F454263

General Info

Members Datasets Scaffolds Average Seq Length
492 267 984 295

Family's Representative Sequence

Representative Sequence 3300013100|Ga0157373_10007049|Ga0157373_100070496
Length 329
Sequence VPDAKTLRLELTSWRHIAIALCRLTQGGSMLKKHLFLAVLVTLVWGVNFPITKLGLRAIDPFVLTGIRFALAALPLVFFIKRPAVKFSYVAAYGFIFGLGMWGVINYGIQVGVSPGIASLIIQLSVFFTMGWGFVLFKEKIRGAQMIGAVLALIGLAGIISTQEGNHAVLGVLLIVLSAVAWSVGNVIIKKSGVKEIFSFMVWASLIPPIPLFLTAWLMHGSAAFEGLQSSLDLTAILSILFQVYLATHFAYWGWNSLLKLYPVSTVAPLSLLIPVFGITSSMLILDERISTPNLISIGIIIVGLAVGLYRRPVNLAPVEPQPIAHMDR

Samples

Sample ID Description Type Environment
1 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
2 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
3 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
4 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300003158 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_3 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
7 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
8 3300003300 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
9 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
10 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
11 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
12 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
13 3300003611 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_27 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
14 3300003613 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_31 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
15 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
16 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
17 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
18 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
19 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
20 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
21 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
22 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
23 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
30 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
31 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
32 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
33 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
34 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
35 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
36 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
37 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
38 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
39 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
40 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
41 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
42 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
43 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
44 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
45 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
46 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
47 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
48 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
49 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
50 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
51 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
52 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
53 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
54 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
55 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
69 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
70 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
71 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
72 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
73 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
74 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
75 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
76 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
77 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
78 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
79 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
80 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
81 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
82 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
83 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
84 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
85 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
86 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
87 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
88 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
89 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
90 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
91 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
92 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
93 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
94 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
95 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
96 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
97 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
98 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
99 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
100 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
101 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
102 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
103 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
104 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
105 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
106 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
107 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
108 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
109 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
110 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
111 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
112 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
113 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
114 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
115 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
116 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
117 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
118 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
119 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
120 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
121 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
122 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
123 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
124 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
125 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
126 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
127 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
128 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
129 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
130 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
131 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
132 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
133 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
134 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
135 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
136 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
137 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
138 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
139 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
140 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
141 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
142 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
143 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
144 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
145 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
146 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
147 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
148 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
149 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
150 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
151 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
152 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
153 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
154 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
155 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
156 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
157 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
158 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
159 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
160 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
161 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
162 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
163 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
164 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
165 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
166 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
167 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
168 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
169 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
170 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
171 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
172 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
173 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
174 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
175 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
176 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
177 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
178 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
179 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
180 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
181 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
182 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
183 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
184 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
185 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
186 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
187 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
188 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
189 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
195 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
196 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
197 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
198 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
199 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
200 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
201 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
202 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
203 2511231017 Pseudomonas sp. GM55 Isolate Nodule
204 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
205 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
206 2599185299 Pantoea ananatis NFR11 Isolate Rhizoplane
207 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
208 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
209 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
210 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
211 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
212 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
213 2684622997 Pantoea ananatis NFIX48 Isolate Rhizoplane
214 2711768156 Atlantibacter hermannii DDE1 Isolate Unclassified
215 2718217725 Pseudomonas fluorescens CREA-C16 Isolate Rhizosphere
216 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
217 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
218 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
219 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
220 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
221 2773857670 Pseudomonas sp. 478 Isolate Unclassified
222 2784132072 Pseudomonas sp. 460 Isolate Unclassified
223 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
224 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
225 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
226 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
227 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
228 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
229 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
230 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
231 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
232 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
233 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
234 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
235 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
236 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
237 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
238 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
239 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
240 2844528606 Pantoea sp. R-72498 v. 2 Isolate Unclassified
241 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
242 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
243 2860867994 Pseudomonas sp. R1-43-08 Isolate Rhizosphere
244 2865014394 Pantoea sp. R-71966 Isolate Unclassified
245 2881609920 Pantoea sp. ARC607 Isolate Rhizosphere
246 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
247 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
248 2919155634 Pseudomonas fulva 1992 Isolate Unclassified
249 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
250 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
251 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
252 2939602548 Pantoea dispersa 1175 Isolate Rhizosphere
253 2945951305 Pantoea agglomerans W2I1 Isolate Rhizosphere
254 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
255 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
256 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
257 2978975091 Pantoea anthophila SORGH_AS 797 Isolate Unclassified
258 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
259 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
260 646564506 Arcobacter nitrofigilis DSM 7299 Isolate Unclassified
261 8002392321 Alcaligenes faecalis Mc250 Isolate Rhizosphere
262 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
263 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
264 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
265 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
266 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
267 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 84.76
Metatranscriptomes 2.03
Isolates 13.21

