F454285

General Info

Members Datasets Scaffolds Average Seq Length
492 184 492 127

Family's Representative Sequence

Representative Sequence 3300031548|Ga0307408_100320713|Ga0307408_1003207132
Length 132
Sequence MPRYAGGMNSLPPYARLLRLRTEQQGDALRFVMPFHEDVVGRPGFLHGGAIAGLLEFAAFTALSRAIGDDTVKKPITVTVDYMRGGTPRDTFAEAQIERLGKRMANVEAYAWQSDRDRPIAAARINFLLDRQ

Samples

Sample ID Description Type Environment
1 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
2 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
54 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
55 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
56 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
64 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
65 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
70 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
71 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
72 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
116 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
120 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
121 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
122 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
123 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
124 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
125 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
126 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
127 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
128 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
129 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
130 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
131 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
132 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
133 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
134 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
135 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
136 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
137 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
138 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
139 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
140 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
141 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
142 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
143 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
144 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
145 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
146 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
147 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
148 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
149 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
150 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
151 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
152 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
153 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
154 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
155 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
156 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
157 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
158 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
159 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
160 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
161 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
162 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
163 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
164 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
165 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
166 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
167 3300049659 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control Metagenome Rhizosphere
168 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
169 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
170 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
171 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
172 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
173 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
174 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
175 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
176 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
177 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
178 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
179 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
180 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
181 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
182 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
183 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
184 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.2
Nodule 0
Rhizoplane 2.24
Rhizosphere 97.15
Stem 0
Stem Tuber 0
Unclassified 0.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1003330 3300001977 Bacteria 2526
2 JGI24034J26672_10014286 3300002239 Bacteria 1210
3 rootH1_10190015 3300003323 Bacteria 1116
4 Ga0065704_10259470 3300005289 Bacteria 957
5 Ga0065712_10268531 3300005290 Bacteria 921
6 Ga0065715_10089189 3300005293 Bacteria 12880
7 Ga0065715_10095029 3300005293 Bacteria 4152
8 Ga0065707_10129470 3300005295 Bacteria 1947
9 Ga0065707_10387289 3300005295 Bacteria 858
10 Ga0070658_10003042 3300005327 Bacteria 13873
11 Ga0070658_11176406 3300005327 Unclassified 667
12 Ga0070676_10007382 3300005328 Bacteria 5898
13 Ga0070676_10300065 3300005328 Bacteria 1089
14 Ga0070690_100695117 3300005330 Bacteria 780
15 Ga0070690_101173308 3300005330 Bacteria 611
16 Ga0070670_100008951 3300005331 Bacteria 8552
17 Ga0070670_100019012 3300005331 Bacteria 5892
18 Ga0070670_100036183 3300005331 Bacteria 4249
19 Ga0070670_100676344 3300005331 Bacteria 927
20 Ga0070670_100695032 3300005331 Bacteria 914
21 Ga0070670_100994043 3300005331 Bacteria 763
22 Ga0070677_10000930 3300005333 Bacteria 9562
23 Ga0070677_10001640 3300005333 Bacteria 7082
24 Ga0070666_10295447 3300005335 Bacteria 1153
25 Ga0070680_100798654 3300005336 Bacteria 813
26 Ga0070680_100816338 3300005336 Bacteria 804
27 Ga0070660_100000852 3300005339 Bacteria 20293
28 Ga0070660_100007755 3300005339 Bacteria 7486
29 Ga0070660_100029533 3300005339 Bacteria 4109
30 Ga0070660_100498689 3300005339 Bacteria 1013
31 Ga0070660_100654913 3300005339 Bacteria 880
32 Ga0070661_100598719 3300005344 Bacteria 891
33 Ga0070692_10005532 3300005345 Bacteria 5399
34 Ga0070692_10128994 3300005345 Bacteria 1419
35 Ga0070668_100001451 3300005347 Bacteria 17116
36 Ga0070668_100049401 3300005347 Bacteria 3237
37 Ga0070668_100199154 3300005347 Bacteria 1643
38 Ga0070668_100710824 3300005347 Bacteria 887
39 Ga0070668_100775530 3300005347 Bacteria 850
40 Ga0070669_100001035 3300005353 Bacteria 20294
41 Ga0070669_100073032 3300005353 Bacteria 2541
42 Ga0070669_100091828 3300005353 Bacteria 2278
43 Ga0070669_101711170 3300005353 Unclassified 548
44 Ga0070675_100002714 3300005354 Bacteria 13302
45 Ga0070675_100002842 3300005354 Bacteria 13052
46 Ga0070675_100032854 3300005354 Bacteria 4201
47 Ga0070675_100252756 3300005354 Bacteria 1543
48 Ga0070675_101147516 3300005354 Bacteria 715
49 Ga0070671_100004167 3300005355 Bacteria 11428
50 Ga0070671_100322010 3300005355 Bacteria 1317
51 Ga0070674_100000894 3300005356 Bacteria 15570
52 Ga0070673_100018430 3300005364 Bacteria 4985
53 Ga0070673_100377882 3300005364 Bacteria 1263
54 Ga0070673_100382014 3300005364 Bacteria 1256
55 Ga0070673_100756302 3300005364 Bacteria 895
56 Ga0070659_100113013 3300005366 Bacteria 2193
57 Ga0070659_100382858 3300005366 Bacteria 1185
58 Ga0070659_100778898 3300005366 Bacteria 831
59 Ga0070659_101281817 3300005366 Bacteria 649
60 Ga0070667_101875903 3300005367 Unclassified 564
61 Ga0070701_10184357 3300005438 Bacteria 1224
62 Ga0070663_100145390 3300005455 Bacteria 1814
63 Ga0070663_100228087 3300005455 Bacteria 1465
64 Ga0070663_100677269 3300005455 Unclassified 875
65 Ga0070678_100003324 3300005456 Bacteria 8949
66 Ga0070678_100061156 3300005456 Bacteria 2775
67 Ga0070662_100001948 3300005457 Bacteria 12690
68 Ga0070662_100012431 3300005457 Bacteria 5647
69 Ga0070662_100070567 3300005457 Bacteria 2574
70 Ga0070662_100138801 3300005457 Bacteria 1882
71 Ga0070662_100640925 3300005457 Bacteria 896
72 Ga0070681_10210811 3300005458 Bacteria 1859
73 Ga0070681_10274097 3300005458 Bacteria 1598
74 Ga0068867_100014795 3300005459 Bacteria 5532
75 Ga0068867_100690317 3300005459 Bacteria 900
76 Ga0070685_10878011 3300005466 Bacteria 666
77 Ga0070679_100820964 3300005530 Bacteria 873
78 Ga0070679_100830059 3300005530 Bacteria 867
79 Ga0068853_100103919 3300005539 Bacteria 2515
80 Ga0068853_100278377 3300005539 Bacteria 1542
81 Ga0068853_100349318 3300005539 Bacteria 1375
82 Ga0070672_100001437 3300005543 Bacteria 14726
83 Ga0070672_100019600 3300005543 Bacteria 4913
84 Ga0070672_100381284 3300005543 Bacteria 1206
85 Ga0070665_100077673 3300005548 Bacteria 3326
86 Ga0070665_100230956 3300005548 Bacteria 1850
87 Ga0068855_100000860 3300005563 Bacteria 37683
88 Ga0068855_101704060 3300005563 Unclassified 643
89 Ga0070664_100003661 3300005564 Bacteria 12375
90 Ga0070664_100186199 3300005564 Bacteria 1848
91 Ga0070664_100725785 3300005564 Bacteria 927
92 Ga0068857_100165612 3300005577 Bacteria 2007
93 Ga0068857_100531300 3300005577 Bacteria 1106
94 Ga0068857_101460043 3300005577 Bacteria 666
95 Ga0068854_100192956 3300005578 Bacteria 1597
96 Ga0068852_100264063 3300005616 Bacteria 1654
