F454261

General Info

Members Datasets Scaffolds Average Seq Length
492 314 984 333

Family's Representative Sequence

Representative Sequence 3300010375|Ga0105239_10230958|Ga0105239_102309582
Length 364
Sequence MGAARPACRFHRCVTQGAQLFTTGGIRMSQQGRIGTIAALAACAVSLAVASGNAAAEWKPSQPVEFIVTAGPGGGTDNFARTIQAIVAKYKLVDQPIVVLNKGGGSGAEGFIYGKGAVGDPHKVTFATNNEYLLPLIAKLAWKGDDFTPVAAMALDEFVLWVNGKSDYKTAKAYIDAVKAKPDTFKMGGSQSKDTDQTLTSQISAATGAKFLYVPFKSGGEAAVQLAGGHIDSNTNNPSESLGQWKGGLVTPLCVFSAKRLAAGPKITATMGWSDIPTCAESGIPIEQYQQPRTIWLPQSVPADAVAFYVGVLQKVRETPDWKEYIERSAQTDRFLTGADIRTFIAGDEQKARKVFEHEGWLVR

Samples

Sample ID Description Type Environment
1 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
4 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
8 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
9 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
10 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
50 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
51 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
52 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
53 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
54 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
55 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
56 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
57 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
58 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
59 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
64 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
65 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
74 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
75 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
76 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
77 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
78 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
91 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
92 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
93 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
94 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
95 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
96 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
97 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
98 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
99 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
151 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
152 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
153 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
154 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
155 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
156 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
157 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
158 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
159 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
160 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
161 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
162 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
163 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
164 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
165 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
166 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
167 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
168 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
169 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
170 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
171 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
172 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
173 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
174 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
175 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
176 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
177 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
178 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
179 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
180 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
181 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
182 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
183 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
184 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
185 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
186 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
187 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
188 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
189 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
190 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
191 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
192 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
193 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
194 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
195 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
196 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
197 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
198 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
199 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
200 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
201 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
202 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
203 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
204 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
205 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
206 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
207 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
208 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
209 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
210 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
211 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
212 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