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.44
Nodule 1.02
Rhizoplane 2.85
Rhizosphere 79.27
Stem 0
Stem Tuber 0
Unclassified 0.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157373_10007049 3300013100 Bacteria 8375
2 MRS2a_Contig_721 2124908027 Bacteria 19610
3 SwRhRL2b_contig_247870 2162886007 Bacteria 4021
4 SwRhRL2b_contig_2923456 2162886007 Bacteria 4019
5 MRS1b_contig_8350577 2162886011 Bacteria 1159
6 JGI24735J21928_10035854 3300002067 Bacteria 1456
7 Ga0006760J45825_103297 3300003158 Bacteria 4256
8 Ga0006759J45824_1016382 3300003163 Bacteria 8120
9 Ga0006758J48902_1011793 3300003300 Bacteria 6599
10 Ga0007417J51691_1017833 3300003544 Bacteria 8089
11 Ga0007410J51695_1007046 3300003574 Bacteria 8030
12 Ga0007409J51694_1004792 3300003575 Bacteria 8125
13 Ga0007416J51690_1010736 3300003577 Bacteria 8036
14 Ga0007411J51799_104236 3300003611 Bacteria 7782
15 Ga0007415J51800_107670 3300003613 Bacteria 5271
16 Ga0032354_1016427 3300003693 Bacteria 8075
17 Ga0055536_1000035 3300003781 Bacteria 145848
18 Ga0055530_10000004 3300003791 Bacteria 231465
19 Ga0055540_1000017 3300003792 Bacteria 231465
20 Ga0058692_1001295 3300003856 Bacteria 9491
21 Ga0058692_1004333 3300003856 Bacteria 4223
22 Ga0065714_10064569 3300005288 Bacteria 34851
23 Ga0065714_10081434 3300005288 Bacteria 2375
24 Ga0065704_10070458 3300005289 Bacteria 23980
25 Ga0065704_10107823 3300005289 Bacteria 2035
26 Ga0065712_10069944 3300005290 Bacteria 6483
27 Ga0070670_100001842 3300005331 Bacteria 17273
28 Ga0070660_100156535 3300005339 Bacteria 1834
29 Ga0070668_100009897 3300005347 Bacteria 7060
30 Ga0070665_100473683 3300005548 Bacteria 1263
31 Ga0068855_100018825 3300005563 Bacteria 8300
32 Ga0068856_100360538 3300005614 Bacteria 1472
33 Ga0075432_10015841 3300006058 Bacteria 2573
34 Ga0075369_10037489 3300006186 Bacteria 2065
35 Ga0079104_1002790 3300006946 Bacteria 8806
36 Ga0105251_10000037 3300009011 Bacteria 117409
37 Ga0105251_10002739 3300009011 Bacteria 13491
38 Ga0105251_10010689 3300009011 Bacteria 5298
39 Ga0105251_10037515 3300009011 Bacteria 2378
40 Ga0105244_10000741 3300009036 Bacteria 27900
41 Ga0105244_10015055 3300009036 Bacteria 4448
42 Ga0105244_10026869 3300009036 Bacteria 3110
43 Ga0105244_10051920 3300009036 Bacteria 2089
44 Ga0105244_10073982 3300009036 Bacteria 1695
45 Ga0105250_10000064 3300009092 Bacteria 100417
46 Ga0105250_10009335 3300009092 Bacteria 4135
47 Ga0105240_10002746 3300009093 Bacteria 27840
48 Ga0105240_10163021 3300009093 Bacteria 2646
49 Ga0105243_10068423 3300009148 Bacteria 2862
50 Ga0105241_10199536 3300009174 Bacteria 1670
51 Ga0105237_10037506 3300009545 Bacteria 4898
52 Ga0105237_10122690 3300009545 Bacteria 2592
53 Ga0105239_10028666 3300010375 Bacteria 6121
54 Ga0105246_10487012 3300011119 Bacteria 1045
55 Ga0157373_10000324 3300013100 Bacteria 38632
56 Ga0157373_10000472 3300013100 Bacteria 31894
57 Ga0157373_10001274 3300013100 Bacteria 19268
58 Ga0157373_10001338 3300013100 Bacteria 18862
59 Ga0157373_10003816 3300013100 Bacteria 11397
60 Ga0157373_10011410 3300013100 Bacteria 6535
61 Ga0157373_10015620 3300013100 Bacteria 5547
62 Ga0157371_10000249 3300013102 Bacteria 75638
63 Ga0157371_10000535 3300013102 Bacteria 45229
64 Ga0157371_10003685 3300013102 Bacteria 13756
65 Ga0157371_10006038 3300013102 Bacteria 10077
66 Ga0157370_10007207 3300013104 Bacteria 12135
67 Ga0157370_10030558 3300013104 Bacteria 5278
68 Ga0157370_10041542 3300013104 Bacteria 4436
69 Ga0157370_10147661 3300013104 Bacteria 2189
70 Ga0157370_10205335 3300013104 Bacteria 1827
71 Ga0157369_10005318 3300013105 Bacteria 15003
72 Ga0157369_10033503 3300013105 Bacteria 5645
73 Ga0157369_10034303 3300013105 Bacteria 5570
74 Ga0157369_10185612 3300013105 Bacteria 2187
75 Ga0157369_10200303 3300013105 Bacteria 2096
76 Ga0157374_10000172 3300013296 Bacteria 59888
77 Ga0163162_10001192 3300013306 Bacteria 24279
78 Ga0163162_10005827 3300013306 Bacteria 11912
79 Ga0163162_10031806 3300013306 Bacteria 5236
80 Ga0163162_10307083 3300013306 Bacteria 1719
81 Ga0157372_10002308 3300013307 Bacteria 20703
82 Ga0157375_10000731 3300013308 Bacteria 28959
83 Ga0157375_10011666 3300013308 Bacteria 7765
84 Ga0182008_10002478 3300014497 Bacteria 11541
85 Ga0182008_10038768 3300014497 Bacteria 2382
86 Ga0182008_10091939 3300014497 Bacteria 1496
87 Ga0182006_1001844 3300015261 Bacteria 12160
88 Ga0182006_1002068 3300015261 Bacteria 11245
89 Ga0182006_1011695 3300015261 Bacteria 3855
90 Ga0182006_1015845 3300015261 Bacteria 3224
91 Ga0182006_1024488 3300015261 Bacteria 2488
92 Ga0182007_10001696 3300015262 Bacteria 11633
93 Ga0182007_10001721 3300015262 Bacteria 11541
94 Ga0182007_10002929 3300015262 Bacteria 8290
95 Ga0182007_10015721 3300015262 Bacteria 2812
96 Ga0182005_1001061 3300015265 Bacteria 11626
97 Ga0182005_1001257 3300015265 Bacteria 10431
98 Ga0182005_1004800 3300015265 Bacteria 4305
99 Ga0183361_10004 3300016635 Bacteria 484183
100 Ga0163161_10000515 3300017792 Bacteria 31522
101 Ga0163161_10000642 3300017792 Bacteria 27902
102 Ga0163161_10094124 3300017792 Bacteria 2221
103 Ga0209759_1003198 3300025256 Bacteria 6644
104 Ga0209676_1000020 3300025292 Bacteria 617256
105 Ga0209676_1009772 3300025292 Bacteria 4089
106 Ga0209050_1000037 3300025298 Bacteria 415612
107 Ga0209051_1000040 3300025303 Bacteria 315055
108 Ga0207696_1000128 3300025711 Bacteria 134490
109 Ga0207696_1006941 3300025711 Bacteria 4490
110 Ga0207696_1009764 3300025711 Bacteria 3562
111 Ga0207655_1002398 3300025728 Bacteria 15273
112 Ga0207655_1003203 3300025728 Bacteria 12313
113 Ga0207655_1006607 3300025728 Bacteria 7650
114 Ga0207655_1023302 3300025728 Bacteria 3075
