F454290

General Info

Members Datasets Scaffolds Average Seq Length
492 239 984 194

Family's Representative Sequence

Representative Sequence 3300032126|Ga0307415_100049326|Ga0307415_1000493263
Length 213
Sequence MVYFSCAPHPRGLAKKTPDMYELFFQKLTGKVAFTPEEQEVIRHYLTPKKLRKRQYLLQEGDVCKHIAFVEKGVLRAYTVDDKGIEHIIQFAPEGWTISDLYSFMTGEGATYNIDALEDSELVLISRQAQEELLQKVPRYSDFIRLQITGAYLAMQKRLTSVLSLGVEERYSNLLKLYPDLVQRVPQHMIASYMGLTPETLSRVRRKMARKDS

Samples

Sample ID Description Type Environment
1 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
6 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
7 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
8 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
60 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
73 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
74 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
75 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
84 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
88 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
89 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
135 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
136 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
137 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
138 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
139 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
140 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
141 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
142 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
143 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
144 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
145 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
146 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
147 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
148 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
149 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
150 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
151 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
152 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
153 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
154 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
155 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
156 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
157 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
158 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
159 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
160 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
161 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
162 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
163 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
164 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
165 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
166 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
167 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
168 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
169 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
170 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
171 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
172 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
173 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
174 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
175 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
176 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
177 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
178 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
179 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
180 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
181 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
182 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
183 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
184 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
185 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
186 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
187 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
188 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
189 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
190 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
191 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
192 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
193 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
199 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
200 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
201 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
202 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
203 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
204 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
205 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
206 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
207 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
208 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
209 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
210 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
211 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
212 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
213 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
214 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
215 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
216 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
217 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
218 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
219 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
220 3300049773 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control Metagenome Rhizosphere
221 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
223 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
224 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
225 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
226 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
227 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
228 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
229 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
230 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
231 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
232 3300053726 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere Metagenome Endosphere
233 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
234 2585428060 Chryseobacterium sp. OV715 Isolate Rhizosphere
235 2588253712 Chryseobacterium sp. OV279 Isolate Rhizosphere
236 2738541279 Flavobacterium sp. GV069 Isolate Unclassified
237 2738541285 Flavobacterium sp. GV030 Isolate Unclassified
238 2738543007 Flavobacterium sp. GV063 Isolate Unclassified
239 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.78
Metatranscriptomes 0
Isolates 1.22