213 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
214 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
215 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
216 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
217 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
218 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
219 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
220 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
221 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
222 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
223 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
224 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
225 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
226 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
227 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
228 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
229 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
230 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
231 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
232 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
233 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
234 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
235 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
236 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
237 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
238 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
239 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
240 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
241 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
242 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
243 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
244 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
245 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
246 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
247 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
248 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
249 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
250 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
251 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
252 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
253 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
254 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
255 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
256 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
257 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
258 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
259 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
260 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
261 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
262 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
263 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
264 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
265 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
266 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
267 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
268 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
269 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
270 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
271 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
272 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
273 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
274 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
275 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
276 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
277 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
278 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
279 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
280 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
281 2508501050 Microvirga lupini Lut6 Isolate Nodule
282 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
283 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
284 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
285 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
286 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
287 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
288 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
289 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
290 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
291 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
292 2643221733 Bosea sp. Root381 Isolate Unclassified
293 2643221734 Bosea sp. Root670 Isolate Unclassified
294 2643221736 Bosea sp. Root483D1 Isolate Unclassified
295 2773857925 Microvirga vignae BR3299 Isolate Unclassified
296 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
297 2818991467 Bosea vestrisii 3192 Isolate Unclassified
298 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
299 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
300 2841760612 Bosea sp. Tri-49 Isolate Nodule
301 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
302 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
303 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
304 2844104063 Bosea sp. Tri-39 Isolate Nodule
305 2851182111 Bosea sp. Tri-44 Isolate Nodule
306 2851246043 Bosea sp. Tri-54 Isolate Nodule
307 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
308 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
309 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
310 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
311 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
312 8057132660 Paracoccus rhizosphaerae LMG 21293 Isolate Rhizosphere
313 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule
314 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 93.09
Metatranscriptomes 0
Isolates 6.91

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.16
Nodule 4.07
Rhizoplane 3.86
Rhizosphere 75.81