97 Ga0068859_100004379 3300005617 Bacteria 14402
98 Ga0068859_101770212 3300005617 Unclassified 682
99 Ga0068864_100050923 3300005618 Bacteria 3566
100 Ga0068864_100378451 3300005618 Bacteria 1341
101 Ga0068864_100599005 3300005618 Bacteria 1069
102 Ga0068866_10225066 3300005718 Bacteria 1134
103 Ga0068866_11123058 3300005718 Bacteria 564
104 Ga0068861_100011177 3300005719 Bacteria 6234
105 Ga0068870_10070475 3300005840 Bacteria 1905
106 Ga0068863_100973392 3300005841 Bacteria 851
107 Ga0068858_100676147 3300005842 Bacteria 1004
108 Ga0068860_100061074 3300005843 Bacteria 3580
109 Ga0068860_100204830 3300005843 Bacteria 1913
110 Ga0068862_100003135 3300005844 Bacteria 14380
111 Ga0068862_100033237 3300005844 Bacteria 4359
112 Ga0068862_100450780 3300005844 Bacteria 1213
113 Ga0075432_10041128 3300006058 Bacteria 1614
114 Ga0097621_100250333 3300006237 Bacteria 1551
115 Ga0075428_100754184 3300006844 Bacteria 1035
116 Ga0075431_100004274 3300006847 Bacteria 13987
117 Ga0075433_10371092 3300006852 Bacteria 1264
118 Ga0075429_100727833 3300006880 Bacteria 869
119 Ga0068865_100155639 3300006881 Bacteria 1738
120 Ga0097620_100004379 3300006931 Bacteria 14402
121 Ga0097620_101769944 3300006931 Unclassified 682
122 Ga0111539_10065335 3300009094 Bacteria 4299
123 Ga0111539_10338944 3300009094 Bacteria 1750
124 Ga0111539_11047164 3300009094 Bacteria 948
125 Ga0105243_11079243 3300009148 Bacteria 810
126 Ga0105248_10149034 3300009177 Bacteria 2640
127 Ga0105249_10048668 3300009553 Bacteria 3864
128 Ga0105249_10250807 3300009553 Bacteria 1755
129 Ga0105249_12300424 3300009553 Bacteria 612
130 Ga0157373_10752941 3300013100 Bacteria 716
131 Ga0157373_10857992 3300013100 Bacteria 672
132 Ga0157371_10023407 3300013102 Bacteria 4517
133 Ga0157371_10033303 3300013102 Bacteria 3702
134 Ga0157371_10056382 3300013102 Bacteria 2787
135 Ga0157371_10193369 3300013102 Bacteria 1457
136 Ga0157370_10133214 3300013104 Bacteria 2318
137 Ga0157370_11079187 3300013104 Bacteria 726
138 Ga0163162_10490296 3300013306 Bacteria 1360
139 Ga0157375_10007958 3300013308 Bacteria 9280
140 Ga0163163_10214042 3300014325 Bacteria 1976
141 Ga0163163_10835855 3300014325 Bacteria 984
142 Ga0157380_10001698 3300014326 Bacteria 14541
143 Ga0157380_10003692 3300014326 Bacteria 10532
144 Ga0157380_10053350 3300014326 Bacteria 3205
145 Ga0157380_10094605 3300014326 Bacteria 2473
146 Ga0157380_11329517 3300014326 Bacteria 767
147 Ga0157377_10608256 3300014745 Bacteria 781
148 Ga0163161_10017518 3300017792 Bacteria 5013
149 Ga0163161_10741450 3300017792 Bacteria 821
150 Ga0207666_1010754 3300025271 Bacteria 1257
151 Ga0207697_10000985 3300025315 Bacteria 15936
152 Ga0207697_10009622 3300025315 Bacteria 4165
153 Ga0207697_10018252 3300025315 Bacteria 2878
154 Ga0207697_10070181 3300025315 Bacteria 1467
155 Ga0207682_10000857 3300025893 Bacteria 14109
156 Ga0207682_10001191 3300025893 Bacteria 12044
157 Ga0207642_10760075 3300025899 Bacteria 614
158 Ga0207688_10072077 3300025901 Bacteria 1962
159 Ga0207688_10303684 3300025901 Bacteria 976
160 Ga0207645_10011981 3300025907 Bacteria 5898
161 Ga0207645_10510120 3300025907 Bacteria 815
162 Ga0207645_10784814 3300025907 Unclassified 648
163 Ga0207643_10338754 3300025908 Bacteria 942
164 Ga0207705_10000648 3300025909 Bacteria 28951
165 Ga0207705_10001745 3300025909 Bacteria 17203
166 Ga0207705_10367653 3300025909 Bacteria 1110
167 Ga0207705_10994968 3300025909 Unclassified 648
168 Ga0207654_11141625 3300025911 Bacteria 568
169 Ga0207707_10061774 3300025912 Bacteria 3260
170 Ga0207707_10324691 3300025912 Bacteria 1328
171 Ga0207660_11065050 3300025917 Unclassified 659
172 Ga0207657_10001247 3300025919 Bacteria 27200
173 Ga0207657_10001696 3300025919 Bacteria 23760
174 Ga0207657_10141024 3300025919 Bacteria 1969
175 Ga0207657_10339132 3300025919 Bacteria 1186
176 Ga0207657_10383281 3300025919 Bacteria 1107
177 Ga0207657_11256933 3300025919 Bacteria 561
178 Ga0207649_10477927 3300025920 Bacteria 945
179 Ga0207652_10823465 3300025921 Bacteria 823
180 Ga0207652_10853852 3300025921 Bacteria 806
181 Ga0207681_10001808 3300025923 Bacteria 13726
182 Ga0207681_10023028 3300025923 Bacteria 3978
183 Ga0207681_10310576 3300025923 Bacteria 1250
184 Ga0207650_10014719 3300025925 Bacteria 5437
185 Ga0207650_10090408 3300025925 Bacteria 2338
186 Ga0207650_10108169 3300025925 Bacteria 2149
187 Ga0207650_10629615 3300025925 Bacteria 903
188 Ga0207659_10003143 3300025926 Bacteria 9870
189 Ga0207659_10122112 3300025926 Bacteria 1997
190 Ga0207659_10195627 3300025926 Bacteria 1611
191 Ga0207644_10114064 3300025931 Bacteria 2047
192 Ga0207644_10367372 3300025931 Bacteria 1171
193 Ga0207690_10074057 3300025932 Bacteria 2358
194 Ga0207690_10163158 3300025932 Bacteria 1663
195 Ga0207690_10353120 3300025932 Bacteria 1163
196 Ga0207690_11139370 3300025932 Bacteria 651
197 Ga0207690_11590979 3300025932 Unclassified 546
198 Ga0207706_10000284 3300025933 Bacteria 55240
199 Ga0207706_10044034 3300025933 Bacteria 3955
200 Ga0207706_10171181 3300025933 Bacteria 1908
201 Ga0207706_11482473 3300025933 Bacteria 554
202 Ga0207709_10097849 3300025935 Bacteria 1933
203 Ga0207669_10005555 3300025937 Bacteria 5670
204 Ga0207669_10785771 3300025937 Bacteria 788
205 Ga0207704_10689029 3300025938 Unclassified 845
206 Ga0207704_11057308 3300025938 Bacteria 688
207 Ga0207691_10001690 3300025940 Bacteria 21784
208 Ga0207691_10044262 3300025940 Bacteria 4098
209 Ga0207691_10117949 3300025940 Bacteria 2354
210 Ga0207711_10568828 3300025941 Bacteria 1057
211 Ga0207711_10701542 3300025941 Bacteria 944
212 Ga0207679_10006008 3300025945 Bacteria 7638
213 Ga0207679_10082011 3300025945 Bacteria 2468
214 Ga0207679_10736852 3300025945 Bacteria 896
215 Ga0207667_10010703 3300025949 Bacteria 10703
216 Ga0207667_10186565 3300025949 Bacteria 2129
217 Ga0207651_10040267 3300025960 Bacteria 3089
218 Ga0207651_10232660 3300025960 Bacteria 1497
219 Ga0207712_10412177 3300025961 Bacteria 1138
220 Ga0207668_10005040 3300025972 Bacteria 7773
221 Ga0207668_10568511 3300025972 Bacteria 984
222 Ga0207668_10955490 3300025972 Bacteria 764
223 Ga0207668_11924946 3300025972 Bacteria 533
224 Ga0207640_10028574 3300025981 Bacteria 3411
225 Ga0207658_11695478 3300025986 Unclassified 577
226 Ga0207677_10402594 3300026023 Bacteria 1161
227 Ga0207639_10167947 3300026041 Bacteria 1855
228 Ga0207639_10246266 3300026041 Bacteria 1557
229 Ga0207678_10171828 3300026067 Bacteria 1850
230 Ga0207678_10203681 3300026067 Bacteria 1692
231 Ga0207648_10003838 3300026089 Bacteria 15698
232 Ga0207648_11810337 3300026089 Bacteria 572
233 Ga0207676_10046933 3300026095 Bacteria 3345
234 Ga0207676_10285909 3300026095 Bacteria 1499
235 Ga0207676_11629594 3300026095 Bacteria 643
236 Ga0207674_10049004 3300026116 Bacteria 4322
237 Ga0207674_10396843 3300026116 Bacteria 1333
238 Ga0207674_10706814 3300026116 Bacteria 973
239 Ga0207675_100013354 3300026118 Bacteria 7663
240 Ga0207675_100582457 3300026118 Bacteria 1120
241 Ga0207683_10011685 3300026121 Bacteria 7496
242 Ga0207683_10236171 3300026121 Bacteria 1667
243 Ga0209970_1013994 3300027614 Bacteria 1331
244 Ga0209983_1016172 3300027665 Bacteria 1539
245 Ga0209974_10043567 3300027876 Bacteria 1496
246 Ga0209974_10060068 3300027876 Bacteria 1286
247 Ga0207428_10497067 3300027907 Bacteria 886
248 Ga0268266_10735920 3300028379 Bacteria 951
249 Ga0268265_10001996 3300028380 Bacteria 16124
250 Ga0268265_10042666 3300028380 Bacteria 3367
251 Ga0268265_10360134 3300028380 Bacteria 1331
252 Ga0268264_11715943 3300028381 Bacteria 638
253 Ga0316183_1070220 3300030742 Bacteria 2098
254 Ga0316182_1079047 3300030745 Bacteria 1934
255 Ga0316182_1181019 3300030745 Bacteria 730
256 Ga0307408_100036802 3300031548 Bacteria 3442
257 Ga0307408_100103990 3300031548 Bacteria 2169
258 Ga0307408_100118755 3300031548 Bacteria 2045
259 Ga0307408_100254476 3300031548 Bacteria 1450
260 Ga0307408_100320713 3300031548 Bacteria 1305
261 Ga0307408_100557747 3300031548 Bacteria 1012
262 Ga0307408_101902956 3300031548 Bacteria 570
263 Ga0307405_10023301 3300031731 Bacteria 3516
264 Ga0307405_10030813 3300031731 Bacteria 3149
265 Ga0307405_10053494 3300031731 Bacteria 2515
266 Ga0307405_10068564 3300031731 Bacteria 2270
267 Ga0307405_10136968 3300031731 Bacteria 1701
268 Ga0307405_10313336 3300031731 Bacteria 1195
269 Ga0307405_10350556 3300031731 Bacteria 1138
270 Ga0307405_10436116 3300031731 Bacteria 1035
271 Ga0307405_10546528 3300031731 Bacteria 936
272 Ga0307405_10644168 3300031731 Bacteria 870
273 Ga0307405_10668527 3300031731 Bacteria 856
274 Ga0307413_10000587 3300031824 Bacteria 12214
275 Ga0307413_10002432 3300031824 Bacteria 7570
276 Ga0307413_10024656 3300031824 Bacteria 3283
277 Ga0307413_10042054 3300031824 Bacteria 2682
278 Ga0307413_10052294 3300031824 Bacteria 2466
279 Ga0307413_10075101 3300031824 Bacteria 2144
280 Ga0307413_10086273 3300031824 Bacteria 2029
281 Ga0307413_10394272 3300031824 Bacteria 1083
282 Ga0307413_10442442 3300031824 Bacteria 1029
283 Ga0307413_10556944 3300031824 Bacteria 931
284 Ga0307413_10676935 3300031824 Bacteria 854
285 Ga0307413_10949418 3300031824 Bacteria 734
286 Ga0307413_11408854 3300031824 Bacteria 613
287 Ga0307410_10019081 3300031852 Bacteria 4163
288 Ga0307410_10022852 3300031852 Bacteria 3874
289 Ga0307410_10043782 3300031852 Bacteria 2969
290 Ga0307410_10085025 3300031852 Bacteria 2231
291 Ga0307410_10120734 3300031852 Bacteria 1911
292 Ga0307410_10140632 3300031852 Bacteria 1785
293 Ga0307410_10178610 3300031852 Bacteria 1605