115 Ga0207655_1057377 3300025728 Bacteria 1529
116 Ga0207713_1000226 3300025735 Bacteria 76459
117 Ga0207713_1003313 3300025735 Bacteria 11070
118 Ga0207713_1005411 3300025735 Bacteria 7996
119 Ga0207713_1005809 3300025735 Bacteria 7636
120 Ga0207713_1035168 3300025735 Bacteria 2165
121 Ga0207647_10242762 3300025904 Bacteria 1034
122 Ga0207695_10245574 3300025913 Bacteria 1690
123 Ga0207671_10082468 3300025914 Bacteria 2413
124 Ga0207657_10043821 3300025919 Bacteria 3938
125 Ga0207650_10001125 3300025925 Bacteria 19680
126 Ga0207706_10193953 3300025933 Bacteria 1782
127 Ga0207709_10161478 3300025935 Bacteria 1563
128 Ga0209281_1007831 3300027111 Bacteria 2645
129 Ga0209371_1001095 3300027312 Bacteria 20186
130 Ga0209371_1003651 3300027312 Bacteria 7313
131 Ga0209371_1007888 3300027312 Bacteria 3623
132 Ga0207428_10014257 3300027907 Bacteria 6916
133 Ga0207428_10065293 3300027907 Bacteria 2872
134 Ga0207428_10179770 3300027907 Bacteria 1599
135 Ga0307517_10037838 3300028786 Bacteria 5371
136 Ga0268256_1001838 3300030500 Bacteria 11877
137 Ga0268256_1008167 3300030500 Bacteria 3623
138 Ga0265340_10010425 3300031247 Bacteria 4970
139 Ga0307408_100002400 3300031548 Bacteria 13205
140 Ga0307405_10000074 3300031731 Bacteria 43352
141 Ga0395900_0102427 3300037418 Bacteria 2941
142 Ga0395900_0118570 3300037418 Bacteria 2716
143 Ga0395898_0187581 3300037466 Bacteria 1976
144 Ga0395905_0120165 3300037471 Bacteria 2470
145 Ga0439438_000005 3300041405 Bacteria 408610
146 Ga0439438_009774 3300041405 Bacteria 3082
147 Ga0439447_008461 3300041407 Bacteria 3182
148 Ga0439447_018218 3300041407 Bacteria 1898
149 Ga0439466_0000009 3300041411 Bacteria 232657
150 Ga0439466_0002115 3300041411 Bacteria 7778
151 Ga0439431_0000044 3300041997 Bacteria 18341
152 Ga0439448_0000072 3300042005 Bacteria 17272
153 Ga0439432_011774 3300042006 Bacteria 3006
154 Ga0439451_008472 3300042009 Bacteria 2085
155 Ga0439451_011725 3300042009 Bacteria 1768
156 Ga0439456_003649 3300042013 Bacteria 3128
157 Ga0439463_000396 3300042016 Bacteria 12060
158 Ga0450904_001480 3300042139 Bacteria 3265
159 Ga0450904_009154 3300042139 Bacteria 976
160 Ga0450905_000879 3300042142 Bacteria 3755
161 Ga0450907_000802 3300042146 Bacteria 7816
162 Ga0439464_0050516 3300042439 Bacteria 1201
163 Ga0439460_0017109 3300042461 Bacteria 1939
164 Ga0466972_0034653 3300044658 Bacteria 2472
165 Ga0466982_0019772 3300044672 Bacteria 3810
166 Ga0466960_0002725 3300044901 Bacteria 6678
167 Ga0466959_0006238 3300045049 Bacteria 8240
168 Ga0495617_037200 3300046452 Bacteria 1630
169 Ga0495603_0078282 3300046455 Bacteria 1939
170 Ga0495590_0006075 3300046457 Bacteria 4738
171 Ga0495590_0013850 3300046457 Bacteria 2956
172 Ga0495590_0037611 3300046457 Bacteria 1687
173 Ga0495591_000889 3300046458 Bacteria 20922
174 Ga0495591_002440 3300046458 Bacteria 10345
175 Ga0495591_006243 3300046458 Bacteria 5312
176 Ga0495591_034450 3300046458 Bacteria 1490
177 Ga0495629_0009767 3300046459 Bacteria 7003
178 Ga0495629_0058814 3300046459 Bacteria 2687
179 Ga0495638_0002858 3300046460 Bacteria 13841
180 Ga0495638_0165334 3300046460 Bacteria 1273
181 Ga0495653_0000427 3300046463 Bacteria 33277
182 Ga0495653_0005140 3300046463 Bacteria 10623
183 Ga0495650_0000031 3300046471 Bacteria 433811
184 Ga0495650_0001802 3300046471 Bacteria 19309
185 Ga0495582_0005471 3300046473 Bacteria 7078
186 Ga0495582_0116634 3300046473 Bacteria 1502
187 Ga0495605_0000054 3300046474 Bacteria 157560
188 Ga0495605_0000577 3300046474 Bacteria 29725
189 Ga0495605_0001917 3300046474 Bacteria 13239
190 Ga0495605_0004359 3300046474 Bacteria 8325
191 Ga0495605_0013572 3300046474 Bacteria 4483
192 Ga0495605_0014374 3300046474 Bacteria 4339
193 Ga0495605_0069405 3300046474 Bacteria 1668
194 Ga0495639_0001848 3300046475 Bacteria 9366
195 Ga0495639_0010746 3300046475 Bacteria 3940
196 Ga0495639_0021608 3300046475 Bacteria 2818
197 Ga0495664_0046809 3300046477 Bacteria 2566
198 Ga0495584_0000296 3300046491 Bacteria 35158
199 Ga0495584_0008495 3300046491 Bacteria 5316
200 Ga0495585_0004289 3300046492 Bacteria 9283
201 Ga0495585_0006464 3300046492 Bacteria 7271
202 Ga0495585_0013439 3300046492 Bacteria 4791
203 Ga0495585_0072168 3300046492 Bacteria 1881
204 Ga0495594_0001807 3300046499 Bacteria 11115
205 Ga0495594_0010615 3300046499 Bacteria 4775
206 Ga0495596_0016678 3300046500 Bacteria 3048
207 Ga0495607_0001695 3300046501 Bacteria 18961
208 Ga0495607_0007425 3300046501 Bacteria 7587
209 Ga0495607_0032144 3300046501 Bacteria 3206
210 Ga0495583_0000921 3300046506 Bacteria 34568
211 Ga0495583_0006973 3300046506 Bacteria 7239
212 Ga0495583_0013366 3300046506 Bacteria 4582
213 Ga0495606_0000032 3300046507 Bacteria 248690
214 Ga0495606_0000342 3300046507 Bacteria 80008
215 Ga0495606_0009766 3300046507 Bacteria 8067
216 Ga0495606_0021725 3300046507 Bacteria 4694
217 Ga0495606_0023664 3300046507 Bacteria 4444
218 Ga0495606_0042837 3300046507 Bacteria 3024
219 Ga0495610_0003144 3300046512 Bacteria 13112
220 Ga0495610_0045370 3300046512 Bacteria 2175
221 Ga0495610_0091631 3300046512 Bacteria 1377
222 Ga0495616_0001017 3300046513 Bacteria 20071
223 Ga0495616_0003445 3300046513 Bacteria 10124
224 Ga0495616_0061402 3300046513 Bacteria 1843
225 Ga0495616_0062019 3300046513 Bacteria 1832
226 Ga0495628_0003599 3300046516 Bacteria 13866
227 Ga0495630_0004349 3300046517 Bacteria 9943
228 Ga0495630_0029053 3300046517 Bacteria 4110
229 Ga0495631_0041782 3300046518 Bacteria 2028
230 Ga0495632_0001457 3300046519 Bacteria 19671
231 Ga0495632_0003532 3300046519 Bacteria 11056
232 Ga0495632_0004761 3300046519 Bacteria 9142
233 Ga0495637_0001431 3300046520 Bacteria 14063
