0000037
860 Ga0495610_0000049
861 Ga0495610_0000747
862 Ga0495610_0001062
863 Ga0495616_0014695
864 Ga0495628_0021869
865 Ga0495630_0036974
866 Ga0495632_0005245
867 Ga0495643_0001223
868 Ga0495654_0000056
869 Ga0495609_0000025
870 Ga0495633_0000562
871 Ga0495633_0015264
872 Ga0495668_0001808
873 Ga0495634_0041482
874 Ga0495625_0002377
875 Ga0495625_0043937
876 Ga0495657_0092337
877 Ga0495672_0027850
878 Ga0495686_0000386
879 Ga0495686_0001452
880 Ga0495686_0011295
881 Ga0496114_0091923
882 Ga0496115_0046659
883 Ga0496116_0001157
884 Ga0496117_0000980
885 Ga0496121_0009909
886 Ga0496122_0002730
887 Ga0496122_0003059
888 Ga0496123_0003661
889 Ga0496124_0027614
890 Ga0496125_0023543
891 Ga0501034_0027850
892 Ga0501034_0028044
893 Ga0501038_0023587
894 Ga0501043_0024414
895 Ga0501043_0066386
896 Ga0501241_000020
897 Ga0501241_005760
898 Ga0501269_000181
899 Ga0501044_0061545
900 nmdc:mga0k408_3695_c2
901 nmdc:mga05p37_2426_c2
902 nmdc:mga09592_4890_c1
903 nmdc:mga0qj67_13768_c1
904 nmdc:mga08y16_41578_c1
905 nmdc:mga0n895_213443_c1
906 Ga0500646_0004164
907 Ga0500583_0000028
908 Ga0500583_0002283
909 Ga0500651_0000357
910 Ga0500641_0000040
911 Ga0500562_000047
912 Ga0500616_0001915
913 Ga0500622_0000751
914 Ga0500611_000002
915 Ga0500611_000008
916 Ga0500661_001831
917 2520880520
918 2586208889
919 2586208942
920 2587751788
921 2587865787
922 2587943945
923 2588231824
924 2644373259
925 2644682526
926 2722731051
927 2738698315
928 2738734414
929 2738759393
930 2738763273
931 2738767172
932 2738852540
933 2738856292
934 2739215995
935 2739252641
936 2739304184
937 2739590472
938 2739591348
939 2739614787
940 2739646080
941 2775672153
942 2776616121
943 2802651300
944 2817414184
945 2819549384
946 2819549611
947 2842724757
948 2842727429
949 2842913217
950 2842913825
951 2849283490
952 2849285526
953 2852630641
954 2857631950
955 2881361486
956 2895501697
957 2896345246
958 2902048924
959 2903895260
960 2904447209
961 2904449852
962 2904783415
963 2910248442
964 2914761567
965 2914761858
966 2919099240
967 2919181281
968 2919190601
969 2929153820
970 2929155313
971 2939669189
972 2945926540
973 2945998254
974 2946001770
975 2954018592
976 2954020718
977 2958459607
978 2958513695
979 2977272714
980 3003237164
981 8055420069
982 8055596959

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF20629

GD_AH_C

D-galactarate/Altronate dehydratase, C-terminal

335

577

0.99

PF04295

GD_AH_second

D-galactarate dehydratase/Altronate hydrolase, second domain

145

326

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
3k3s-assembly3.cif.gz_C crystal structure of altronate hydrolase (fragment 1-84) from shigella flexneri. 0.9785 4 84
3k3s-assembly3.cif.gz_C crystal structure of altronate hydrolase (fragment 1-84) from shigella flexneri. 0.9227 4 84
6u7l-assembly1.cif.gz_A 2.75 angstrom crystal structure of galactarate dehydratase from escherichia coli. 0.8704 5 547
6u7l-assembly2.cif.gz_C 2.75 angstrom crystal structure of galactarate dehydratase from escherichia coli. 0.8701 5 547
6u7l-assembly1.cif.gz_B 2.75 angstrom crystal structure of galactarate dehydratase from escherichia coli. 0.8673 5 547
ID Description Score Start End Superfamily
3k3sD01 Mainly Beta;Roll;Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4; 0.9615 5 84 2.30.130.110
3k3sD01 Mainly Beta;Roll;Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4; 0.9173 5 84 2.30.130.110
af_P39829_14_92_2.30.130.110 Mainly Beta;Roll;Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4; 0.8724 5 83 2.30.130.110
af_P39829_14_92_2.30.130.110 Mainly Beta;Roll;Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4; 0.8518 5 83 2.30.130.110
af_Q9VEN6_71_200_3.30.420.80 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribosomal protein S11/S14 0.5851 211 272 3.30.420.80
ID Description Score Start End GO Terms
AF-A0A4Q5QFK8-F1-model_v4 Altronate dehydratase 1.003 1 85 GO:0016829
GO:0019698
AF-A0A2V9BGE4-F1-model_v4 Altronate hydrolase 1.002 1 75 GO:0016787
GO:0016829
AF-A0A4Q5QFK8-F1-model_v4 Altronate dehydratase 0.9917 1 85 GO:0016829
GO:0019698
AF-A0A2V9BGE4-F1-model_v4 Altronate hydrolase 0.9887 1 75 GO:0016787
GO:0016829
AF-A0A5J4RPN1-F1-model_v4 Altronate dehydratase (EC 4.2.1.7) 0.9833 3 84 GO:0008789
GO:0019698

Map