294 Ga0307410_10384354 3300031852 Bacteria 1130
295 Ga0307410_10536726 3300031852 Bacteria 967
296 Ga0307410_10692382 3300031852 Bacteria 858
297 Ga0307410_10806997 3300031852 Bacteria 798
298 Ga0307410_11011935 3300031852 Bacteria 717
299 Ga0307410_11171609 3300031852 Bacteria 669
300 Ga0307406_10015311 3300031901 Bacteria 4435
301 Ga0307406_10068485 3300031901 Bacteria 2317
302 Ga0307406_10085033 3300031901 Bacteria 2114
303 Ga0307406_10116407 3300031901 Bacteria 1849
304 Ga0307406_10117511 3300031901 Bacteria 1842
305 Ga0307406_10134339 3300031901 Bacteria 1741
306 Ga0307406_10234523 3300031901 Bacteria 1372
307 Ga0307406_10668589 3300031901 Bacteria 864
308 Ga0307406_11369300 3300031901 Bacteria 619
309 Ga0307407_10003648 3300031903 Bacteria 6366
310 Ga0307407_10019882 3300031903 Bacteria 3428
311 Ga0307407_10021951 3300031903 Bacteria 3303
312 Ga0307407_10068028 3300031903 Bacteria 2108
313 Ga0307407_10112960 3300031903 Bacteria 1709
314 Ga0307407_10203044 3300031903 Bacteria 1329
315 Ga0307407_10312114 3300031903 Bacteria 1100
316 Ga0307407_11026299 3300031903 Unclassified 638
317 Ga0307412_10026727 3300031911 Bacteria 3591
318 Ga0307412_10031859 3300031911 Bacteria 3334
319 Ga0307412_10039584 3300031911 Bacteria 3044
320 Ga0307412_10083188 3300031911 Bacteria 2218
321 Ga0307412_10109135 3300031911 Bacteria 1972
322 Ga0307412_10131642 3300031911 Bacteria 1818
323 Ga0307412_10167095 3300031911 Bacteria 1641
324 Ga0307412_10205621 3300031911 Bacteria 1498
325 Ga0307412_10229141 3300031911 Bacteria 1429
326 Ga0307412_10257176 3300031911 Bacteria 1359
327 Ga0307412_10873756 3300031911 Bacteria 786
328 Ga0307412_11600146 3300031911 Unclassified 595
329 Ga0307412_11849732 3300031911 Bacteria 556
330 Ga0307409_100070109 3300031995 Bacteria 2781
331 Ga0307409_100080661 3300031995 Bacteria 2626
332 Ga0307409_100089251 3300031995 Bacteria 2519
333 Ga0307409_100140198 3300031995 Bacteria 2082
334 Ga0307409_100151227 3300031995 Bacteria 2015
335 Ga0307409_100196561 3300031995 Bacteria 1800
336 Ga0307409_100370746 3300031995 Bacteria 1357
337 Ga0307409_100447268 3300031995 Bacteria 1246
338 Ga0307409_100520048 3300031995 Bacteria 1162
339 Ga0307409_100566236 3300031995 Bacteria 1118
340 Ga0307409_100593787 3300031995 Bacteria 1093
341 Ga0307409_100613929 3300031995 Bacteria 1076
342 Ga0307409_100685762 3300031995 Bacteria 1022
343 Ga0307409_100709123 3300031995 Bacteria 1006
344 Ga0307409_100859864 3300031995 Bacteria 918
345 Ga0307409_100861345 3300031995 Bacteria 917
346 Ga0307409_100868867 3300031995 Bacteria 914
347 Ga0307409_101479287 3300031995 Bacteria 706
348 Ga0307409_101505317 3300031995 Bacteria 700
349 Ga0307409_101938937 3300031995 Bacteria 618
350 Ga0307409_102298732 3300031995 Bacteria 568
351 Ga0307416_100139347 3300032002 Bacteria 2201
352 Ga0307416_100192440 3300032002 Bacteria 1925
353 Ga0307416_100217959 3300032002 Bacteria 1827
354 Ga0307416_100346442 3300032002 Bacteria 1501
355 Ga0307416_100547748 3300032002 Bacteria 1230
356 Ga0307416_100730717 3300032002 Bacteria 1081
357 Ga0307416_101130659 3300032002 Bacteria 888
358 Ga0307416_101313669 3300032002 Bacteria 829
359 Ga0307416_102199067 3300032002 Unclassified 653
360 Ga0307416_103415002 3300032002 Unclassified 531
361 Ga0307414_10002885 3300032004 Bacteria 9080
362 Ga0307414_10020771 3300032004 Bacteria 4101
363 Ga0307414_10047412 3300032004 Bacteria 2956
364 Ga0307414_10050848 3300032004 Bacteria 2873
365 Ga0307414_10058173 3300032004 Bacteria 2722
366 Ga0307414_10122314 3300032004 Bacteria 2003
367 Ga0307414_10161712 3300032004 Bacteria 1779
368 Ga0307414_10162526 3300032004 Bacteria 1775
369 Ga0307414_10193288 3300032004 Bacteria 1648
370 Ga0307414_10201150 3300032004 Bacteria 1620
371 Ga0307414_10402582 3300032004 Bacteria 1189
372 Ga0307414_10559352 3300032004 Bacteria 1020
373 Ga0307414_10603572 3300032004 Bacteria 984
374 Ga0307414_10724126 3300032004 Bacteria 902
375 Ga0307414_11706781 3300032004 Bacteria 587
376 Ga0307411_10002724 3300032005 Bacteria 7927
377 Ga0307411_10007367 3300032005 Bacteria 5597
378 Ga0307411_10009224 3300032005 Bacteria 5172
379 Ga0307411_10010450 3300032005 Bacteria 4949
380 Ga0307411_10032872 3300032005 Bacteria 3211
381 Ga0307411_10046135 3300032005 Bacteria 2807
382 Ga0307411_10067959 3300032005 Bacteria 2400
383 Ga0307411_10097054 3300032005 Bacteria 2073
384 Ga0307411_10103265 3300032005 Bacteria 2022
385 Ga0307411_10152836 3300032005 Bacteria 1717
386 Ga0307411_10156790 3300032005 Bacteria 1699
387 Ga0307411_10240260 3300032005 Bacteria 1417
388 Ga0307411_10249114 3300032005 Bacteria 1395
389 Ga0307411_10259978 3300032005 Bacteria 1370
390 Ga0307411_10275881 3300032005 Bacteria 1335
391 Ga0307411_10281956 3300032005 Bacteria 1323
392 Ga0307411_10398431 3300032005 Bacteria 1137
393 Ga0307411_10498504 3300032005 Bacteria 1029
394 Ga0307411_10614318 3300032005 Bacteria 936
395 Ga0307411_10715878 3300032005 Bacteria 873
396 Ga0307411_10909522 3300032005 Bacteria 782
397 Ga0307415_100015344 3300032126 Bacteria 4533
398 Ga0307415_100016359 3300032126 Bacteria 4419
399 Ga0307415_100051417 3300032126 Bacteria 2796
400 Ga0307415_100076428 3300032126 Bacteria 2374
401 Ga0307415_100083418 3300032126 Bacteria 2289
402 Ga0307415_100093218 3300032126 Bacteria 2186
403 Ga0307415_100211551 3300032126 Bacteria 1547
404 Ga0307415_100232389 3300032126 Bacteria 1486
405 Ga0307415_100285199 3300032126 Bacteria 1360
406 Ga0307415_100319514 3300032126 Bacteria 1294
407 Ga0307415_100365786 3300032126 Bacteria 1219
408 Ga0307415_100546551 3300032126 Bacteria 1021
409 Ga0307415_101142170 3300032126 Bacteria 731
410 Ga0307415_101532629 3300032126 Unclassified 638
411 Ga0307415_101749691 3300032126 Bacteria 600
412 Ga0395899_0004515 3300037312 Bacteria 10849
413 Ga0395899_0116962 3300037312 Bacteria 1912
414 Ga0395899_0255725 3300037312 Bacteria 1200
415 Ga0395900_0000777 3300037418 Bacteria 42484
416 Ga0395900_0001654 3300037418 Bacteria 26100
417 Ga0395898_0015202 3300037466 Bacteria 7902
418 Ga0395898_0209161 3300037466 Bacteria 1861
419 Ga0395905_0001805 3300037471 Bacteria 24778
420 Ga0395905_0049460 3300037471 Bacteria 3940
421 Ga0395905_0113958 3300037471 Bacteria 2540
422 Ga0395905_0432323 3300037471 Bacteria 1213
423 Ga0395905_0790047 3300037471 Bacteria 852
424 Ga0395905_1625400 3300037471 Bacteria 551
425 Ga0395901_0002157 3300038443 Bacteria 20101
426 Ga0395901_0006976 3300038443 Bacteria 11414
427 Ga0395901_0032181 3300038443 Bacteria 5412
428 Ga0439453_0024191 3300041408 Bacteria 1113
429 Ga0439461_0109499 3300041410 Bacteria 680
430 Ga0439466_0066009 3300041411 Bacteria 1159
431 Ga0451807_0695055 3300041486 Bacteria 592
432 Ga0451853_2745094 3300041512 Bacteria 602
433 Ga0439431_0185532 3300041997 Bacteria 602
434 Ga0439445_0002103 3300042004 Bacteria 4405
435 Ga0439449_0203724 3300042007 Bacteria 741
436 Ga0495585_0411978 3300046492 Bacteria 650
437 Ga0495663_0004446 3300046525 Bacteria 3942
438 Ga0495663_0004557 3300046525 Bacteria 3887
439 Ga0495642_0085352 3300046528 Bacteria 1333
440 Ga0495621_0000209 3300046539 Bacteria 13667
441 Ga0495621_0029897 3300046539 Bacteria 1859
442 Ga0495621_0030922 3300046539 Bacteria 1833
443 Ga0495633_0058498 3300046558 Bacteria 1809
444 Ga0495633_0058806 3300046558 Bacteria 1804
445 Ga0495633_0177786 3300046558 Bacteria 980
446 Ga0495633_0516480 3300046558 Bacteria 538
447 Ga0495659_0026155 3300046664 Bacteria 2003
448 Ga0495659_0054902 3300046664 Bacteria 1458
449 Ga0495659_0055353 3300046664 Bacteria 1453
450 Ga0495659_0160992 3300046664 Bacteria 906
451 Ga0495659_0379764 3300046664 Unclassified 607
452 Ga0495669_0065702 3300046684 Bacteria 1647
453 Ga0495670_0013506 3300046691 Bacteria 4018
454 Ga0495670_0029074 3300046691 Bacteria 2742
455 Ga0495670_0031402 3300046691 Bacteria 2639
456 Ga0495670_0040437 3300046691 Bacteria 2325
457 Ga0495670_0177765 3300046691 Bacteria 1123
458 Ga0495677_0032746 3300047445 Bacteria 1893
459 Ga0495677_0043423 3300047445 Bacteria 1648
460 Ga0496102_0572745 3300048905 Bacteria 1052
461 Ga0496107_0539245 3300048910 Bacteria 864
462 Ga0496108_0588607 3300048911 Bacteria 970
463 Ga0496109_0223647 3300048912 Bacteria 1770
464 Ga0496109_0876599 3300048912 Bacteria 835
465 Ga0496110_0076524 3300048913 Bacteria 2976
466 Ga0496110_0103542 3300048913 Bacteria 2553
467 Ga0496111_0008972 3300048914 Bacteria 6652
468 Ga0496113_0597498 3300048916 Bacteria 884
469 Ga0496114_0006322 3300048917 Bacteria 9322
470 Ga0501199_043016 3300049650 Unclassified 591
471 Ga0501201_033122 3300049651 Unclassified 596
472 Ga0501202_108198 3300049652 Bacteria 685
473 Ga0501209_054526 3300049656 Bacteria 1100
474 Ga0501214_070020 3300049659 Unclassified 571
475 Ga0501223_062192 3300049663 Unclassified 730
476 Ga0501224_047780 3300049664 Bacteria 652
477 Ga0501230_060857 3300049667 Unclassified 764
478 Ga0501235_002169 3300049669 Bacteria 4214
479 Ga0501247_057288 3300049677 Unclassified 591
480 Ga0501249_001173 3300049679 Bacteria 5516
481 Ga0501257_039862 3300049686 Bacteria 1151
482 Ga0501258_012168 3300049687 Bacteria 930
483 Ga0501234_028998 3300049707 Bacteria 891
484 Ga0501263_042673 3300049760 Unclassified 670
485 Ga0501272_006790 3300049769 Bacteria 1229
486 Ga0501204_003946 3300049850 Bacteria 1581
487 Ga0501212_043703 3300049851 Bacteria 746
488 nmdc:mga00v17_866346_c1 3300050491 Unclassified 573
489 nmdc:mga06r32_11078_c1 3300050510 Bacteria 8118
490 nmdc:mga08y16_152169_c1 3300050511 Bacteria 2404
491 nmdc:mga08y16_406932_c1 3300050511 Bacteria 1392
492 nmdc:mga0a205_546334_c1 3300050515 Bacteria 1014