234 Ga0495637_0031012 3300046520 Bacteria 2367
235 Ga0495637_0032464 3300046520 Bacteria 2299
236 Ga0495643_0036497 3300046522 Bacteria 2699
237 Ga0495643_0043743 3300046522 Bacteria 2436
238 Ga0495644_0081596 3300046523 Bacteria 1219
239 Ga0495644_0095108 3300046523 Bacteria 1125
240 Ga0495648_0003522 3300046524 Bacteria 13715
241 Ga0495648_0003591 3300046524 Bacteria 13567
242 Ga0495648_0006591 3300046524 Bacteria 9440
243 Ga0495648_0010226 3300046524 Bacteria 7166
244 Ga0495648_0030701 3300046524 Bacteria 3549
245 Ga0495648_0074392 3300046524 Bacteria 1957
246 Ga0495666_0000767 3300046526 Bacteria 14819
247 Ga0495642_0000198 3300046528 Bacteria 35398
248 Ga0495642_0000541 3300046528 Bacteria 19038
249 Ga0495642_0001632 3300046528 Bacteria 9761
250 Ga0495652_0005777 3300046529 Bacteria 11585
251 Ga0495654_0000217 3300046530 Bacteria 53975
252 Ga0495654_0000391 3300046530 Bacteria 37667
253 Ga0495654_0002411 3300046530 Bacteria 12053
254 Ga0495654_0004321 3300046530 Bacteria 8467
255 Ga0495654_0016027 3300046530 Bacteria 3970
256 Ga0495654_0025559 3300046530 Bacteria 3041
257 Ga0495654_0047292 3300046530 Bacteria 2115
258 Ga0495665_0000011 3300046531 Bacteria 71017
259 Ga0495586_0002141 3300046535 Bacteria 10724
260 Ga0495587_0008365 3300046536 Bacteria 6657
261 Ga0495609_0020144 3300046538 Bacteria 3082
262 Ga0495609_0026523 3300046538 Bacteria 2652
263 Ga0495609_0082368 3300046538 Bacteria 1405
264 Ga0495597_0003398 3300046542 Bacteria 9321
265 Ga0495645_0018134 3300046543 Bacteria 5052
266 Ga0495645_0104082 3300046543 Bacteria 2016
267 Ga0495622_0000863 3300046557 Bacteria 16601
268 Ga0495622_0029404 3300046557 Bacteria 2567
269 Ga0495656_0039629 3300046615 Bacteria 1958
270 Ga0495625_0034877 3300046660 Bacteria 3710
271 Ga0495625_0047453 3300046660 Bacteria 3097
272 Ga0495625_0063749 3300046660 Bacteria 2602
273 Ga0495625_0067981 3300046660 Bacteria 2505
274 Ga0495625_0101375 3300046660 Bacteria 1977
275 Ga0495635_0007421 3300046663 Bacteria 7651
276 Ga0495659_0011654 3300046664 Bacteria 2833
277 Ga0495659_0067856 3300046664 Bacteria 1331
278 Ga0495661_0002506 3300046665 Bacteria 14119
279 Ga0495661_0006348 3300046665 Bacteria 8316
280 Ga0495661_0082776 3300046665 Bacteria 1846
281 Ga0495588_0082930 3300046674 Bacteria 1674
282 Ga0495623_0000739 3300046679 Bacteria 21877
283 Ga0495646_0000741 3300046680 Bacteria 18144
284 Ga0495646_0018289 3300046680 Bacteria 4439
285 Ga0495669_0084152 3300046684 Bacteria 1462
286 Ga0495613_0007033 3300046689 Bacteria 8375
287 Ga0495624_0002232 3300046690 Bacteria 14756
288 Ga0495670_0003682 3300046691 Bacteria 7535
289 Ga0495670_0004988 3300046691 Bacteria 6524
290 Ga0495670_0008571 3300046691 Bacteria 5034
291 Ga0495670_0046601 3300046691 Bacteria 2165
292 Ga0495671_0001781 3300046692 Bacteria 13932
293 Ga0495671_0004883 3300046692 Bacteria 7930
294 Ga0495671_0005238 3300046692 Bacteria 7617
295 Ga0495671_0175723 3300046692 Bacteria 1040
296 Ga0495649_0000013 3300046694 Bacteria 316013
297 Ga0495649_0002920 3300046694 Bacteria 11829
298 Ga0495649_0009644 3300046694 Bacteria 5723
299 Ga0495649_0029605 3300046694 Bacteria 3028
300 Ga0495589_0001953 3300046794 Bacteria 11676
301 Ga0495589_0005095 3300046794 Bacteria 6952
302 Ga0495589_0005509 3300046794 Bacteria 6675
303 Ga0495589_0022380 3300046794 Bacteria 3225
304 Ga0495600_0051874 3300046809 Bacteria 2677
305 Ga0495660_0000136 3300046810 Bacteria 79750
306 Ga0495660_0002857 3300046810 Bacteria 10859
307 Ga0495660_0007266 3300046810 Bacteria 6518
308 Ga0495660_0017296 3300046810 Bacteria 4152
309 Ga0495660_0024250 3300046810 Bacteria 3455
310 Ga0495660_0029610 3300046810 Bacteria 3087
311 Ga0495660_0059507 3300046810 Bacteria 2054
312 Ga0495581_0001940 3300047315 Bacteria 11607
313 Ga0495604_0001691 3300047317 Bacteria 18141
314 Ga0495636_0010018 3300047318 Bacteria 3735
315 Ga0495636_0016513 3300047318 Bacteria 2949
316 Ga0495674_0002038 3300047319 Bacteria 19843
317 Ga0495672_0000001 3300047320 Bacteria 1458820
318 Ga0495672_0000053 3300047320 Bacteria 233823
319 Ga0495672_0010193 3300047320 Bacteria 6716
320 Ga0495672_0013560 3300047320 Bacteria 5617
321 Ga0495672_0014191 3300047320 Bacteria 5465
322 Ga0495672_0038663 3300047320 Bacteria 2908
323 Ga0495672_0044768 3300047320 Bacteria 2652
324 Ga0495680_0002868 3300047322 Bacteria 17320
325 Ga0495680_0003576 3300047322 Bacteria 15215
326 Ga0495683_0000815 3300047323 Bacteria 22198
327 Ga0495683_0003990 3300047323 Bacteria 8487
328 Ga0495683_0013307 3300047323 Bacteria 4306
329 Ga0495683_0014164 3300047323 Bacteria 4155
330 Ga0495683_0020536 3300047323 Bacteria 3406
331 Ga0495687_025127 3300047443 Bacteria 2821
332 Ga0495675_0004669 3300047444 Bacteria 8318
333 Ga0495675_0005342 3300047444 Bacteria 7827
334 Ga0495679_000431 3300047446 Bacteria 31084
335 Ga0495679_005287 3300047446 Bacteria 5753
336 Ga0495679_005834 3300047446 Bacteria 5412
337 Ga0495685_018874 3300047447 Bacteria 2367
338 Ga0495673_0000073 3300047469 Bacteria 211743
339 Ga0495673_0019590 3300047469 Bacteria 3387
340 Ga0495673_0032200 3300047469 Bacteria 2447
341 Ga0495673_0037115 3300047469 Bacteria 2229
342 Ga0495673_0053373 3300047469 Bacteria 1762
343 Ga0495673_0074862 3300047469 Bacteria 1415
344 Ga0495681_0001109 3300047470 Bacteria 20427
345 Ga0495593_0000147 3300047673 Bacteria 34669
346 Ga0495602_0001906 3300048088 Bacteria 20930
347 Ga0495626_0000511 3300048091 Bacteria 38840
348 Ga0495626_0001789 3300048091 Bacteria 16252
349 Ga0495626_0004017 3300048091 Bacteria 9175
350 Ga0495626_0004615 3300048091 Bacteria 8391
351 Ga0495626_0084392 3300048091 Bacteria 1405
352 Ga0496100_0178513 3300048903 Bacteria 1534