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105239_10230958 3300010375 Bacteria 2075
2 LJQas_1003406 3300000549 Bacteria 2133
3 JGI25159J45721_1012900 3300002987 Bacteria 1964
4 JGI25159J45721_1014120 3300002987 Bacteria 1817
5 JGI25151J46595_10000279 3300003187 Bacteria 58320
6 JGI25151J46595_10001258 3300003187 Bacteria 17973
7 JGI25151J46595_10059425 3300003187 Bacteria 1230
8 JGI25406J46586_10001534 3300003203 Bacteria 10906
9 JGI25153J46596_10055022 3300003215 Bacteria 1116
10 JGI25160J50197_1005272 3300003354 Bacteria 5410
11 Ga0055526_1000318 3300003771 Bacteria 40039
12 Ga0055526_1001446 3300003771 Bacteria 16875
13 Ga0055526_1002037 3300003771 Bacteria 13906
14 Ga0055524_1000215 3300003775 Bacteria 61181
15 Ga0055524_1010400 3300003775 Bacteria 3707
16 Ga0065165_1000143 3300005262 Bacteria 124381
17 Ga0070658_10014569 3300005327 Bacteria 6310
18 Ga0070658_10016112 3300005327 Bacteria 5978
19 Ga0070658_10048952 3300005327 Bacteria 3423
20 Ga0070658_10059793 3300005327 Bacteria 3103
21 Ga0070658_10235684 3300005327 Bacteria 1550
22 Ga0070676_10042585 3300005328 Bacteria 2637
23 Ga0070683_100000596 3300005329 Bacteria 25920
24 Ga0070683_100066983 3300005329 Bacteria 3344
25 Ga0070670_100028245 3300005331 Bacteria 4827
26 Ga0070670_100037610 3300005331 Bacteria 4164
27 Ga0070666_10027235 3300005335 Bacteria 3741
28 Ga0070680_100047327 3300005336 Bacteria 3502
29 Ga0070680_100278539 3300005336 Bacteria 1417
30 Ga0070680_100289193 3300005336 Bacteria 1389
31 Ga0070660_100009871 3300005339 Bacteria 6732
32 Ga0070660_100034156 3300005339 Bacteria 3840
33 Ga0070660_100058027 3300005339 Bacteria 3000
34 Ga0070660_100081230 3300005339 Bacteria 2544
35 Ga0070660_100141648 3300005339 Bacteria 1929
36 Ga0070691_10015275 3300005341 Bacteria 3528
37 Ga0070691_10015582 3300005341 Bacteria 3492
38 Ga0070661_100007681 3300005344 Bacteria 7446
39 Ga0070661_100020151 3300005344 Bacteria 4754
40 Ga0070661_100126093 3300005344 Bacteria 1921
41 Ga0070661_100132963 3300005344 Bacteria 1870
42 Ga0070668_100051233 3300005347 Bacteria 3180
43 Ga0070668_100091716 3300005347 Bacteria 2395
44 Ga0070668_100316041 3300005347 Bacteria 1314
45 Ga0070669_100083560 3300005353 Bacteria 2381
46 Ga0070671_100002005 3300005355 Bacteria 15645
47 Ga0070671_100021673 3300005355 Bacteria 5248
48 Ga0070671_100163128 3300005355 Bacteria 1884
49 Ga0070673_100029224 3300005364 Bacteria 4108
50 Ga0070673_100112264 3300005364 Bacteria 2262
51 Ga0070688_100088943 3300005365 Bacteria 2014
52 Ga0070688_100188879 3300005365 Bacteria 1434
53 Ga0070659_100004754 3300005366 Bacteria 9704
54 Ga0070667_100024337 3300005367 Bacteria 5029
55 Ga0070714_100029701 3300005435 Bacteria 4546
56 Ga0070663_100097315 3300005455 Bacteria 2190
57 Ga0070663_100108775 3300005455 Bacteria 2080
58 Ga0070678_100018822 3300005456 Bacteria 4484
59 Ga0070678_100193657 3300005456 Bacteria 1673
60 Ga0070662_100010462 3300005457 Bacteria 6089
61 Ga0070662_100015756 3300005457 Bacteria 5068
62 Ga0070681_10000356 3300005458 Bacteria 36911
63 Ga0070681_10016000 3300005458 Bacteria 7479
64 Ga0070681_10032423 3300005458 Bacteria 5243
65 Ga0070681_10036293 3300005458 Bacteria 4949
66 Ga0070681_10121247 3300005458 Bacteria 2549
67 Ga0070699_100006207 3300005518 Bacteria 10430
68 Ga0070699_100050534 3300005518 Bacteria 3600
69 Ga0070679_100060865 3300005530 Bacteria 3763
70 Ga0070679_100063994 3300005530 Bacteria 3665
71 Ga0070679_100098301 3300005530 Bacteria 2914
72 Ga0070679_100170277 3300005530 Bacteria 2151
73 Ga0070684_100033955 3300005535 Bacteria 4359
74 Ga0070684_100228320 3300005535 Bacteria 1699
75 Ga0070697_100088051 3300005536 Bacteria 2564
76 Ga0068853_100012607 3300005539 Bacteria 6878
77 Ga0068853_100028523 3300005539 Bacteria 4696
78 Ga0068853_100113756 3300005539 Bacteria 2406
79 Ga0068853_100196973 3300005539 Bacteria 1832
80 Ga0070672_100279649 3300005543 Bacteria 1411
81 Ga0070665_100076802 3300005548 Bacteria 3347
82 Ga0068855_100027227 3300005563 Bacteria 6840
83 Ga0068855_100047173 3300005563 Bacteria 5090
84 Ga0068855_100184864 3300005563 Bacteria 2354
85 Ga0070664_100003198 3300005564 Bacteria 13236
86 Ga0070664_100109604 3300005564 Bacteria 2408
87 Ga0070664_100126939 3300005564 Bacteria 2238
88 Ga0070664_100137024 3300005564 Bacteria 2153
89 Ga0068857_100144906 3300005577 Bacteria 2149
90 Ga0068857_100229685 3300005577 Bacteria 1697
91 Ga0068854_100055833 3300005578 Bacteria 2845
92 Ga0068854_100060708 3300005578 Bacteria 2736
93 Ga0068854_100180310 3300005578 Bacteria 1649
94 Ga0068856_100003737 3300005614 Bacteria 15253
95 Ga0068856_100021384 3300005614 Bacteria 6289
96 Ga0068856_100084746 3300005614 Bacteria 3148
97 Ga0068856_100443913 3300005614 Bacteria 1318
98 Ga0068852_100005742 3300005616 Bacteria 8904
99 Ga0068852_100023442 3300005616 Bacteria 4968
100 Ga0068852_100059005 3300005616 Bacteria 3326
101 Ga0068852_100373098 3300005616 Bacteria 1398
102 Ga0068864_100049982 3300005618 Bacteria 3598
103 Ga0068861_100319097 3300005719 Bacteria 1352
104 Ga0068851_10008461 3300005834 Bacteria 4757
105 Ga0068851_10009252 3300005834 Bacteria 4574
106 Ga0068851_10098643 3300005834 Bacteria 1547
107 Ga0068862_100253702 3300005844 Bacteria 1604
108 Ga0068862_100263043 3300005844 Bacteria 1575
109 Ga0081455_10008680 3300005937 Bacteria 10527
110 Ga0081540_1011464 3300005983 Bacteria 5921
111 Ga0081539_10000224 3300005985 Bacteria 133057
112 Ga0075365_10019991 3300006038 Bacteria 4144
113 Ga0075365_10232953 3300006038 Bacteria 1293
114 Ga0075368_10007323 3300006042 Bacteria 3892
115 Ga0075368_10086125 3300006042 Bacteria 1282
116 Ga0075363_100029721 3300006048 Bacteria 2823
117 Ga0075364_10049305 3300006051 Bacteria 2745
118 Ga0070716_100076786 3300006173 Bacteria 1981
119 Ga0075362_10116241 3300006177 Bacteria 1263
120 Ga0075367_10084780 3300006178 Bacteria 1922
121 Ga0075369_10105327 3300006186 Bacteria 1268
122 Ga0097621_100225441 3300006237 Bacteria 1634
123 Ga0068871_100043818 3300006358 Bacteria 3595
124 Ga0068865_100184655 3300006881 Bacteria 1608