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300032004 Ga0307414_10193288 Ga0307414_101932882 108
2 3300042004 Ga0439445_0002103 Ga0439445_0002103_23_376 116
3 3300005339 Ga0070660_100654913 Ga0070660_1006549132 122
4 3300005366 Ga0070659_100113013 Ga0070659_1001130131 122
5 3300005458 Ga0070681_10274097 Ga0070681_102740972 122
6 3300005530 Ga0070679_100830059 Ga0070679_1008300592 122
7 3300005539 Ga0068853_100278377 Ga0068853_1002783773 122
8 3300006844 Ga0075428_100754184 Ga0075428_1007541842 122
9 3300013100 Ga0157373_10857992 Ga0157373_108579922 122
10 3300025912 Ga0207707_10061774 Ga0207707_100617746 122
11 3300025919 Ga0207657_10141024 Ga0207657_101410243 122
12 3300025921 Ga0207652_10823465 Ga0207652_108234651 122
13 3300025932 Ga0207690_11590979 Ga0207690_115909791 122
14 3300005293 Ga0065715_10095029 Ga0065715_100950297 123
15 3300005328 Ga0070676_10300065 Ga0070676_103000653 123
16 3300005331 Ga0070670_100008951 Ga0070670_1000089517 123
17 3300005333 Ga0070677_10001640 Ga0070677_100016404 123
18 3300005347 Ga0070668_100049401 Ga0070668_1000494015 123
19 3300005354 Ga0070675_100002714 Ga0070675_1000027148 123
20 3300005364 Ga0070673_100382014 Ga0070673_1003820143 123
21 3300005366 Ga0070659_100778898 Ga0070659_1007788982 123
22 3300005456 Ga0070678_100061156 Ga0070678_1000611563 123
23 3300005457 Ga0070662_100070567 Ga0070662_1000705674 123
24 3300005543 Ga0070672_100019600 Ga0070672_1000196007 123
25 3300005548 Ga0070665_100230956 Ga0070665_1002309562 123
26 3300005564 Ga0070664_100725785 Ga0070664_1007257853 123
27 3300014326 Ga0157380_10053350 Ga0157380_100533503 123
28 3300025315 Ga0207697_10018252 Ga0207697_100182523 123
29 3300025893 Ga0207682_10001191 Ga0207682_100011918 123
30 3300025901 Ga0207688_10072077 Ga0207688_100720772 123
31 3300025908 Ga0207643_10338754 Ga0207643_103387542 123
32 3300025925 Ga0207650_10629615 Ga0207650_106296153 123
33 3300025926 Ga0207659_10122112 Ga0207659_101221124 123
34 3300025933 Ga0207706_11482473 Ga0207706_114824731 123
35 3300025937 Ga0207669_10785771 Ga0207669_107857711 123
36 3300025940 Ga0207691_10044262 Ga0207691_100442627 123
37 3300025945 Ga0207679_10736852 Ga0207679_107368523 123
38 3300025972 Ga0207668_10955490 Ga0207668_109554902 123
39 3300026121 Ga0207683_10236171 Ga0207683_102361712 123
40 3300031824 Ga0307413_10000587 Ga0307413_1000058710 123
41 3300031852 Ga0307410_10022852 Ga0307410_100228523 123
42 3300031903 Ga0307407_10019882 Ga0307407_100198823 123
43 3300031995 Ga0307409_100151227 Ga0307409_1001512273 123
44 3300032005 Ga0307411_10002724 Ga0307411_100027246 123
45 3300005339 Ga0070660_100029533 Ga0070660_1000295337 124
46 3300005347 Ga0070668_100775530 Ga0070668_1007755302 124
47 3300005353 Ga0070669_100073032 Ga0070669_1000730322 124
48 3300005455 Ga0070663_100677269 Ga0070663_1006772692 124
49 3300005548 Ga0070665_100077673 Ga0070665_1000776735 124
50 3300006058 Ga0075432_10041128 Ga0075432_100411282 124
51 3300009094 Ga0111539_11047164 Ga0111539_110471642 124
52 3300009553 Ga0105249_10250807 Ga0105249_102508072 124
53 3300009553 Ga0105249_12300424 Ga0105249_123004241 124
54 3300013104 Ga0157370_11079187 Ga0157370_110791871 124
55 3300014326 Ga0157380_11329517 Ga0157380_113295172 124
56 3300025923 Ga0207681_10310576 Ga0207681_103105762 124
57 3300028379 Ga0268266_10735920 Ga0268266_107359201 124
58 3300030745 Ga0316182_1079047 Ga0316182_10790472 124
59 3300031548 Ga0307408_100036802 Ga0307408_1000368023 124
60 3300031731 Ga0307405_10053494 Ga0307405_100534947 124
61 3300031731 Ga0307405_10668527 Ga0307405_106685272 124
62 3300031824 Ga0307413_10676935 Ga0307413_106769352 124
63 3300031852 Ga0307410_10692382 Ga0307410_106923822 124
64 3300031852 Ga0307410_11011935 Ga0307410_110119351 124
65 3300031901 Ga0307406_10234523 Ga0307406_102345234 124
66 3300031911 Ga0307412_10229141 Ga0307412_102291414 124
67 3300031995 Ga0307409_100709123 Ga0307409_1007091233 124
68 3300032002 Ga0307416_100192440 Ga0307416_1001924403 124
69 3300032004 Ga0307414_10559352 Ga0307414_105593522 124
70 3300032005 Ga0307411_10240260 Ga0307411_102402602 124
71 3300032005 Ga0307411_10498504 Ga0307411_104985042 124
72 3300032126 Ga0307415_100093218 Ga0307415_1000932183 124
73 3300041486 Ga0451807_0695055 Ga0451807_0695055_103_486 124
74 3300046525 Ga0495663_0004446 Ga0495663_0004446_2478_2855 124
75 3300046539 Ga0495621_0029897 Ga0495621_0029897_1351_1728 124
76 3300046558 Ga0495633_0058498 Ga0495633_0058498_1362_1739 124
77 3300046664 Ga0495659_0055353 Ga0495659_0055353_264_641 124
78 3300046691 Ga0495670_0040437 Ga0495670_0040437_1072_1449 124
79 3300047445 Ga0495677_0043423 Ga0495677_0043423_543_920 124
80 3300050511 nmdc:mga08y16_152169_c1 nmdc:mga08y16_152169_c1_1687_2064 124
81 3300001977 JGI24746J21847_1003330 JGI24746J21847_10033306 125
82 3300002239 JGI24034J26672_10014286 JGI24034J26672_100142863 125
83 3300003323 rootH1_10190015 rootH1_101900152 125
84 3300005289 Ga0065704_10259470 Ga0065704_102594701 125
85 3300005290 Ga0065712_10268531 Ga0065712_102685312 125
86 3300005293 Ga0065715_10089189 Ga0065715_100891899 125
87 3300005295 Ga0065707_10129470 Ga0065707_101294702 125
88 3300005295 Ga0065707_10387289 Ga0065707_103872891 125
89 3300005327 Ga0070658_10003042 Ga0070658_100030427 125
90 3300005327 Ga0070658_11176406 Ga0070658_111764062 125
91 3300005328 Ga0070676_10007382 Ga0070676_100073826 125
92 3300005330 Ga0070690_100695117 Ga0070690_1006951172 125
93 3300005330 Ga0070690_101173308 Ga0070690_1011733081 125
94 3300005331 Ga0070670_100019012 Ga0070670_1000190124 125
95 3300005331 Ga0070670_100036183 Ga0070670_1000361832 125
96 3300005331 Ga0070670_100676344 Ga0070670_1006763443 125
97 3300005331 Ga0070670_100695032 Ga0070670_1006950323 125
98 3300005331 Ga0070670_100994043 Ga0070670_1009940431 125
99 3300005333 Ga0070677_10000930 Ga0070677_100009306 125
100 3300005335 Ga0070666_10295447 Ga0070666_102954471 125
101 3300005336 Ga0070680_100798654 Ga0070680_1007986541 125
102 3300005336 Ga0070680_100816338 Ga0070680_1008163381 125
103 3300005339 Ga0070660_100000852 Ga0070660_1000008524 125
104 3300005339 Ga0070660_100007755 Ga0070660_1000077557 125
105 3300005339 Ga0070660_100498689 Ga0070660_1004986892 125
106 3300005344 Ga0070661_100598719 Ga0070661_1005987191 125
107 3300005345 Ga0070692_10005532 Ga0070692_100055323 125
108 3300005345 Ga0070692_10128994 Ga0070692_101289944 125
109 3300005347 Ga0070668_100001451 Ga0070668_10000145113 125
110 3300005347 Ga0070668_100199154 Ga0070668_1001991541 125
111 3300005347 Ga0070668_100710824 Ga0070668_1007108242 125
112 3300005353 Ga0070669_100001035 Ga0070669_10000103510 125
113 3300005353 Ga0070669_100091828 Ga0070669_1000918285 125
114 3300005353 Ga0070669_101711170 Ga0070669_1017111702 125
115 3300005354 Ga0070675_100002842 Ga0070675_1000028428 125
116 3300005354 Ga0070675_100032854 Ga0070675_1000328542 125
117 3300005354 Ga0070675_100252756 Ga0070675_1002527562 125
118 3300005354 Ga0070675_101147516 Ga0070675_1011475162 125
119 3300005355 Ga0070671_100004167 Ga0070671_10000416713 125
120 3300005355 Ga0070671_100322010 Ga0070671_1003220102 125
121 3300005356 Ga0070674_100000894 Ga0070674_10000089413 125
122 3300005364 Ga0070673_100018430 Ga0070673_1000184307 125
123 3300005364 Ga0070673_100377882 Ga0070673_1003778824 125
124 3300005364 Ga0070673_100756302 Ga0070673_1007563023 125