353 Ga0496105_0032106 3300048908 Bacteria 4307
354 Ga0496105_0165038 3300048908 Bacteria 1817
355 Ga0496105_0172358 3300048908 Bacteria 1773
356 Ga0496109_0252273 3300048912 Bacteria 1662
357 Ga0496110_0030519 3300048913 Bacteria 4647
358 Ga0496111_0162685 3300048914 Bacteria 1657
359 Ga0496115_0451050 3300048918 Bacteria 1039
360 Ga0496116_0000065 3300048919 Bacteria 265193
361 Ga0496116_0057563 3300048919 Bacteria 2540
362 Ga0496117_0000143 3300048920 Bacteria 156096
363 Ga0496117_0000268 3300048920 Bacteria 98537
364 Ga0496117_0001860 3300048920 Bacteria 28482
365 Ga0496117_0075226 3300048920 Bacteria 2244
366 Ga0496118_0000085 3300048921 Bacteria 179731
367 Ga0496118_0001427 3300048921 Bacteria 35987
368 Ga0496118_0001797 3300048921 Bacteria 30957
369 Ga0496118_0047894 3300048921 Bacteria 3308
370 Ga0496119_0000015 3300048922 Bacteria 312979
371 Ga0496119_0000162 3300048922 Bacteria 92734
372 Ga0496119_0000229 3300048922 Bacteria 78634
373 Ga0496119_0036253 3300048922 Bacteria 3222
374 Ga0496119_0185153 3300048922 Bacteria 1089
375 Ga0496120_0000029 3300048923 Bacteria 229859
376 Ga0496120_0000107 3300048923 Bacteria 139739
377 Ga0496120_0001675 3300048923 Bacteria 25486
378 Ga0496120_0056051 3300048923 Bacteria 2226
379 Ga0496121_0000504 3300048924 Bacteria 74639
380 Ga0496121_0002976 3300048924 Bacteria 24661
381 Ga0496121_0026094 3300048924 Bacteria 5519
382 Ga0496122_0024058 3300048925 Bacteria 5341
383 Ga0496122_0025705 3300048925 Bacteria 5103
384 Ga0496122_0028602 3300048925 Bacteria 4723
385 Ga0496122_0105506 3300048925 Bacteria 1868
386 Ga0496122_0169444 3300048925 Bacteria 1318
387 Ga0496123_0004518 3300048926 Bacteria 14543
388 Ga0496123_0055146 3300048926 Bacteria 2609
389 Ga0496123_0106765 3300048926 Bacteria 1612
390 Ga0496123_0112497 3300048926 Bacteria 1552
391 Ga0496124_0000216 3300048927 Bacteria 112485
392 Ga0496124_0024763 3300048927 Bacteria 5449
393 Ga0496124_0026269 3300048927 Bacteria 5255
394 Ga0496124_0029897 3300048927 Bacteria 4846
395 Ga0496124_0035498 3300048927 Bacteria 4361
396 Ga0496125_0001791 3300048928 Bacteria 29691
397 Ga0496125_0064177 3300048928 Bacteria 2920
398 Ga0496125_0064697 3300048928 Bacteria 2903
399 Ga0496125_0138666 3300048928 Bacteria 1695
400 Ga0496126_0002235 3300048929 Bacteria 26772
401 Ga0496126_0043639 3300048929 Bacteria 4134
402 Ga0496126_0156270 3300048929 Bacteria 1951
403 Ga0496126_0218864 3300048929 Bacteria 1600
404 Ga0495678_000440 3300049459 Bacteria 41527
405 Ga0495678_000535 3300049459 Bacteria 36733
406 Ga0495678_001566 3300049459 Bacteria 17568
407 Ga0495678_007615 3300049459 Bacteria 5589
408 Ga0495678_031102 3300049459 Bacteria 2229
409 Ga0495682_0000884 3300049460 Bacteria 18557
410 Ga0495682_0003323 3300049460 Bacteria 7180
411 Ga0495682_0004636 3300049460 Bacteria 5833
412 Ga0495682_0016604 3300049460 Bacteria 2785
413 Ga0501032_0191681 3300049569 Unclassified 1336
414 Ga0501037_0515898 3300049573 Unclassified 809
415 Ga0501038_0137171 3300049574 Bacteria 2003
416 Ga0501043_0381323 3300049579 Bacteria 1067
417 Ga0501047_0140003 3300049581 Bacteria 2298
418 Ga0501073_0071827 3300049589 Bacteria 2411
419 Ga0501083_0040042 3300049744 Bacteria 3181
420 Ga0501241_000038 3300049758 Bacteria 43033
421 Ga0501269_000622 3300049766 Bacteria 6201
422 Ga0501269_000745 3300049766 Bacteria 5254
423 Ga0501044_0258191 3300049823 Bacteria 1681
424 nmdc:mga0sz30_33926_c1 3300050516 Bacteria 2122
425 Ga0500621_000002 3300053126 Bacteria 849473
426 Ga0500586_000694 3300053145 Bacteria 6888
427 Ga0500634_0013579 3300053161 Bacteria 4276
428 2511333750 2511231017 Bacteria 6503007
429 2514051701 2513237166 Bacteria 10373764
430 2599880978 2599185288 Bacteria 6666191
431 2599928676 2599185299 Bacteria 4854625
432 2599931803 2599185300 Bacteria 6062622
433 2599951191 2599185303 Bacteria 6512725
434 2599992887 2599185311 Bacteria 6354990
435 2621299161 2619619299 Bacteria 6649820
436 2624489360 2623620446 Bacteria 6500345
437 2644189149 2643221633 Bacteria 6733554
438 2686355105 2684622997 Bacteria 4624240
439 2712469765 2711768156 Bacteria 4471618
440 2718634485 2718217725 Bacteria 5758958
441 2738672318 2738541265 Bacteria 6594665
442 2738750711 2738541282 Bacteria 6593925
443 2738812174 2738541294 Bacteria 6925949
444 2738859752 2738541303 Bacteria 6591772
445 2738899534 2738541309 Bacteria 6926455
446 2774119047 2773857670 Bacteria 6407454
447 2784312686 2784132072 Bacteria 6596533
448 2808857977 2808606361 Bacteria 6136259
449 2808926443 2808606376 Bacteria 6248667
450 2808930191 2808606377 Bacteria 6646337
451 2808938181 2808606378 Bacteria 6177535
452 2808948633 2808606380 Bacteria 6248705
453 2808952244 2808606381 Bacteria 6646461
454 2808966433 2808606383 Bacteria 6138645
455 2808972121 2808606384 Bacteria 8474373
456 2808978623 2808606385 Bacteria 6711065
457 2808993850 2808606388 Bacteria 6706662
458 2809001263 2808606389 Bacteria 6138126
459 2809006961 2808606390 Bacteria 8476311
460 2809014099 2808606391 Bacteria 8308166
461 2817491752 2816332298 Bacteria 6852809
462 2826586485 2826581358 Bacteria 5963467
463 2834030333 2834028612 Bacteria 6354979
464 2842854464 2842849001 Bacteria 5924277
465 2844530904 2844528606 Bacteria 4733806
466 2852617346 2852612431 Bacteria 6885235
467 2852672535 2852667396 Bacteria 6885555
468 2860871432 2860867994 Bacteria 5645326
469 2865015276 2865014394 Bacteria 4764573
470 2881612286 2881609920 Bacteria 4405319
471 2904552104 2904550169 Bacteria 6221258
472 2908450258 2908446538 Bacteria 6829095
473 2919159615 2919155634 Bacteria 4860545
474 2919702435 2919697872 Bacteria 6553725
475 2923588092 2923586266 Bacteria 6565975