125 Ga0068865_100247235 3300006881 Bacteria 1406
126 Ga0075436_100096294 3300006914 Bacteria 2059
127 Ga0099794_10008073 3300007265 Bacteria 4357
128 Ga0099795_10018077 3300007788 Bacteria 2259
129 Ga0105240_10031942 3300009093 Bacteria 6820
130 Ga0105240_10037950 3300009093 Bacteria 6186
131 Ga0105240_10050820 3300009093 Bacteria 5223
132 Ga0111539_10360590 3300009094 Bacteria 1692
133 Ga0105245_10453374 3300009098 Bacteria 1291
134 Ga0105241_10032358 3300009174 Bacteria 3921
135 Ga0105241_10076233 3300009174 Bacteria 2614
136 Ga0105242_10252053 3300009176 Bacteria 1591
137 Ga0105248_10132390 3300009177 Bacteria 2813
138 Ga0105237_10010048 3300009545 Bacteria 10094
139 Ga0105237_10082360 3300009545 Bacteria 3208
140 Ga0105238_10005342 3300009551 Bacteria 12686
141 Ga0105238_10472725 3300009551 Bacteria 1252
142 Ga0099796_10000753 3300010159 Bacteria 5789
143 Ga0105239_10013635 3300010375 Bacteria 9023
144 Ga0105239_10105028 3300010375 Bacteria 3128
145 Ga0105239_10133877 3300010375 Bacteria 2759
146 Ga0105239_10718871 3300010375 Bacteria 1142
147 Ga0105246_10044984 3300011119 Bacteria 3004
148 Ga0157373_10000462 3300013100 Bacteria 32264
149 Ga0157373_10015873 3300013100 Bacteria 5498
150 Ga0157373_10050372 3300013100 Bacteria 2966
151 Ga0157371_10000601 3300013102 Bacteria 42868
152 Ga0157371_10158378 3300013102 Bacteria 1617
153 Ga0157370_10007304 3300013104 Bacteria 12057
154 Ga0157370_10071004 3300013104 Bacteria 3286
155 Ga0157370_10106634 3300013104 Bacteria 2622
156 Ga0157370_10275295 3300013104 Bacteria 1555
157 Ga0157369_10007535 3300013105 Bacteria 12524
158 Ga0157369_10052773 3300013105 Bacteria 4397
159 Ga0157369_10062377 3300013105 Bacteria 4017
160 Ga0157369_10159954 3300013105 Bacteria 2377
161 Ga0157369_10181208 3300013105 Bacteria 2216
162 Ga0157369_10293837 3300013105 Bacteria 1691
163 Ga0171462_1044 3300013250 Bacteria 54963
164 Ga0157374_10071049 3300013296 Bacteria 3281
165 Ga0157374_10162008 3300013296 Bacteria 2178
166 Ga0163162_10173431 3300013306 Bacteria 2281
167 Ga0157372_10009233 3300013307 Bacteria 10485
168 Ga0157372_10010168 3300013307 Bacteria 9991
169 Ga0157372_10040084 3300013307 Bacteria 5172
170 Ga0157372_10162531 3300013307 Bacteria 2581
171 Ga0157372_10609539 3300013307 Bacteria 1272
172 Ga0157375_10049751 3300013308 Bacteria 4109
173 Ga0157375_10364719 3300013308 Bacteria 1611
174 Ga0157375_10413990 3300013308 Bacteria 1514
175 Ga0163163_10026595 3300014325 Bacteria 5534
176 Ga0157380_10218752 3300014326 Bacteria 1703
177 Ga0157380_10390292 3300014326 Bacteria 1317
178 Ga0182008_10099259 3300014497 Bacteria 1438
179 Ga0182008_10118618 3300014497 Bacteria 1314
180 Ga0157379_10024939 3300014968 Bacteria 5307
181 Ga0157376_10023824 3300014969 Bacteria 4798
182 Ga0157376_10317053 3300014969 Bacteria 1481
183 Ga0163161_10360731 3300017792 Bacteria 1157
184 Ga0209673_1022491 3300025273 Bacteria 2173
185 Ga0209130_1000220 3300025284 Bacteria 74888
186 Ga0209130_1000525 3300025284 Bacteria 38664
187 Ga0209675_1000593 3300025291 Bacteria 25941
188 Ga0209025_1000010 3300025294 Bacteria 986612
189 Ga0209025_1000800 3300025294 Bacteria 51109
190 Ga0209025_1005981 3300025294 Bacteria 9667
191 Ga0209025_1046826 3300025294 Bacteria 1774
192 Ga0209025_1050270 3300025294 Bacteria 1669
193 Ga0209564_1000054 3300025295 Bacteria 350653
194 Ga0209564_1000441 3300025295 Bacteria 71474
195 Ga0209564_1002582 3300025295 Bacteria 13918
196 Ga0209758_1001635 3300025297 Bacteria 25463
197 Ga0209758_1003564 3300025297 Bacteria 13997
198 Ga0209256_1000330 3300025299 Bacteria 79958
199 Ga0209256_1000377 3300025299 Bacteria 71474
200 Ga0207426_1000085 3300025302 Bacteria 293171
201 Ga0209257_1035124 3300025304 Bacteria 1554
202 Ga0207697_10008920 3300025315 Bacteria 4357
203 Ga0207697_10077418 3300025315 Bacteria 1398
204 Ga0207656_10060609 3300025321 Bacteria 1659
205 Ga0207710_10041973 3300025900 Bacteria 2030
206 Ga0207647_10072944 3300025904 Bacteria 2069
207 Ga0207699_10070304 3300025906 Bacteria 2137
208 Ga0207645_10021627 3300025907 Bacteria 4192
209 Ga0207645_10064608 3300025907 Bacteria 2338
210 Ga0207643_10017601 3300025908 Bacteria 3909
211 Ga0207654_10008509 3300025911 Bacteria 5191
212 Ga0207707_10011825 3300025912 Bacteria 7589
213 Ga0207707_10013432 3300025912 Bacteria 7137
214 Ga0207707_10016138 3300025912 Bacteria 6514
215 Ga0207707_10199605 3300025912 Bacteria 1744
216 Ga0207707_10307467 3300025912 Bacteria 1370
217 Ga0207695_10033447 3300025913 Bacteria 5606
218 Ga0207695_10168136 3300025913 Bacteria 2120
219 Ga0207695_10258408 3300025913 Bacteria 1640
220 Ga0207671_10036622 3300025914 Bacteria 3639
221 Ga0207671_10143398 3300025914 Bacteria 1842
222 Ga0207660_10006100 3300025917 Bacteria 7823
223 Ga0207660_10041729 3300025917 Bacteria 3217
224 Ga0207657_10001149 3300025919 Bacteria 28146
225 Ga0207657_10001270 3300025919 Bacteria 26894
226 Ga0207657_10046987 3300025919 Bacteria 3778
227 Ga0207657_10132985 3300025919 Bacteria 2037
228 Ga0207657_10178340 3300025919 Bacteria 1718
229 Ga0207649_10083602 3300025920 Bacteria 2072
230 Ga0207652_10011118 3300025921 Bacteria 7255
231 Ga0207652_10012086 3300025921 Bacteria 6971
232 Ga0207681_10015969 3300025923 Bacteria 4690
233 Ga0207681_10127644 3300025923 Bacteria 1875
234 Ga0207694_10124455 3300025924 Bacteria 2061
235 Ga0207694_10331851 3300025924 Bacteria 1257
236 Ga0207650_10038086 3300025925 Bacteria 3508
237 Ga0207650_10042586 3300025925 Bacteria 3330
238 Ga0207650_10175688 3300025925 Bacteria 1704
239 Ga0207659_10251837 3300025926 Bacteria 1433
240 Ga0207687_10029517 3300025927 Bacteria 3689
241 Ga0207700_10125222 3300025928 Bacteria 2089
242 Ga0207664_10151029 3300025929 Bacteria 1973
243 Ga0207644_10011258 3300025931 Bacteria 5913
244 Ga0207644_10082163 3300025931 Bacteria 2383
245 Ga0207706_10000877 3300025933 Bacteria 30889
246 Ga0207706_10029854 3300025933 Bacteria 4865
247 Ga0207686_10086792 3300025934 Bacteria 2056
248 Ga0207669_10020712 3300025937 Bacteria 3455
249 Ga0207665_10176891 3300025939 Bacteria 1544
250 Ga0207665_10267837 3300025939 Bacteria 1268