125 3300005366 Ga0070659_100382858 Ga0070659_1003828582 125
126 3300005366 Ga0070659_101281817 Ga0070659_1012818171 125
127 3300005367 Ga0070667_101875903 Ga0070667_1018759031 125
128 3300005438 Ga0070701_10184357 Ga0070701_101843572 125
129 3300005455 Ga0070663_100145390 Ga0070663_1001453904 125
130 3300005455 Ga0070663_100228087 Ga0070663_1002280871 125
131 3300005456 Ga0070678_100003324 Ga0070678_1000033248 125
132 3300005457 Ga0070662_100001948 Ga0070662_1000019489 125
133 3300005457 Ga0070662_100012431 Ga0070662_1000124317 125
134 3300005457 Ga0070662_100138801 Ga0070662_1001388014 125
135 3300005457 Ga0070662_100640925 Ga0070662_1006409252 125
136 3300005458 Ga0070681_10210811 Ga0070681_102108112 125
137 3300005459 Ga0068867_100014795 Ga0068867_1000147955 125
138 3300005459 Ga0068867_100690317 Ga0068867_1006903172 125
139 3300005466 Ga0070685_10878011 Ga0070685_108780111 125
140 3300005530 Ga0070679_100820964 Ga0070679_1008209641 125
141 3300005539 Ga0068853_100103919 Ga0068853_1001039197 125
142 3300005539 Ga0068853_100349318 Ga0068853_1003493182 125
143 3300005543 Ga0070672_100001437 Ga0070672_10000143710 125
144 3300005543 Ga0070672_100381284 Ga0070672_1003812842 125
145 3300005563 Ga0068855_100000860 Ga0068855_10000086027 125
146 3300005563 Ga0068855_101704060 Ga0068855_1017040602 125
147 3300005564 Ga0070664_100003661 Ga0070664_10000366110 125
148 3300005564 Ga0070664_100186199 Ga0070664_1001861994 125
149 3300005577 Ga0068857_100165612 Ga0068857_1001656122 125
150 3300005577 Ga0068857_100531300 Ga0068857_1005313002 125
151 3300005577 Ga0068857_101460043 Ga0068857_1014600432 125
152 3300005578 Ga0068854_100192956 Ga0068854_1001929564 125
153 3300005616 Ga0068852_100264063 Ga0068852_1002640634 125
154 3300005617 Ga0068859_100004379 Ga0068859_1000043793 125
155 3300005617 Ga0068859_101770212 Ga0068859_1017702121 125
156 3300005618 Ga0068864_100050923 Ga0068864_1000509235 125
157 3300005618 Ga0068864_100378451 Ga0068864_1003784512 125
158 3300005618 Ga0068864_100599005 Ga0068864_1005990053 125
159 3300005718 Ga0068866_10225066 Ga0068866_102250663 125
160 3300005718 Ga0068866_11123058 Ga0068866_111230582 125
161 3300005719 Ga0068861_100011177 Ga0068861_1000111774 125
162 3300005840 Ga0068870_10070475 Ga0068870_100704754 125
163 3300005841 Ga0068863_100973392 Ga0068863_1009733923 125
164 3300005842 Ga0068858_100676147 Ga0068858_1006761472 125
165 3300005843 Ga0068860_100061074 Ga0068860_1000610743 125
166 3300005843 Ga0068860_100204830 Ga0068860_1002048305 125
167 3300005844 Ga0068862_100003135 Ga0068862_1000031359 125
168 3300005844 Ga0068862_100033237 Ga0068862_1000332375 125
169 3300005844 Ga0068862_100450780 Ga0068862_1004507802 125
170 3300006237 Ga0097621_100250333 Ga0097621_1002503332 125
171 3300006847 Ga0075431_100004274 Ga0075431_1000042748 125
172 3300006852 Ga0075433_10371092 Ga0075433_103710922 125
173 3300006880 Ga0075429_100727833 Ga0075429_1007278332 125
174 3300006881 Ga0068865_100155639 Ga0068865_1001556392 125
175 3300006931 Ga0097620_100004379 Ga0097620_1000043793 125
176 3300006931 Ga0097620_101769944 Ga0097620_1017699442 125
177 3300009094 Ga0111539_10065335 Ga0111539_100653356 125
178 3300009094 Ga0111539_10338944 Ga0111539_103389444 125
179 3300009148 Ga0105243_11079243 Ga0105243_110792432 125
180 3300009177 Ga0105248_10149034 Ga0105248_101490343 125
181 3300009553 Ga0105249_10048668 Ga0105249_100486682 125
182 3300013100 Ga0157373_10752941 Ga0157373_107529412 125
183 3300013102 Ga0157371_10023407 Ga0157371_100234074 125
184 3300013102 Ga0157371_10033303 Ga0157371_100333034 125
185 3300013102 Ga0157371_10056382 Ga0157371_100563822 125
186 3300013102 Ga0157371_10193369 Ga0157371_101933692 125
187 3300013104 Ga0157370_10133214 Ga0157370_101332142 125
188 3300013306 Ga0163162_10490296 Ga0163162_104902964 125
189 3300013308 Ga0157375_10007958 Ga0157375_100079582 125
190 3300014325 Ga0163163_10214042 Ga0163163_102140423 125
191 3300014325 Ga0163163_10835855 Ga0163163_108358553 125
192 3300014326 Ga0157380_10001698 Ga0157380_1000169813 125
193 3300014326 Ga0157380_10003692 Ga0157380_1000369213 125
194 3300014326 Ga0157380_10094605 Ga0157380_100946051 125
195 3300014745 Ga0157377_10608256 Ga0157377_106082561 125
196 3300017792 Ga0163161_10017518 Ga0163161_100175182 125
197 3300017792 Ga0163161_10741450 Ga0163161_107414501 125
198 3300025271 Ga0207666_1010754 Ga0207666_10107542 125
199 3300025315 Ga0207697_10000985 Ga0207697_1000098513 125
200 3300025315 Ga0207697_10009622 Ga0207697_100096226 125
201 3300025315 Ga0207697_10070181 Ga0207697_100701811 125
202 3300025893 Ga0207682_10000857 Ga0207682_100008574 125
203 3300025899 Ga0207642_10760075 Ga0207642_107600751 125
204 3300025901 Ga0207688_10303684 Ga0207688_103036841 125
205 3300025907 Ga0207645_10011981 Ga0207645_100119814 125
206 3300025907 Ga0207645_10510120 Ga0207645_105101203 125
207 3300025907 Ga0207645_10784814 Ga0207645_107848142 125
208 3300025909 Ga0207705_10000648 Ga0207705_1000064837 125
209 3300025909 Ga0207705_10001745 Ga0207705_100017459 125
210 3300025909 Ga0207705_10367653 Ga0207705_103676532 125
211 3300025909 Ga0207705_10994968 Ga0207705_109949682 125
212 3300025911 Ga0207654_11141625 Ga0207654_111416252 125
213 3300025912 Ga0207707_10324691 Ga0207707_103246912 125
214 3300025917 Ga0207660_11065050 Ga0207660_110650502 125
215 3300025919 Ga0207657_10001247 Ga0207657_1000124716 125
216 3300025919 Ga0207657_10001696 Ga0207657_1000169612 125
217 3300025919 Ga0207657_10339132 Ga0207657_103391323 125
218 3300025919 Ga0207657_10383281 Ga0207657_103832812 125
219 3300025919 Ga0207657_11256933 Ga0207657_112569331 125
220 3300025920 Ga0207649_10477927 Ga0207649_104779273 125
221 3300025921 Ga0207652_10853852 Ga0207652_108538521 125
222 3300025923 Ga0207681_10001808 Ga0207681_100018087 125
223 3300025923 Ga0207681_10023028 Ga0207681_100230282 125
224 3300025925 Ga0207650_10014719 Ga0207650_100147194 125
225 3300025925 Ga0207650_10090408 Ga0207650_100904085 125
226 3300025925 Ga0207650_10108169 Ga0207650_101081692 125
227 3300025926 Ga0207659_10003143 Ga0207659_100031434 125
228 3300025926 Ga0207659_10195627 Ga0207659_101956272 125
229 3300025931 Ga0207644_10114064 Ga0207644_101140642 125
230 3300025931 Ga0207644_10367372 Ga0207644_103673722 125
231 3300025932 Ga0207690_10074057 Ga0207690_100740573 125
232 3300025932 Ga0207690_10163158 Ga0207690_101631582 125
233 3300025932 Ga0207690_10353120 Ga0207690_103531203 125
234 3300025932 Ga0207690_11139370 Ga0207690_111393702 125
235 3300025933 Ga0207706_10000284 Ga0207706_1000028429 125
236 3300025933 Ga0207706_10044034 Ga0207706_100440347 125
237 3300025933 Ga0207706_10171181 Ga0207706_101711814 125
238 3300025935 Ga0207709_10097849 Ga0207709_100978493 125
239 3300025937 Ga0207669_10005555 Ga0207669_100055551 125
240 3300025938 Ga0207704_10689029 Ga0207704_106890292 125
241 3300025938 Ga0207704_11057308 Ga0207704_110573082 125
242 3300025940 Ga0207691_10001690 Ga0207691_1000169018 125
243 3300025940 Ga0207691_10117949 Ga0207691_101179492 125
244 3300025941 Ga0207711_10568828 Ga0207711_105688283 125
245 3300025941 Ga0207711_10701542 Ga0207711_107015423 125
246 3300025945 Ga0207679_10006008 Ga0207679_100060085 125
247 3300025945 Ga0207679_10082011 Ga0207679_100820112 125
248 3300025949 Ga0207667_10010703 Ga0207667_100107035 125