476 2931374812 2931369376 Bacteria 6847892
477 2939603807 2939602548 Bacteria 4950493
478 2945952973 2945951305 Bacteria 4918162
479 2946009305 2946006987 Bacteria 6705746
480 2946031934 2946027586 Bacteria 6049274
481 2974291505 2974289157 Bacteria 6080362
482 2978979523 2978975091 Bacteria 4704313
483 3007617923 3007614139 Bacteria 6053559
484 3007622853 3007619802 Bacteria 6411688
485 646812278 646564506 Bacteria 3192235
486 8002392944 8002392321 Bacteria 4159911
487 8019779658 8019775933 Bacteria 6858656
488 8054164406 8054160619 Bacteria 7783213
489 8054287682 8054285046 Bacteria 6919322
490 8054505740 8054503363 Bacteria 6101651
491 8055820255 8055817908 Bacteria 6609162
492 8056177323 8056172158 Bacteria 6133900
493 Ga0157373_10007049
494 MRS2a_Contig_721
495 SwRhRL2b_contig_247870
496 SwRhRL2b_contig_2923456
497 MRS1b_contig_8350577
498 JGI24735J21928_10035854
499 Ga0006760J45825_103297
500 Ga0006759J45824_1016382
501 Ga0006758J48902_1011793
502 Ga0007417J51691_1017833
503 Ga0007410J51695_1007046
504 Ga0007409J51694_1004792
505 Ga0007416J51690_1010736
506 Ga0007411J51799_104236
507 Ga0007415J51800_107670
508 Ga0032354_1016427
509 Ga0055536_1000035
510 Ga0055530_10000004
511 Ga0055540_1000017
512 Ga0058692_1001295
513 Ga0058692_1004333
514 Ga0065714_10064569
515 Ga0065714_10081434
516 Ga0065704_10070458
517 Ga0065704_10107823
518 Ga0065712_10069944
519 Ga0070670_100001842
520 Ga0070660_100156535
521 Ga0070668_100009897
522 Ga0070665_100473683
523 Ga0068855_100018825
524 Ga0068856_100360538
525 Ga0075432_10015841
526 Ga0075369_10037489
527 Ga0079104_1002790
528 Ga0105251_10000037
529 Ga0105251_10002739
530 Ga0105251_10010689
531 Ga0105251_10037515
532 Ga0105244_10000741
533 Ga0105244_10015055
534 Ga0105244_10026869
535 Ga0105244_10051920
536 Ga0105244_10073982
537 Ga0105250_10000064
538 Ga0105250_10009335
539 Ga0105240_10002746
540 Ga0105240_10163021
541 Ga0105243_10068423
542 Ga0105241_10199536
543 Ga0105237_10037506
544 Ga0105237_10122690
545 Ga0105239_10028666
546 Ga0105246_10487012
547 Ga0157373_10000324
548 Ga0157373_10000472
549 Ga0157373_10001274
550 Ga0157373_10001338
551 Ga0157373_10003816
552 Ga0157373_10011410
553 Ga0157373_10015620
554 Ga0157371_10000249
555 Ga0157371_10000535
556 Ga0157371_10003685
557 Ga0157371_10006038
558 Ga0157370_10007207
559 Ga0157370_10030558
560 Ga0157370_10041542
561 Ga0157370_10147661
562 Ga0157370_10205335
563 Ga0157369_10005318
564 Ga0157369_10033503
565 Ga0157369_10034303
566 Ga0157369_10185612
567 Ga0157369_10200303
568 Ga0157374_10000172
569 Ga0163162_10001192
570 Ga0163162_10005827
571 Ga0163162_10031806
572 Ga0163162_10307083
573 Ga0157372_10002308
574 Ga0157375_10000731
575 Ga0157375_10011666
576 Ga0182008_10002478
577 Ga0182008_10038768
578 Ga0182008_10091939
579 Ga0182006_1001844
580 Ga0182006_1002068
581 Ga0182006_1011695
582 Ga0182006_1015845
583 Ga0182006_1024488
584 Ga0182007_10001696
585 Ga0182007_10001721
586 Ga0182007_10002929
587 Ga0182007_10015721
588 Ga0182005_1001061
589 Ga0182005_1001257
590 Ga0182005_1004800
591 Ga0183361_10004
592 Ga0163161_10000515
593 Ga0163161_10000642
594 Ga0163161_10094124
595 Ga0209759_1003198
596 Ga0209676_1000020
597 Ga0209676_1009772
598 Ga0209050_1000037
599 Ga0209051_1000040
600 Ga0207696_1000128
601 Ga0207696_1006941
602 Ga0207696_1009764
603 Ga0207655_1002398
604 Ga0207655_1003203
605 Ga0207655_1006607
606 Ga0207655_1023302
607 Ga0207655_1057377
608 Ga0207713_1000226
609 Ga0207713_1003313
610 Ga0207713_1005411
611 Ga0207713_1005809
612 Ga0207713_1035168
613 Ga0207647_10242762
614 Ga0207695_10245574
615 Ga0207671_10082468
616 Ga0207657_10043821
617 Ga0207650_10001125
618 Ga0207706_10193953
619 Ga0207709_10161478
620 Ga0209281_1007831
621 Ga0209371_1001095
622 Ga0209371_1003651
623 Ga0209371_1007888
624 Ga0207428_10014257
625 Ga0207428_10065293
626 Ga0207428_10179770
627 Ga0307517_10037838
628 Ga0268256_1001838
629 Ga0268256_1008167
630 Ga0265340_10010425
631 Ga0307408_100002400
632 Ga0307405_10000074
633 Ga0395900_0102427
634 Ga0395900_0118570
635 Ga0395898_0187581
636 Ga0395905_0120165
637 Ga0439438_000005
638 Ga0439438_009774
639 Ga0439447_008461
640 Ga0439447_018218
641 Ga0439466_0000009
642 Ga0439466_0002115
643 Ga0439431_0000044
644 Ga0439448_0000072
645 Ga0439432_011774
646 Ga0439451_008472
647 Ga0439451_011725
648 Ga0439456_003649
649 Ga0439463_000396
650 Ga0450904_001480
651 Ga0450904_009154
652 Ga0450905_000879
653 Ga0450907_000802
654 Ga0439464_0050516
655 Ga0439460_0017109
656 Ga0466972_0034653
657 Ga0466982_0019772
658 Ga0466960_0002725
659 Ga0466959_0006238
660 Ga0495617_037200
661 Ga0495603_0078282
662 Ga0495590_0006075
663 Ga0495590_0013850
664 Ga0495590_0037611
665 Ga0495591_000889
666 Ga0495591_002440
667 Ga0495591_006243
668 Ga0495591_034450
669 Ga0495629_0009767
670 Ga0495629_0058814
671 Ga0495638_0002858
672 Ga0495638_0165334
673 Ga0495653_0000427
674 Ga0495653_0005140
675 Ga0495650_0000031
676 Ga0495650_0001802
677 Ga0495582_0005471
678 Ga0495582_0116634
679 Ga0495605_0000054
680 Ga0495605_0000577
681 Ga0495605_0001917
682 Ga0495605_0004359
683 Ga0495605_0013572
684 Ga0495605_0014374
685 Ga0495605_0069405
686 Ga0495639_0001848
687 Ga0495639_0010746
688 Ga0495639_0021608
689 Ga0495664_0046809
690 Ga0495584_0000296
691 Ga0495584_0008495
692 Ga0495585_0004289
693 Ga0495585_0006464
694 Ga0495585_0013439
695 Ga0495585_0072168
696 Ga0495594_0001807
697 Ga0495594_0010615
698 Ga0495596_0016678
699 Ga0495607_0001695
700 Ga0495607_0007425
701 Ga0495607_0032144
702 Ga0495583_0000921
703 Ga0495583_0006973
704 Ga0495583_0013366
705 Ga0495606_0000032
706 Ga0495606_0000342
707 Ga0495606_0009766