251 Ga0207691_10026174 3300025940 Bacteria 5475
252 Ga0207691_10050233 3300025940 Bacteria 3818
253 Ga0207691_10142471 3300025940 Bacteria 2111
254 Ga0207691_10186795 3300025940 Bacteria 1809
255 Ga0207711_10017728 3300025941 Bacteria 5917
256 Ga0207661_10005037 3300025944 Bacteria 9268
257 Ga0207661_10048095 3300025944 Bacteria 3388
258 Ga0207661_10426043 3300025944 Bacteria 1206
259 Ga0207679_10009350 3300025945 Bacteria 6278
260 Ga0207679_10105499 3300025945 Bacteria 2213
261 Ga0207679_10129777 3300025945 Bacteria 2020
262 Ga0207667_10004939 3300025949 Bacteria 16285
263 Ga0207667_10007079 3300025949 Bacteria 13547
264 Ga0207667_10232446 3300025949 Bacteria 1887
265 Ga0207651_10044124 3300025960 Bacteria 2981
266 Ga0207712_10138173 3300025961 Bacteria 1866
267 Ga0207712_10155098 3300025961 Bacteria 1773
268 Ga0207640_10018257 3300025981 Bacteria 4119
269 Ga0207640_10115565 3300025981 Bacteria 1911
270 Ga0207658_10019413 3300025986 Bacteria 4701
271 Ga0207703_10294723 3300026035 Bacteria 1477
272 Ga0207639_10003121 3300026041 Bacteria 11146
273 Ga0207639_10167758 3300026041 Bacteria 1856
274 Ga0207678_10015994 3300026067 Bacteria 6589
275 Ga0207678_10049956 3300026067 Bacteria 3613
276 Ga0207678_10091350 3300026067 Bacteria 2602
277 Ga0207678_10154170 3300026067 Bacteria 1962
278 Ga0207708_10086631 3300026075 Bacteria 2410
279 Ga0207702_10034124 3300026078 Bacteria 4253
280 Ga0207702_10047367 3300026078 Bacteria 3622
281 Ga0207702_10164354 3300026078 Bacteria 2029
282 Ga0207641_10312403 3300026088 Bacteria 1488
283 Ga0207676_10044159 3300026095 Bacteria 3437
284 Ga0207674_10022357 3300026116 Bacteria 6790
285 Ga0207674_10119135 3300026116 Bacteria 2609
286 Ga0207674_10189599 3300026116 Bacteria 2006
287 Ga0207674_10208239 3300026116 Bacteria 1905
288 Ga0207675_100026820 3300026118 Bacteria 5362
289 Ga0207683_10003038 3300026121 Bacteria 14665
290 Ga0207683_10067452 3300026121 Bacteria 3156
291 Ga0207683_10153837 3300026121 Bacteria 2077
292 Ga0207698_10028097 3300026142 Bacteria 4006
293 Ga0207698_10188938 3300026142 Bacteria 1833
294 Ga0209588_1003466 3300027671 Bacteria 4379
295 Ga0268266_10012555 3300028379 Bacteria 7320
296 Ga0268266_10055839 3300028379 Bacteria 3396
297 Ga0268265_10077824 3300028380 Bacteria 2606
298 Ga0265334_10023700 3300028573 Bacteria 2494
299 Ga0307517_10000066 3300028786 Bacteria 141370
300 Ga0307517_10145296 3300028786 Bacteria 1648
301 Ga0265327_10010391 3300031251 Bacteria 6554
302 Ga0307408_100153348 3300031548 Bacteria 1821
303 Ga0307508_10158925 3300031616 Bacteria 1864
304 Ga0307516_10088935 3300031730 Bacteria 2920
305 Ga0307413_10035093 3300031824 Bacteria 2874
306 Ga0307406_10106757 3300031901 Bacteria 1919
307 Ga0307406_10138738 3300031901 Bacteria 1718
308 Ga0307406_10152386 3300031901 Bacteria 1651
309 Ga0307407_10114004 3300031903 Bacteria 1702
310 Ga0307412_10068252 3300031911 Bacteria 2417
311 Ga0307412_10141601 3300031911 Bacteria 1762
312 Ga0307409_100056206 3300031995 Bacteria 3042
313 Ga0307409_100193771 3300031995 Bacteria 1812
314 Ga0307409_100273601 3300031995 Bacteria 1557
315 Ga0307415_100062575 3300032126 Bacteria 2582
316 Ga0307510_10125794 3300033180 Bacteria 2253
317 Ga0373923_0003338 3300035111 Bacteria 5130
318 Ga0373936_0000090 3300035113 Bacteria 32876
319 Ga0373945_0001190 3300035116 Bacteria 7913
320 Ga0373954_0001396 3300035118 Bacteria 9780
321 Ga0373956_0005161 3300035119 Bacteria 5228
322 Ga0373943_0001574 3300035170 Bacteria 10338
323 Ga0373946_0003783 3300035171 Bacteria 5369
324 Ga0373955_0014399 3300035172 Bacteria 3846
325 Ga0373924_0065089 3300035410 Bacteria 1531
326 Ga0373931_0014330 3300035691 Bacteria 3872
327 Ga0373935_0000831 3300035692 Bacteria 16621
328 Ga0373927_0041680 3300035695 Bacteria 2977
329 Ga0373933_0032263 3300035724 Bacteria 3043
330 Ga0373933_0048435 3300035724 Bacteria 2531
331 Ga0373947_0001488 3300035725 Bacteria 14379
332 Ga0373937_0000003 3300036401 Bacteria 235408
333 Ga0373937_0178403 3300036401 Bacteria 1994
334 Ga0373925_0000052 3300037068 Bacteria 127490
335 Ga0395899_0184496 3300037312 Bacteria 1463
336 Ga0395900_0281616 3300037418 Bacteria 1654
337 Ga0395898_0316188 3300037466 Bacteria 1490
338 Ga0395905_0052502 3300037471 Bacteria 3816
339 Ga0395905_0208307 3300037471 Bacteria 1832
340 Ga0395901_0066624 3300038443 Bacteria 3750
341 Ga0439431_0014530 3300041997 Bacteria 1826
342 Ga0439445_0010513 3300042004 Bacteria 2192
343 Ga0439432_057870 3300042006 Bacteria 1199
344 Ga0466964_0078187 3300044706 Bacteria 1414
345 Ga0466957_0026618 3300044842 Bacteria 3433
346 Ga0451576_0166461 3300045051 Bacteria 2301
347 Ga0466958_0029523 3300045836 Bacteria 3254
348 Ga0466967_0070522 3300045976 Bacteria 3126
349 Ga0466967_0079996 3300045976 Bacteria 2948
350 Ga0495627_060317 3300046453 Bacteria 1124
351 Ga0495592_0000051 3300046454 Bacteria 111216
352 Ga0495629_0011126 3300046459 Bacteria 6537
353 Ga0495629_0036505 3300046459 Bacteria 3469
354 Ga0495651_0001023 3300046462 Bacteria 21643
355 Ga0495653_0000071 3300046463 Bacteria 86572
356 Ga0495662_0002014 3300046476 Bacteria 10170
357 Ga0495664_0000015 3300046477 Bacteria 192569
358 Ga0495594_0110128 3300046499 Bacteria 1553
359 Ga0495596_0039273 3300046500 Bacteria 1870
360 Ga0495608_0000025 3300046511 Bacteria 158132
361 Ga0495610_0023421 3300046512 Bacteria 3358
362 Ga0495610_0033777 3300046512 Bacteria 2641
363 Ga0495618_0000022 3300046514 Bacteria 127582
364 Ga0495628_0000011 3300046516 Bacteria 225267
365 Ga0495630_0002501 3300046517 Bacteria 12748
366 Ga0495631_0046269 3300046518 Bacteria 1913
367 Ga0495644_0021943 3300046523 Bacteria 2434
368 Ga0495648_0004300 3300046524 Bacteria 12208
369 Ga0495652_0000014 3300046529 Bacteria 225484
370 Ga0495640_0000008 3300046533 Bacteria 220320
371 Ga0495587_0000015 3300046536 Bacteria 187415
372 Ga0495645_0000020 3300046543 Bacteria 143867
373 Ga0495633_0071360 3300046558 Bacteria 1620
374 Ga0495667_0000013 3300046559 Bacteria 220294
375 Ga0495634_0000043 3300046642 Bacteria 99897