249 3300025949 Ga0207667_10186565 Ga0207667_101865653 125
250 3300025960 Ga0207651_10040267 Ga0207651_100402673 125
251 3300025960 Ga0207651_10232660 Ga0207651_102326602 125
252 3300025961 Ga0207712_10412177 Ga0207712_104121772 125
253 3300025972 Ga0207668_10005040 Ga0207668_100050407 125
254 3300025972 Ga0207668_10568511 Ga0207668_105685113 125
255 3300025972 Ga0207668_11924946 Ga0207668_119249462 125
256 3300025981 Ga0207640_10028574 Ga0207640_100285743 125
257 3300025986 Ga0207658_11695478 Ga0207658_116954781 125
258 3300026023 Ga0207677_10402594 Ga0207677_104025943 125
259 3300026041 Ga0207639_10167947 Ga0207639_101679472 125
260 3300026041 Ga0207639_10246266 Ga0207639_102462662 125
261 3300026067 Ga0207678_10171828 Ga0207678_101718282 125
262 3300026067 Ga0207678_10203681 Ga0207678_102036812 125
263 3300026089 Ga0207648_10003838 Ga0207648_1000383816 125
264 3300026089 Ga0207648_11810337 Ga0207648_118103371 125
265 3300026095 Ga0207676_10046933 Ga0207676_100469333 125
266 3300026095 Ga0207676_10285909 Ga0207676_102859092 125
267 3300026095 Ga0207676_11629594 Ga0207676_116295942 125
268 3300026116 Ga0207674_10049004 Ga0207674_100490043 125
269 3300026116 Ga0207674_10396843 Ga0207674_103968432 125
270 3300026116 Ga0207674_10706814 Ga0207674_107068142 125
271 3300026118 Ga0207675_100013354 Ga0207675_1000133545 125
272 3300026118 Ga0207675_100582457 Ga0207675_1005824574 125
273 3300026121 Ga0207683_10011685 Ga0207683_100116857 125
274 3300027614 Ga0209970_1013994 Ga0209970_10139942 125
275 3300027665 Ga0209983_1016172 Ga0209983_10161723 125
276 3300027876 Ga0209974_10043567 Ga0209974_100435672 125
277 3300027876 Ga0209974_10060068 Ga0209974_100600682 125
278 3300027907 Ga0207428_10497067 Ga0207428_104970671 125
279 3300028380 Ga0268265_10001996 Ga0268265_100019967 125
280 3300028380 Ga0268265_10042666 Ga0268265_100426663 125
281 3300028380 Ga0268265_10360134 Ga0268265_103601342 125
282 3300028381 Ga0268264_11715943 Ga0268264_117159432 125
283 3300030742 Ga0316183_1070220 Ga0316183_10702202 125
284 3300030745 Ga0316182_1181019 Ga0316182_11810191 125
285 3300031548 Ga0307408_100103990 Ga0307408_1001039902 125
286 3300031548 Ga0307408_100118755 Ga0307408_1001187552 125
287 3300031548 Ga0307408_100254476 Ga0307408_1002544762 125
288 3300031548 Ga0307408_100320713 Ga0307408_1003207132 125
289 3300031548 Ga0307408_100557747 Ga0307408_1005577472 125
290 3300031548 Ga0307408_101902956 Ga0307408_1019029562 125
291 3300031731 Ga0307405_10023301 Ga0307405_100233012 125
292 3300031731 Ga0307405_10030813 Ga0307405_100308132 125
293 3300031731 Ga0307405_10068564 Ga0307405_100685645 125
294 3300031731 Ga0307405_10136968 Ga0307405_101369682 125
295 3300031731 Ga0307405_10313336 Ga0307405_103133362 125
296 3300031731 Ga0307405_10350556 Ga0307405_103505562 125
297 3300031731 Ga0307405_10436116 Ga0307405_104361162 125
298 3300031731 Ga0307405_10546528 Ga0307405_105465281 125
299 3300031731 Ga0307405_10644168 Ga0307405_106441681 125
300 3300031824 Ga0307413_10002432 Ga0307413_100024325 125
301 3300031824 Ga0307413_10024656 Ga0307413_100246564 125
302 3300031824 Ga0307413_10042054 Ga0307413_100420544 125
303 3300031824 Ga0307413_10052294 Ga0307413_100522945 125
304 3300031824 Ga0307413_10075101 Ga0307413_100751012 125
305 3300031824 Ga0307413_10086273 Ga0307413_100862732 125
306 3300031824 Ga0307413_10394272 Ga0307413_103942721 125
307 3300031824 Ga0307413_10442442 Ga0307413_104424421 125
308 3300031824 Ga0307413_10556944 Ga0307413_105569441 125
309 3300031824 Ga0307413_10949418 Ga0307413_109494182 125
310 3300031824 Ga0307413_11408854 Ga0307413_114088541 125
311 3300031852 Ga0307410_10019081 Ga0307410_100190817 125
312 3300031852 Ga0307410_10043782 Ga0307410_100437822 125
313 3300031852 Ga0307410_10085025 Ga0307410_100850253 125
314 3300031852 Ga0307410_10120734 Ga0307410_101207342 125
315 3300031852 Ga0307410_10140632 Ga0307410_101406325 125
316 3300031852 Ga0307410_10178610 Ga0307410_101786101 125
317 3300031852 Ga0307410_10384354 Ga0307410_103843543 125
318 3300031852 Ga0307410_10536726 Ga0307410_105367262 125
319 3300031852 Ga0307410_10806997 Ga0307410_108069972 125
320 3300031852 Ga0307410_11171609 Ga0307410_111716091 125
321 3300031901 Ga0307406_10015311 Ga0307406_100153112 125
322 3300031901 Ga0307406_10068485 Ga0307406_100684851 125
323 3300031901 Ga0307406_10085033 Ga0307406_100850332 125
324 3300031901 Ga0307406_10116407 Ga0307406_101164072 125
325 3300031901 Ga0307406_10117511 Ga0307406_101175111 125
326 3300031901 Ga0307406_10134339 Ga0307406_101343392 125
327 3300031901 Ga0307406_10668589 Ga0307406_106685891 125
328 3300031901 Ga0307406_11369300 Ga0307406_113693001 125
329 3300031903 Ga0307407_10003648 Ga0307407_100036487 125
330 3300031903 Ga0307407_10021951 Ga0307407_100219517 125
331 3300031903 Ga0307407_10068028 Ga0307407_100680285 125
332 3300031903 Ga0307407_10112960 Ga0307407_101129603 125
333 3300031903 Ga0307407_10203044 Ga0307407_102030442 125
334 3300031903 Ga0307407_10312114 Ga0307407_103121141 125
335 3300031903 Ga0307407_11026299 Ga0307407_110262992 125
336 3300031911 Ga0307412_10026727 Ga0307412_100267272 125
337 3300031911 Ga0307412_10031859 Ga0307412_100318597 125
338 3300031911 Ga0307412_10039584 Ga0307412_100395844 125
339 3300031911 Ga0307412_10083188 Ga0307412_100831885 125
340 3300031911 Ga0307412_10109135 Ga0307412_101091352 125
341 3300031911 Ga0307412_10131642 Ga0307412_101316423 125
342 3300031911 Ga0307412_10167095 Ga0307412_101670953 125
343 3300031911 Ga0307412_10205621 Ga0307412_102056214 125
344 3300031911 Ga0307412_10257176 Ga0307412_102571762 125
345 3300031911 Ga0307412_10873756 Ga0307412_108737562 125
346 3300031911 Ga0307412_11600146 Ga0307412_116001462 125
347 3300031911 Ga0307412_11849732 Ga0307412_118497322 125
348 3300031995 Ga0307409_100070109 Ga0307409_1000701097 125
349 3300031995 Ga0307409_100080661 Ga0307409_1000806616 125
350 3300031995 Ga0307409_100089251 Ga0307409_1000892512 125
351 3300031995 Ga0307409_100140198 Ga0307409_1001401984 125
352 3300031995 Ga0307409_100196561 Ga0307409_1001965612 125
353 3300031995 Ga0307409_100370746 Ga0307409_1003707464 125
354 3300031995 Ga0307409_100447268 Ga0307409_1004472681 125
355 3300031995 Ga0307409_100520048 Ga0307409_1005200484 125
356 3300031995 Ga0307409_100566236 Ga0307409_1005662362 125
357 3300031995 Ga0307409_100593787 Ga0307409_1005937871 125
358 3300031995 Ga0307409_100613929 Ga0307409_1006139292 125
359 3300031995 Ga0307409_100685762 Ga0307409_1006857623 125
360 3300031995 Ga0307409_100859864 Ga0307409_1008598642 125
361 3300031995 Ga0307409_100861345 Ga0307409_1008613452 125
362 3300031995 Ga0307409_100868867 Ga0307409_1008688672 125
363 3300031995 Ga0307409_101479287 Ga0307409_1014792872 125
364 3300031995 Ga0307409_101505317 Ga0307409_1015053172 125
365 3300031995 Ga0307409_101938937 Ga0307409_1019389372 125
366 3300031995 Ga0307409_102298732 Ga0307409_1022987321 125
367 3300032002 Ga0307416_100139347 Ga0307416_1001393472 125
368 3300032002 Ga0307416_100217959 Ga0307416_1002179594 125
369 3300032002 Ga0307416_100346442 Ga0307416_1003464422 125
370 3300032002 Ga0307416_100547748 Ga0307416_1005477482 125
371 3300032002 Ga0307416_100730717 Ga0307416_1007307172 125
372 3300032002 Ga0307416_101130659 Ga0307416_1011306592 125
373 3300032002 Ga0307416_101313669 Ga0307416_1013136692 125
374 3300032002 Ga0307416_102199067 Ga0307416_1021990672 125