708 Ga0495606_0021725
709 Ga0495606_0023664
710 Ga0495606_0042837
711 Ga0495610_0003144
712 Ga0495610_0045370
713 Ga0495610_0091631
714 Ga0495616_0001017
715 Ga0495616_0003445
716 Ga0495616_0061402
717 Ga0495616_0062019
718 Ga0495628_0003599
719 Ga0495630_0004349
720 Ga0495630_0029053
721 Ga0495631_0041782
722 Ga0495632_0001457
723 Ga0495632_0003532
724 Ga0495632_0004761
725 Ga0495637_0001431
726 Ga0495637_0031012
727 Ga0495637_0032464
728 Ga0495643_0036497
729 Ga0495643_0043743
730 Ga0495644_0081596
731 Ga0495644_0095108
732 Ga0495648_0003522
733 Ga0495648_0003591
734 Ga0495648_0006591
735 Ga0495648_0010226
736 Ga0495648_0030701
737 Ga0495648_0074392
738 Ga0495666_0000767
739 Ga0495642_0000198
740 Ga0495642_0000541
741 Ga0495642_0001632
742 Ga0495652_0005777
743 Ga0495654_0000217
744 Ga0495654_0000391
745 Ga0495654_0002411
746 Ga0495654_0004321
747 Ga0495654_0016027
748 Ga0495654_0025559
749 Ga0495654_0047292
750 Ga0495665_0000011
751 Ga0495586_0002141
752 Ga0495587_0008365
753 Ga0495609_0020144
754 Ga0495609_0026523
755 Ga0495609_0082368
756 Ga0495597_0003398
757 Ga0495645_0018134
758 Ga0495645_0104082
759 Ga0495622_0000863
760 Ga0495622_0029404
761 Ga0495656_0039629
762 Ga0495625_0034877
763 Ga0495625_0047453
764 Ga0495625_0063749
765 Ga0495625_0067981
766 Ga0495625_0101375
767 Ga0495635_0007421
768 Ga0495659_0011654
769 Ga0495659_0067856
770 Ga0495661_0002506
771 Ga0495661_0006348
772 Ga0495661_0082776
773 Ga0495588_0082930
774 Ga0495623_0000739
775 Ga0495646_0000741
776 Ga0495646_0018289
777 Ga0495669_0084152
778 Ga0495613_0007033
779 Ga0495624_0002232
780 Ga0495670_0003682
781 Ga0495670_0004988
782 Ga0495670_0008571
783 Ga0495670_0046601
784 Ga0495671_0001781
785 Ga0495671_0004883
786 Ga0495671_0005238
787 Ga0495671_0175723
788 Ga0495649_0000013
789 Ga0495649_0002920
790 Ga0495649_0009644
791 Ga0495649_0029605
792 Ga0495589_0001953
793 Ga0495589_0005095
794 Ga0495589_0005509
795 Ga0495589_0022380
796 Ga0495600_0051874
797 Ga0495660_0000136
798 Ga0495660_0002857
799 Ga0495660_0007266
800 Ga0495660_0017296
801 Ga0495660_0024250
802 Ga0495660_0029610
803 Ga0495660_0059507
804 Ga0495581_0001940
805 Ga0495604_0001691
806 Ga0495636_0010018
807 Ga0495636_0016513
808 Ga0495674_0002038
809 Ga0495672_0000001
810 Ga0495672_0000053
811 Ga0495672_0010193
812 Ga0495672_0013560
813 Ga0495672_0014191
814 Ga0495672_0038663
815 Ga0495672_0044768
816 Ga0495680_0002868
817 Ga0495680_0003576
818 Ga0495683_0000815
819 Ga0495683_0003990
820 Ga0495683_0013307
821 Ga0495683_0014164
822 Ga0495683_0020536
823 Ga0495687_025127
824 Ga0495675_0004669
825 Ga0495675_0005342
826 Ga0495679_000431
827 Ga0495679_005287
828 Ga0495679_005834
829 Ga0495685_018874
830 Ga0495673_0000073
831 Ga0495673_0019590
832 Ga0495673_0032200
833 Ga0495673_0037115
834 Ga0495673_0053373
835 Ga0495673_0074862
836 Ga0495681_0001109
837 Ga0495593_0000147
838 Ga0495602_0001906
839 Ga0495626_0000511
840 Ga0495626_0001789
841 Ga0495626_0004017
842 Ga0495626_0004615
843 Ga0495626_0084392
844 Ga0496100_0178513
845 Ga0496105_0032106
846 Ga0496105_0165038
847 Ga0496105_0172358
848 Ga0496109_0252273
849 Ga0496110_0030519
850 Ga0496111_0162685
851 Ga0496115_0451050
852 Ga0496116_0000065
853 Ga0496116_0057563
854 Ga0496117_0000143
855 Ga0496117_0000268
856 Ga0496117_0001860
857 Ga0496117_0075226
858 Ga0496118_0000085
859 Ga0496118_0001427
860 Ga0496118_0001797
861 Ga0496118_0047894
862 Ga0496119_0000015
863 Ga0496119_0000162
864 Ga0496119_0000229
865 Ga0496119_0036253
866 Ga0496119_0185153
867 Ga0496120_0000029
868 Ga0496120_0000107
869 Ga0496120_0001675
870 Ga0496120_0056051
871 Ga0496121_0000504
872 Ga0496121_0002976
873 Ga0496121_0026094
874 Ga0496122_0024058
875 Ga0496122_0025705
876 Ga0496122_0028602
877 Ga0496122_0105506
878 Ga0496122_0169444
879 Ga0496123_0004518
880 Ga0496123_0055146
881 Ga0496123_0106765
882 Ga0496123_0112497
883 Ga0496124_0000216
884 Ga0496124_0024763
885 Ga0496124_0026269
886 Ga0496124_0029897
887 Ga0496124_0035498
888 Ga0496125_0001791
889 Ga0496125_0064177
890 Ga0496125_0064697
891 Ga0496125_0138666
892 Ga0496126_0002235
893 Ga0496126_0043639
894 Ga0496126_0156270
895 Ga0496126_0218864
896 Ga0495678_000440
897 Ga0495678_000535
898 Ga0495678_001566
899 Ga0495678_007615
900 Ga0495678_031102
901 Ga0495682_0000884
902 Ga0495682_0003323
903 Ga0495682_0004636
904 Ga0495682_0016604
905 Ga0501032_0191681
906 Ga0501037_0515898
907 Ga0501038_0137171
908 Ga0501043_0381323
909 Ga0501047_0140003
910 Ga0501073_0071827
911 Ga0501083_0040042
912 Ga0501241_000038
913 Ga0501269_000622
914 Ga0501269_000745
915 Ga0501044_0258191
916 nmdc:mga0sz30_33926_c1
917 Ga0500621_000002
918 Ga0500586_000694
919 Ga0500634_0013579
920 2511333750
921 2514051701
922 2599880978
923 2599928676
924 2599931803
925 2599951191
926 2599992887
927 2621299161
928 2624489360
929 2644189149
930 2686355105
931 2712469765
932 2718634485
933 2738672318
934 2738750711
935 2738812174
936 2738859752
937 2738899534
938 2774119047
939 2784312686
940 2808857977
941 2808926443
942 2808930191
943 2808938181
944 2808948633
945 2808952244
946 2808966433
947 2808972121
948 2808978623
949 2808993850
950 2809001263
951 2809006961
952 2809014099
953 2817491752
954 2826586485
955 2834030333
956 2842854464
957 2844530904
958 2852617346
959 2852672535
960 2860871432
961 2865015276
962 2881612286
963 2904552104
964 2908450258
965 2919159615
966 2919702435
967 2923588092
968 2931374812
969 2939603807
970 2945952973
971 2946009305
972 2946031934
973 2974291505
974 2978979523
975 3007617923
976 3007622853
977 646812278
978 8002392944
979 8019779658
980 8054164406
981 8054287682
982 8054505740
983 8055820255
984 8056177323