376 Ga0495625_0007298 3300046660 Bacteria 9657
377 Ga0495625_0110224 3300046660 Bacteria 1882
378 Ga0495635_0000012 3300046663 Bacteria 225271
379 Ga0495657_0000048 3300046675 Bacteria 104278
380 Ga0495599_0000008 3300046678 Bacteria 225534
381 Ga0495623_0000002 3300046679 Bacteria 166669
382 Ga0495646_0000004 3300046680 Bacteria 268993
383 Ga0495613_0009385 3300046689 Bacteria 7260
384 Ga0495624_0005836 3300046690 Bacteria 8809
385 Ga0495670_0053438 3300046691 Bacteria 2023
386 Ga0495670_0067091 3300046691 Bacteria 1811
387 Ga0495671_0103189 3300046692 Bacteria 1393
388 Ga0495600_0000231 3300046809 Bacteria 30973
389 Ga0495581_0004606 3300047315 Bacteria 7966
390 Ga0495604_0000001 3300047317 Bacteria 708627
391 Ga0495674_0000023 3300047319 Bacteria 157443
392 Ga0495680_0000510 3300047322 Bacteria 43956
393 Ga0495683_0078081 3300047323 Bacteria 1618
394 Ga0495675_0000023 3300047444 Bacteria 111081
395 Ga0495677_0069290 3300047445 Bacteria 1314
396 Ga0495681_0059073 3300047470 Bacteria 1775
397 Ga0495684_0000007 3300047471 Bacteria 225614
398 Ga0495686_0183564 3300047472 Bacteria 1211
399 Ga0495602_0000045 3300048088 Bacteria 118132
400 Ga0496101_0006389 3300048904 Bacteria 7584
401 Ga0496101_0080395 3300048904 Bacteria 2408
402 Ga0496103_0102914 3300048906 Bacteria 1809
403 Ga0496104_0092280 3300048907 Bacteria 2895
404 Ga0496105_0007494 3300048908 Bacteria 8451
405 Ga0496106_0011577 3300048909 Bacteria 6519
406 Ga0496106_0057584 3300048909 Bacteria 2939
407 Ga0496107_0003901 3300048910 Bacteria 10022
408 Ga0496107_0185625 3300048910 Bacteria 1544
409 Ga0496109_0265400 3300048912 Bacteria 1617
410 Ga0496110_0242935 3300048913 Bacteria 1638
411 Ga0496111_0003002 3300048914 Bacteria 10333
412 Ga0496111_0019157 3300048914 Bacteria 4748
413 Ga0496111_0274325 3300048914 Bacteria 1251
414 Ga0496114_0082425 3300048917 Bacteria 2719
415 Ga0496115_0017000 3300048918 Bacteria 5549
416 Ga0496115_0029494 3300048918 Bacteria 4309
417 Ga0496116_0000216 3300048919 Bacteria 108542
418 Ga0496117_0004522 3300048920 Bacteria 15269
419 Ga0496117_0052466 3300048920 Bacteria 2872
420 Ga0496117_0083147 3300048920 Bacteria 2094
421 Ga0496118_0028839 3300048921 Bacteria 4666
422 Ga0496118_0121454 3300048921 Bacteria 1702
423 Ga0496119_0044031 3300048922 Bacteria 2815
424 Ga0496121_0003971 3300048924 Bacteria 20407
425 Ga0496122_0001796 3300048925 Bacteria 32863
426 Ga0496122_0016625 3300048925 Bacteria 6942
427 Ga0496122_0114582 3300048925 Bacteria 1758
428 Ga0496123_0013643 3300048926 Bacteria 6797
429 Ga0496123_0037975 3300048926 Bacteria 3392
430 Ga0496124_0000023 3300048927 Bacteria 415226
431 Ga0496124_0027881 3300048927 Bacteria 5059
432 Ga0496126_0034271 3300048929 Bacteria 4769
433 Ga0501034_0007025 3300049571 Bacteria 12010
434 Ga0501034_0032509 3300049571 Bacteria 5297
435 Ga0501036_0124081 3300049572 Bacteria 2181
436 Ga0501038_0253341 3300049574 Bacteria 1394
437 Ga0501043_0273876 3300049579 Bacteria 1295
438 Ga0501047_0022956 3300049581 Bacteria 5989
439 Ga0501070_0174893 3300049586 Bacteria 1768
440 Ga0501073_0232269 3300049589 Bacteria 1274
441 Ga0501217_053293 3300049661 Bacteria 1063
442 Ga0501035_0041318 3300049822 Bacteria 4164
443 nmdc:mga03683_75757_c1 3300050489 Bacteria 1445
444 nmdc:mga08x19_84388_c1 3300050514 Bacteria 2089
445 Ga0495601_0000014 3300053077 Bacteria 220318
446 Ga0495612_0000014 3300053078 Bacteria 187444
447 Ga0495595_0000632 3300053084 Bacteria 13397
448 Ga0495619_0000006 3300053085 Bacteria 384835
449 Ga0500651_0001088 3300053093 Bacteria 13425
450 Ga0500593_010579 3300053117 Bacteria 3877
451 Ga0500595_002816 3300053119 Bacteria 8362
452 Ga0500595_002954 3300053119 Bacteria 8096
453 Ga0500595_006360 3300053119 Bacteria 5018
454 Ga0500642_0012817 3300053130 Bacteria 3057
455 Ga0500616_0081083 3300053153 Bacteria 1630
456 Ga0500622_0007959 3300053156 Bacteria 5967
457 Ga0500637_0017775 3300053178 Bacteria 3812
458 Ga0501082_0024741 3300060353 Bacteria 5176
459 2508726808 2508501050 Bacteria 9633614
460 2509075977 2508501114 Bacteria 7082538
461 2513913699 2513237144 Bacteria 7530820
462 2513929269 2513237146 Bacteria 7166346
463 2515633578 2515154113 Bacteria 7807172
464 2515641540 2515154114 Bacteria 7848616
465 2517041137 2516653077 Bacteria 7555578
466 2599415506 2599185170 Bacteria 7295545
467 2599717911 2599185236 Bacteria 6875203
468 2600377046 2600254933 Bacteria 4750527
469 2644192122 2643221634 Bacteria 6705461
470 2644729433 2643221733 Bacteria 5690728
471 2644734718 2643221734 Bacteria 5365412
472 2644741985 2643221736 Bacteria 6608466
473 2774871541 2773857925 Bacteria 6472445
474 2776258225 2775506901 Bacteria 9631051
475 2819717024 2818991467 Bacteria 5893227
476 2835317966 2835312727 Bacteria 7413381
477 2838035619 2838035591 Bacteria 7166484
478 2841763392 2841760612 Bacteria 6454112
479 2841916252 2841911363 Bacteria 6173697
480 2841921079 2841917233 Bacteria 6173500
481 2842335739 2842333319 Bacteria 8899485
482 2844108737 2844104063 Bacteria 6440972
483 2851182632 2851182111 Bacteria 6047226
484 2851250844 2851246043 Bacteria 6439203
485 2882459953 2882456835 Bacteria 6863978
486 2917701998 2917699015 Bacteria 7043791
487 2933021953 2933016740 Bacteria 6355406
488 3003669318 3003665799 Bacteria 7279786
489 3005411777 3005409236 Bacteria 7188837
490 8057135781 8057132660 Bacteria 4061191
491 8057534676 8057529695 Bacteria 6306553
492 8057878076 8057874678 Bacteria 7494653
493 Ga0105239_10230958
494 LJQas_1003406
495 JGI25159J45721_1012900
496 JGI25159J45721_1014120
497 JGI25151J46595_10000279
498 JGI25151J46595_10001258
499 JGI25151J46595_10059425
500 JGI25406J46586_10001534
501 JGI25153J46596_10055022
502 JGI25160J50197_1005272
503 Ga0055526_1000318
504 Ga0055526_1001446
505 Ga0055526_1002037
506 Ga0055524_1000215
507 Ga0055524_1010400
508 Ga0065165_1000143
509 Ga0070658_10014569
510 Ga0070658_10016112
511 Ga0070658_10048952
512 Ga0070658_10059793
513 Ga0070658_10235684
514 Ga0070676_10042585
515 Ga0070683_100000596
516 Ga0070683_100066983
517 Ga0070670_100028245