375 3300032002 Ga0307416_103415002 Ga0307416_1034150021 125
376 3300032004 Ga0307414_10002885 Ga0307414_100028853 125
377 3300032004 Ga0307414_10020771 Ga0307414_100207717 125
378 3300032004 Ga0307414_10047412 Ga0307414_100474123 125
379 3300032004 Ga0307414_10050848 Ga0307414_100508482 125
380 3300032004 Ga0307414_10058173 Ga0307414_100581732 125
381 3300032004 Ga0307414_10122314 Ga0307414_101223142 125
382 3300032004 Ga0307414_10161712 Ga0307414_101617122 125
383 3300032004 Ga0307414_10162526 Ga0307414_101625262 125
384 3300032004 Ga0307414_10201150 Ga0307414_102011502 125
385 3300032004 Ga0307414_10402582 Ga0307414_104025823 125
386 3300032004 Ga0307414_10603572 Ga0307414_106035723 125
387 3300032004 Ga0307414_10724126 Ga0307414_107241262 125
388 3300032004 Ga0307414_11706781 Ga0307414_117067812 125
389 3300032005 Ga0307411_10007367 Ga0307411_100073677 125
390 3300032005 Ga0307411_10009224 Ga0307411_100092244 125
391 3300032005 Ga0307411_10010450 Ga0307411_100104505 125
392 3300032005 Ga0307411_10032872 Ga0307411_100328722 125
393 3300032005 Ga0307411_10046135 Ga0307411_100461354 125
394 3300032005 Ga0307411_10067959 Ga0307411_100679594 125
395 3300032005 Ga0307411_10097054 Ga0307411_100970543 125
396 3300032005 Ga0307411_10103265 Ga0307411_101032652 125
397 3300032005 Ga0307411_10152836 Ga0307411_101528362 125
398 3300032005 Ga0307411_10156790 Ga0307411_101567902 125
399 3300032005 Ga0307411_10249114 Ga0307411_102491144 125
400 3300032005 Ga0307411_10259978 Ga0307411_102599782 125
401 3300032005 Ga0307411_10275881 Ga0307411_102758812 125
402 3300032005 Ga0307411_10281956 Ga0307411_102819562 125
403 3300032005 Ga0307411_10398431 Ga0307411_103984312 125
404 3300032005 Ga0307411_10614318 Ga0307411_106143182 125
405 3300032005 Ga0307411_10715878 Ga0307411_107158782 125
406 3300032005 Ga0307411_10909522 Ga0307411_109095222 125
407 3300032126 Ga0307415_100015344 Ga0307415_1000153445 125
408 3300032126 Ga0307415_100016359 Ga0307415_1000163598 125
409 3300032126 Ga0307415_100051417 Ga0307415_1000514172 125
410 3300032126 Ga0307415_100076428 Ga0307415_1000764282 125
411 3300032126 Ga0307415_100083418 Ga0307415_1000834186 125
412 3300032126 Ga0307415_100211551 Ga0307415_1002115514 125
413 3300032126 Ga0307415_100232389 Ga0307415_1002323892 125
414 3300032126 Ga0307415_100285199 Ga0307415_1002851994 125
415 3300032126 Ga0307415_100319514 Ga0307415_1003195142 125
416 3300032126 Ga0307415_100365786 Ga0307415_1003657862 125
417 3300032126 Ga0307415_100546551 Ga0307415_1005465512 125
418 3300032126 Ga0307415_101142170 Ga0307415_1011421702 125
419 3300032126 Ga0307415_101532629 Ga0307415_1015326292 125
420 3300032126 Ga0307415_101749691 Ga0307415_1017496912 125
421 3300037312 Ga0395899_0004515 Ga0395899_0004515_1789_2172 125
422 3300037312 Ga0395899_0116962 Ga0395899_0116962_682_1065 125
423 3300037312 Ga0395899_0255725 Ga0395899_0255725_264_644 125
424 3300037418 Ga0395900_0000777 Ga0395900_0000777_33458_33841 125
425 3300037418 Ga0395900_0001654 Ga0395900_0001654_8965_9345 125
426 3300037466 Ga0395898_0015202 Ga0395898_0015202_4309_4692 125
427 3300037466 Ga0395898_0209161 Ga0395898_0209161_923_1306 125
428 3300037471 Ga0395905_0001805 Ga0395905_0001805_5907_6287 125
429 3300037471 Ga0395905_0049460 Ga0395905_0049460_2316_2705 125
430 3300037471 Ga0395905_0113958 Ga0395905_0113958_2003_2386 125
431 3300037471 Ga0395905_0432323 Ga0395905_0432323_245_628 125
432 3300037471 Ga0395905_0790047 Ga0395905_0790047_392_778 125
433 3300037471 Ga0395905_1625400 Ga0395905_1625400_44_430 125
434 3300038443 Ga0395901_0002157 Ga0395901_0002157_698_1078 125
435 3300038443 Ga0395901_0006976 Ga0395901_0006976_1827_2210 125
436 3300038443 Ga0395901_0032181 Ga0395901_0032181_3879_4262 125
437 3300041408 Ga0439453_0024191 Ga0439453_0024191_670_1068 125
438 3300041410 Ga0439461_0109499 Ga0439461_0109499_267_665 125
439 3300041411 Ga0439466_0066009 Ga0439466_0066009_334_726 125
440 3300041512 Ga0451853_2745094 Ga0451853_2745094_195_584 125
441 3300041997 Ga0439431_0185532 Ga0439431_0185532_111_509 125
442 3300042007 Ga0439449_0203724 Ga0439449_0203724_320_709 125
443 3300046492 Ga0495585_0411978 Ga0495585_0411978_45_422 125
444 3300046525 Ga0495663_0004557 Ga0495663_0004557_2327_2704 125
445 3300046528 Ga0495642_0085352 Ga0495642_0085352_365_742 125
446 3300046539 Ga0495621_0000209 Ga0495621_0000209_1649_2026 125
447 3300046539 Ga0495621_0030922 Ga0495621_0030922_736_1113 125
448 3300046558 Ga0495633_0058806 Ga0495633_0058806_1277_1654 125
449 3300046558 Ga0495633_0177786 Ga0495633_0177786_286_663 125
450 3300046558 Ga0495633_0516480 Ga0495633_0516480_120_506 125
451 3300046664 Ga0495659_0026155 Ga0495659_0026155_986_1363 125
452 3300046664 Ga0495659_0054902 Ga0495659_0054902_115_492 125
453 3300046664 Ga0495659_0160992 Ga0495659_0160992_129_506 125
454 3300046664 Ga0495659_0379764 Ga0495659_0379764_47_424 125
455 3300046684 Ga0495669_0065702 Ga0495669_0065702_26_403 125
456 3300046691 Ga0495670_0013506 Ga0495670_0013506_1309_1686 125
457 3300046691 Ga0495670_0029074 Ga0495670_0029074_1319_1696 125
458 3300046691 Ga0495670_0031402 Ga0495670_0031402_1203_1580 125
459 3300046691 Ga0495670_0177765 Ga0495670_0177765_255_632 125
460 3300047445 Ga0495677_0032746 Ga0495677_0032746_1372_1749 125
461 3300048905 Ga0496102_0572745 Ga0496102_0572745_327_713 125
462 3300048910 Ga0496107_0539245 Ga0496107_0539245_193_576 125
463 3300048911 Ga0496108_0588607 Ga0496108_0588607_386_772 125
464 3300048912 Ga0496109_0223647 Ga0496109_0223647_307_690 125
465 3300048912 Ga0496109_0876599 Ga0496109_0876599_64_450 125
466 3300048913 Ga0496110_0076524 Ga0496110_0076524_1076_1462 125
467 3300048913 Ga0496110_0103542 Ga0496110_0103542_1548_1931 125
468 3300048914 Ga0496111_0008972 Ga0496111_0008972_5804_6187 125
469 3300048916 Ga0496113_0597498 Ga0496113_0597498_192_578 125
470 3300048917 Ga0496114_0006322 Ga0496114_0006322_238_621 125
471 3300049650 Ga0501199_043016 Ga0501199_043016_127_507 125
472 3300049651 Ga0501201_033122 Ga0501201_033122_85_465 125
473 3300049652 Ga0501202_108198 Ga0501202_108198_178_558 125
474 3300049656 Ga0501209_054526 Ga0501209_054526_659_1039 125
475 3300049659 Ga0501214_070020 Ga0501214_070020_107_487 125
476 3300049663 Ga0501223_062192 Ga0501223_062192_94_474 125
477 3300049664 Ga0501224_047780 Ga0501224_047780_128_508 125
478 3300049667 Ga0501230_060857 Ga0501230_060857_333_713 125
479 3300049669 Ga0501235_002169 Ga0501235_002169_231_611 125
480 3300049677 Ga0501247_057288 Ga0501247_057288_127_507 125
481 3300049679 Ga0501249_001173 Ga0501249_001173_4854_5234 125
482 3300049686 Ga0501257_039862 Ga0501257_039862_216_596 125
483 3300049687 Ga0501258_012168 Ga0501258_012168_259_639 125
484 3300049707 Ga0501234_028998 Ga0501234_028998_424_804 125
485 3300049760 Ga0501263_042673 Ga0501263_042673_257_637 125
486 3300049769 Ga0501272_006790 Ga0501272_006790_128_508 125
487 3300049850 Ga0501204_003946 Ga0501204_003946_952_1332 125
488 3300049851 Ga0501212_043703 Ga0501212_043703_225_605 125
489 3300050491 nmdc:mga00v17_866346_c1 nmdc:mga00v17_866346_c1_90_479 125
490 3300050510 nmdc:mga06r32_11078_c1 nmdc:mga06r32_11078_c1_6443_6823 125
491 3300050511 nmdc:mga08y16_406932_c1 nmdc:mga08y16_406932_c1_463_840 125
492 3300050515 nmdc:mga0a205_546334_c1 nmdc:mga0a205_546334_c1_135_512 125