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00892

EamA

EamA-like transporter family

169

310

0.95

PF00892

EamA

EamA-like transporter family

32

161

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
7b0k-assembly1.cif.gz_A membrane protein structure 0.8102 6 278
7b0k-assembly1.cif.gz_A membrane protein structure 0.8015 6 278
5i20-assembly1.cif.gz_A crystal structure of protein 0.7841 1 283
5i20-assembly3.cif.gz_C crystal structure of protein 0.7796 1 277
7paf-assembly1.cif.gz_D streptococcus pneumoniae choline importer licb in lipid nanodiscs 0.7743 6 277
ID Description Score Start End Superfamily
af_Q47377_2_110_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.9084 204 277 1.10.3730.20
af_I1MX93_4_118_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.7194 194 277 1.10.3730.20
af_Q8RY83_36_351_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.7057 5 284 1.20.1740.10
af_Q20583_6_327_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.7008 8 284 1.20.1740.10
af_A0A0P0WMA8_96_409_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.6987 2 280 1.20.1740.10
ID Description Score Start End GO Terms
AF-A0A1W9HY99-F1-model_v4 EamA domain-containing protein 0.9655 1 278 GO:0005886
AF-A0A537JBF6-F1-model_v4 EamA family transporter 0.9524 1 278 GO:0005886
AF-A0A1W9HY99-F1-model_v4 EamA domain-containing protein 0.9357 1 278 GO:0005886
AF-A6FHB8-F1-model_v4 Membrane protein 0.9356 23 289 GO:0005886
AF-A0A812RY92-F1-model_v4 deleted 0.9301 1 277

Map