518 Ga0070670_100037610
519 Ga0070666_10027235
520 Ga0070680_100047327
521 Ga0070680_100278539
522 Ga0070680_100289193
523 Ga0070660_100009871
524 Ga0070660_100034156
525 Ga0070660_100058027
526 Ga0070660_100081230
527 Ga0070660_100141648
528 Ga0070691_10015275
529 Ga0070691_10015582
530 Ga0070661_100007681
531 Ga0070661_100020151
532 Ga0070661_100126093
533 Ga0070661_100132963
534 Ga0070668_100051233
535 Ga0070668_100091716
536 Ga0070668_100316041
537 Ga0070669_100083560
538 Ga0070671_100002005
539 Ga0070671_100021673
540 Ga0070671_100163128
541 Ga0070673_100029224
542 Ga0070673_100112264
543 Ga0070688_100088943
544 Ga0070688_100188879
545 Ga0070659_100004754
546 Ga0070667_100024337
547 Ga0070714_100029701
548 Ga0070663_100097315
549 Ga0070663_100108775
550 Ga0070678_100018822
551 Ga0070678_100193657
552 Ga0070662_100010462
553 Ga0070662_100015756
554 Ga0070681_10000356
555 Ga0070681_10016000
556 Ga0070681_10032423
557 Ga0070681_10036293
558 Ga0070681_10121247
559 Ga0070699_100006207
560 Ga0070699_100050534
561 Ga0070679_100060865
562 Ga0070679_100063994
563 Ga0070679_100098301
564 Ga0070679_100170277
565 Ga0070684_100033955
566 Ga0070684_100228320
567 Ga0070697_100088051
568 Ga0068853_100012607
569 Ga0068853_100028523
570 Ga0068853_100113756
571 Ga0068853_100196973
572 Ga0070672_100279649
573 Ga0070665_100076802
574 Ga0068855_100027227
575 Ga0068855_100047173
576 Ga0068855_100184864
577 Ga0070664_100003198
578 Ga0070664_100109604
579 Ga0070664_100126939
580 Ga0070664_100137024
581 Ga0068857_100144906
582 Ga0068857_100229685
583 Ga0068854_100055833
584 Ga0068854_100060708
585 Ga0068854_100180310
586 Ga0068856_100003737
587 Ga0068856_100021384
588 Ga0068856_100084746
589 Ga0068856_100443913
590 Ga0068852_100005742
591 Ga0068852_100023442
592 Ga0068852_100059005
593 Ga0068852_100373098
594 Ga0068864_100049982
595 Ga0068861_100319097
596 Ga0068851_10008461
597 Ga0068851_10009252
598 Ga0068851_10098643
599 Ga0068862_100253702
600 Ga0068862_100263043
601 Ga0081455_10008680
602 Ga0081540_1011464
603 Ga0081539_10000224
604 Ga0075365_10019991
605 Ga0075365_10232953
606 Ga0075368_10007323
607 Ga0075368_10086125
608 Ga0075363_100029721
609 Ga0075364_10049305
610 Ga0070716_100076786
611 Ga0075362_10116241
612 Ga0075367_10084780
613 Ga0075369_10105327
614 Ga0097621_100225441
615 Ga0068871_100043818
616 Ga0068865_100184655
617 Ga0068865_100247235
618 Ga0075436_100096294
619 Ga0099794_10008073
620 Ga0099795_10018077
621 Ga0105240_10031942
622 Ga0105240_10037950
623 Ga0105240_10050820
624 Ga0111539_10360590
625 Ga0105245_10453374
626 Ga0105241_10032358
627 Ga0105241_10076233
628 Ga0105242_10252053
629 Ga0105248_10132390
630 Ga0105237_10010048
631 Ga0105237_10082360
632 Ga0105238_10005342
633 Ga0105238_10472725
634 Ga0099796_10000753
635 Ga0105239_10013635
636 Ga0105239_10105028
637 Ga0105239_10133877
638 Ga0105239_10718871
639 Ga0105246_10044984
640 Ga0157373_10000462
641 Ga0157373_10015873
642 Ga0157373_10050372
643 Ga0157371_10000601
644 Ga0157371_10158378
645 Ga0157370_10007304
646 Ga0157370_10071004
647 Ga0157370_10106634
648 Ga0157370_10275295
649 Ga0157369_10007535
650 Ga0157369_10052773
651 Ga0157369_10062377
652 Ga0157369_10159954
653 Ga0157369_10181208
654 Ga0157369_10293837
655 Ga0171462_1044
656 Ga0157374_10071049
657 Ga0157374_10162008
658 Ga0163162_10173431
659 Ga0157372_10009233
660 Ga0157372_10010168
661 Ga0157372_10040084
662 Ga0157372_10162531
663 Ga0157372_10609539
664 Ga0157375_10049751
665 Ga0157375_10364719
666 Ga0157375_10413990
667 Ga0163163_10026595
668 Ga0157380_10218752
669 Ga0157380_10390292
670 Ga0182008_10099259
671 Ga0182008_10118618
672 Ga0157379_10024939
673 Ga0157376_10023824
674 Ga0157376_10317053
675 Ga0163161_10360731
676 Ga0209673_1022491
677 Ga0209130_1000220
678 Ga0209130_1000525
679 Ga0209675_1000593
680 Ga0209025_1000010
681 Ga0209025_1000800
682 Ga0209025_1005981
683 Ga0209025_1046826
684 Ga0209025_1050270
685 Ga0209564_1000054
686 Ga0209564_1000441
687 Ga0209564_1002582
688 Ga0209758_1001635
689 Ga0209758_1003564
690 Ga0209256_1000330
691 Ga0209256_1000377
692 Ga0207426_1000085
693 Ga0209257_1035124
694 Ga0207697_10008920
695 Ga0207697_10077418
696 Ga0207656_10060609
697 Ga0207710_10041973
698 Ga0207647_10072944
699 Ga0207699_10070304
700 Ga0207645_10021627
701 Ga0207645_10064608
702 Ga0207643_10017601
703 Ga0207654_10008509
704 Ga0207707_10011825
705 Ga0207707_10013432
706 Ga0207707_10016138
707 Ga0207707_10199605
708 Ga0207707_10307467
709 Ga0207695_10033447
710 Ga0207695_10168136
711 Ga0207695_10258408
712 Ga0207671_10036622
713 Ga0207671_10143398
714 Ga0207660_10006100
715 Ga0207660_10041729
716 Ga0207657_10001149
717 Ga0207657_10001270
718 Ga0207657_10046987
719 Ga0207657_10132985
720 Ga0207657_10178340
721 Ga0207649_10083602
722 Ga0207652_10011118
723 Ga0207652_10012086
724 Ga0207681_10015969
725 Ga0207681_10127644
726 Ga0207694_10124455
727 Ga0207694_10331851
728 Ga0207650_10038086
729 Ga0207650_10042586
730 Ga0207650_10175688
731 Ga0207659_10251837
732 Ga0207687_10029517
733 Ga0207700_10125222
734 Ga0207664_10151029
735 Ga0207644_10011258
736 Ga0207644_10082163
737 Ga0207706_10000877
738 Ga0207706_10029854
739 Ga0207686_10086792
740 Ga0207669_10020712
741 Ga0207665_10176891
742 Ga0207665_10267837
743 Ga0207691_10026174
744 Ga0207691_10050233
745 Ga0207691_10142471
746 Ga0207691_10186795
747 Ga0207711_10017728
748 Ga0207661_10005037
749 Ga0207661_10048095
750 Ga0207661_10426043
751 Ga0207679_10009350
752 Ga0207679_10105499
753 Ga0207679_10129777
754 Ga0207667_10004939
755 Ga0207667_10007079
756 Ga0207667_10232446
757 Ga0207651_10044124
758 Ga0207712_10138173
759 Ga0207712_10155098
760 Ga0207640_10018257
761 Ga0207640_10115565
762 Ga0207658_10019413
763 Ga0207703_10294723
764 Ga0207639_10003121
765 Ga0207639_10167758
766 Ga0207678_10015994
767 Ga0207678_10049956
768 Ga0207678_10091350
769 Ga0207678_10154170
770 Ga0207708_10086631
771 Ga0207702_10034124
772 Ga0207702_10047367
773 Ga0207702_10164354
774 Ga0207641_10312403
775 Ga0207676_10044159
776 Ga0207674_10022357
777 Ga0207674_10119135