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03061

4HBT

Thioesterase superfamily

43

120

0.95

PF13622

4HBT_3

Acyl-CoA thioesterase N-terminal domain

37

128

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
3nwz-assembly2.cif.gz_C crystal structure of bh2602 protein from bacillus halodurans with coa, northeast structural genomics consortium target bhr199 0.8837 7 123
1zki-assembly1.cif.gz_B structure of conserved protein pa5202 from pseudomonas aeruginosa 0.883 4 123
3lz7-assembly1.cif.gz_A crystal structure of thioesterase hi1161 ec3.1.2.- from haemophilus influenzae. orthorombic crystal form. northeast structural genomics consortium target ir63 0.8817 7 124
3nwz-assembly3.cif.gz_B crystal structure of bh2602 protein from bacillus halodurans with coa, northeast structural genomics consortium target bhr199 0.8784 1 125
3dkz-assembly1.cif.gz_A crystal structure of the q7w9w5_borpa protein from bordetella parapertussis. northeast structural genomics consortium target bpr208c. 0.8748 5 122
ID Description Score Start End Superfamily
af_A0A1D6F200_19_155_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8701 13 121 3.10.129.10
1zkiB00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8633 4 123 3.10.129.10
3e1eD00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8606 4 125 3.10.129.10
af_Q9FI76_3_136_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8578 5 123 3.10.129.10
af_A0A0R0II97_1_126_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8556 33 123 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A7Y1T648-F1-model_v4 deleted 0.9719 4 125
AF-A0A537LWU9-F1-model_v4 PaaI family thioesterase 0.962 1 124 GO:0016289
AF-A0A537LWU9-F1-model_v4 PaaI family thioesterase 0.9472 1 124 GO:0016289
AF-A0A7Y1T648-F1-model_v4 deleted 0.9417 4 125
AF-A0A4Y9RLR3-F1-model_v4 PaaI family thioesterase 0.9381 5 123

Feature Viewer

pLDDT pTM Quality
90.47 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map