778 Ga0207674_10189599
779 Ga0207674_10208239
780 Ga0207675_100026820
781 Ga0207683_10003038
782 Ga0207683_10067452
783 Ga0207683_10153837
784 Ga0207698_10028097
785 Ga0207698_10188938
786 Ga0209588_1003466
787 Ga0268266_10012555
788 Ga0268266_10055839
789 Ga0268265_10077824
790 Ga0265334_10023700
791 Ga0307517_10000066
792 Ga0307517_10145296
793 Ga0265327_10010391
794 Ga0307408_100153348
795 Ga0307508_10158925
796 Ga0307516_10088935
797 Ga0307413_10035093
798 Ga0307406_10106757
799 Ga0307406_10138738
800 Ga0307406_10152386
801 Ga0307407_10114004
802 Ga0307412_10068252
803 Ga0307412_10141601
804 Ga0307409_100056206
805 Ga0307409_100193771
806 Ga0307409_100273601
807 Ga0307415_100062575
808 Ga0307510_10125794
809 Ga0373923_0003338
810 Ga0373936_0000090
811 Ga0373945_0001190
812 Ga0373954_0001396
813 Ga0373956_0005161
814 Ga0373943_0001574
815 Ga0373946_0003783
816 Ga0373955_0014399
817 Ga0373924_0065089
818 Ga0373931_0014330
819 Ga0373935_0000831
820 Ga0373927_0041680
821 Ga0373933_0032263
822 Ga0373933_0048435
823 Ga0373947_0001488
824 Ga0373937_0000003
825 Ga0373937_0178403
826 Ga0373925_0000052
827 Ga0395899_0184496
828 Ga0395900_0281616
829 Ga0395898_0316188
830 Ga0395905_0052502
831 Ga0395905_0208307
832 Ga0395901_0066624
833 Ga0439431_0014530
834 Ga0439445_0010513
835 Ga0439432_057870
836 Ga0466964_0078187
837 Ga0466957_0026618
838 Ga0451576_0166461
839 Ga0466958_0029523
840 Ga0466967_0070522
841 Ga0466967_0079996
842 Ga0495627_060317
843 Ga0495592_0000051
844 Ga0495629_0011126
845 Ga0495629_0036505
846 Ga0495651_0001023
847 Ga0495653_0000071
848 Ga0495662_0002014
849 Ga0495664_0000015
850 Ga0495594_0110128
851 Ga0495596_0039273
852 Ga0495608_0000025
853 Ga0495610_0023421
854 Ga0495610_0033777
855 Ga0495618_0000022
856 Ga0495628_0000011
857 Ga0495630_0002501
858 Ga0495631_0046269
859 Ga0495644_0021943
860 Ga0495648_0004300
861 Ga0495652_0000014
862 Ga0495640_0000008
863 Ga0495587_0000015
864 Ga0495645_0000020
865 Ga0495633_0071360
866 Ga0495667_0000013
867 Ga0495634_0000043
868 Ga0495625_0007298
869 Ga0495625_0110224
870 Ga0495635_0000012
871 Ga0495657_0000048
872 Ga0495599_0000008
873 Ga0495623_0000002
874 Ga0495646_0000004
875 Ga0495613_0009385
876 Ga0495624_0005836
877 Ga0495670_0053438
878 Ga0495670_0067091
879 Ga0495671_0103189
880 Ga0495600_0000231
881 Ga0495581_0004606
882 Ga0495604_0000001
883 Ga0495674_0000023
884 Ga0495680_0000510
885 Ga0495683_0078081
886 Ga0495675_0000023
887 Ga0495677_0069290
888 Ga0495681_0059073
889 Ga0495684_0000007
890 Ga0495686_0183564
891 Ga0495602_0000045
892 Ga0496101_0006389
893 Ga0496101_0080395
894 Ga0496103_0102914
895 Ga0496104_0092280
896 Ga0496105_0007494
897 Ga0496106_0011577
898 Ga0496106_0057584
899 Ga0496107_0003901
900 Ga0496107_0185625
901 Ga0496109_0265400
902 Ga0496110_0242935
903 Ga0496111_0003002
904 Ga0496111_0019157
905 Ga0496111_0274325
906 Ga0496114_0082425
907 Ga0496115_0017000
908 Ga0496115_0029494
909 Ga0496116_0000216
910 Ga0496117_0004522
911 Ga0496117_0052466
912 Ga0496117_0083147
913 Ga0496118_0028839
914 Ga0496118_0121454
915 Ga0496119_0044031
916 Ga0496121_0003971
917 Ga0496122_0001796
918 Ga0496122_0016625
919 Ga0496122_0114582
920 Ga0496123_0013643
921 Ga0496123_0037975
922 Ga0496124_0000023
923 Ga0496124_0027881
924 Ga0496126_0034271
925 Ga0501034_0007025
926 Ga0501034_0032509
927 Ga0501036_0124081
928 Ga0501038_0253341
929 Ga0501043_0273876
930 Ga0501047_0022956
931 Ga0501070_0174893
932 Ga0501073_0232269
933 Ga0501217_053293
934 Ga0501035_0041318
935 nmdc:mga03683_75757_c1
936 nmdc:mga08x19_84388_c1
937 Ga0495601_0000014
938 Ga0495612_0000014
939 Ga0495595_0000632
940 Ga0495619_0000006
941 Ga0500651_0001088
942 Ga0500593_010579
943 Ga0500595_002816
944 Ga0500595_002954
945 Ga0500595_006360
946 Ga0500642_0012817
947 Ga0500616_0081083
948 Ga0500622_0007959
949 Ga0500637_0017775
950 Ga0501082_0024741
951 2508726808
952 2509075977
953 2513913699
954 2513929269
955 2515633578
956 2515641540
957 2517041137
958 2599415506
959 2599717911
960 2600377046
961 2644192122
962 2644729433
963 2644734718
964 2644741985
965 2774871541
966 2776258225
967 2819717024
968 2835317966
969 2838035619
970 2841763392
971 2841916252
972 2841921079
973 2842335739
974 2844108737
975 2851182632
976 2851250844
977 2882459953
978 2917701998
979 2933021953
980 3003669318
981 3005411777
982 8057135781
983 8057534676
984 8057878076

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03401

TctC

Tripartite tricarboxylate transporter family receptor

79

360

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
2qpq-assembly2.cif.gz_B structure of bug27 from bordetella pertussis 0.9084 28 333
2qpq-assembly2.cif.gz_B structure of bug27 from bordetella pertussis 0.9026 28 333
8hk9-assembly2.cif.gz_A apo-form of periplasmic terephthalate binding protein (tbp) from ideonella sakaiensis 0.8962 31 329
8hk9-assembly2.cif.gz_A apo-form of periplasmic terephthalate binding protein (tbp) from ideonella sakaiensis 0.8876 31 329
2qpq-assembly3.cif.gz_C structure of bug27 from bordetella pertussis 0.8832 28 333
ID Description Score Start End Superfamily
4x9tA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8902 126 255 3.40.190.10
4x9tA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bordetella uptake gene, domain 1 0.8852 28 326 3.40.190.150
2qpqB01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bordetella uptake gene, domain 1 0.8721 28 333 3.40.190.150
4x9tA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bordetella uptake gene, domain 1 0.865 28 326 3.40.190.150
2dvzA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bordetella uptake gene, domain 1 0.8649 28 333 3.40.190.150
ID Description Score Start End GO Terms
AF-Q9I1Q8-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.969 17 333
AF-A0A3B9D0R1-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.9496 31 324
AF-U7GDX3-F1-model_v4 deleted 0.9341 35 333
AF-A0A6P3Z6M4-F1-model_v4 Uncharacterized protein LOC107407903 0.9314 59 329
AF-A0A439F197-F1-model_v4 deleted 0.9306 86 333

Map