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.46
Nodule 0
Rhizoplane 0.2
Rhizosphere 92.89
Stem 0
Stem Tuber 0
Unclassified 16.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307415_100049326 3300032126 Bacteria 2846
2 rootH2_10059655 3300003320 Bacteria 4283
3 rootL2_10047565 3300003322 Bacteria 4011
4 rootL2_10060049 3300003322 Bacteria 1655
5 rootL2_10066252 3300003322 Bacteria 3587
6 rootL2_10119527 3300003322 Unclassified 1476
7 rootL2_10269286 3300003322 Unclassified 1831
8 rootH1_10068010 3300003323 Bacteria 13848
9 rootH1_10201698 3300003323 Bacteria 2920
10 Ga0055531_10000547 3300003794 Bacteria 33330
11 Ga0055543_1032052 3300004625 Bacteria 914
12 Ga0065165_1000783 3300005262 Bacteria 42648
13 Ga0065714_10005223 3300005288 Bacteria 4341
14 Ga0065714_10141957 3300005288 Bacteria 1165
15 Ga0065704_10000434 3300005289 Bacteria 21011
16 Ga0065707_10279509 3300005295 Bacteria 1051
17 Ga0070658_10018091 3300005327 Bacteria 5637
18 Ga0070658_10073166 3300005327 Bacteria 2810
19 Ga0070658_10349552 3300005327 Bacteria 1265
20 Ga0070658_10493979 3300005327 Bacteria 1057
21 Ga0070658_10989651 3300005327 Bacteria 731
22 Ga0070676_10160171 3300005328 Bacteria 1448
23 Ga0070683_100194082 3300005329 Bacteria 1928
24 Ga0070683_100238624 3300005329 Unclassified 1729
25 Ga0070683_100397718 3300005329 Bacteria 1314
26 Ga0070690_100004064 3300005330 Bacteria 8098
27 Ga0070690_100074283 3300005330 Bacteria 2214
28 Ga0070670_100067183 3300005331 Bacteria 3077
29 Ga0070670_100548416 3300005331 Bacteria 1031
30 Ga0070677_10029966 3300005333 Unclassified 2068
31 Ga0070677_10206131 3300005333 Bacteria 952
32 Ga0068869_100025882 3300005334 Bacteria 4079
33 Ga0068869_100170529 3300005334 Bacteria 1700
34 Ga0070666_10086777 3300005335 Bacteria 2145
35 Ga0070666_10494669 3300005335 Unclassified 886
36 Ga0070680_100044464 3300005336 Bacteria 3608
37 Ga0070680_100055428 3300005336 Bacteria 3239
38 Ga0070680_100196788 3300005336 Bacteria 1699
39 Ga0070682_100042786 3300005337 Bacteria 2799
40 Ga0070682_100492581 3300005337 Bacteria 948
41 Ga0068868_100078830 3300005338 Bacteria 2637
42 Ga0068868_100608702 3300005338 Bacteria 969
43 Ga0070660_100023659 3300005339 Bacteria 4553
44 Ga0070660_100030483 3300005339 Bacteria 4047
45 Ga0070660_100032498 3300005339 Bacteria 3927
46 Ga0070660_100040290 3300005339 Bacteria 3554
47 Ga0070660_100489035 3300005339 Bacteria 1023
48 Ga0070660_100890760 3300005339 Unclassified 750
49 Ga0070689_100255521 3300005340 Bacteria 1447
50 Ga0070661_100346230 3300005344 Bacteria 1165
51 Ga0070661_100666069 3300005344 Bacteria 846
52 Ga0070668_100950148 3300005347 Bacteria 770
53 Ga0070669_101279287 3300005353 Bacteria 635
54 Ga0070675_100035329 3300005354 Bacteria 4061
55 Ga0070675_100106859 3300005354 Bacteria 2363
56 Ga0070675_100944169 3300005354 Bacteria 791
57 Ga0070671_100056337 3300005355 Unclassified 3270
58 Ga0070674_100344086 3300005356 Bacteria 1202
59 Ga0070674_100714547 3300005356 Bacteria 858
60 Ga0070673_100071639 3300005364 Bacteria 2785
61 Ga0070673_100239540 3300005364 Bacteria 1577
62 Ga0070659_100004616 3300005366 Bacteria 9841
63 Ga0070659_100040009 3300005366 Bacteria 3662
64 Ga0070667_100028100 3300005367 Bacteria 4682
65 Ga0070701_10066530 3300005438 Bacteria 1915
66 Ga0070700_100425656 3300005441 Bacteria 1004
67 Ga0070678_100020105 3300005456 Bacteria 4374
68 Ga0070678_100048430 3300005456 Unclassified 3061
69 Ga0070678_100850488 3300005456 Bacteria 831
70 Ga0070681_10017834 3300005458 Bacteria 7094
71 Ga0070681_10053622 3300005458 Bacteria 4019
72 Ga0070681_10094742 3300005458 Bacteria 2934
73 Ga0070681_10170269 3300005458 Bacteria 2100
74 Ga0068867_100268461 3300005459 Bacteria 1394
75 Ga0068867_100832229 3300005459 Bacteria 826
76 Ga0070685_10103462 3300005466 Bacteria 1742
77 Ga0070679_100008912 3300005530 Bacteria 9466
78 Ga0070679_100033073 3300005530 Bacteria 5118
79 Ga0070679_100038687 3300005530 Bacteria 4742
80 Ga0070679_100062854 3300005530 Bacteria 3701
81 Ga0070679_100127702 3300005530 Bacteria 2524
82 Ga0070679_100166661 3300005530 Bacteria 2176
83 Ga0070679_100667278 3300005530 Bacteria 982
84 Ga0070684_100089178 3300005535 Bacteria 2741
85 Ga0068853_100084514 3300005539 Bacteria 2781
86 Ga0068853_100304675 3300005539 Bacteria 1473
87 Ga0068853_100682633 3300005539 Bacteria 979
88 Ga0068853_100866113 3300005539 Bacteria 867
89 Ga0070672_100202181 3300005543 Bacteria 1662
90 Ga0070672_100243346 3300005543 Bacteria 1514
91 Ga0070672_100593137 3300005543 Unclassified 964
92 Ga0070686_100012608 3300005544 Bacteria 4819
93 Ga0070686_100107660 3300005544 Bacteria 1894
94 Ga0070686_100144421 3300005544 Unclassified 1660
95 Ga0070696_100991432 3300005546 Unclassified 701
96 Ga0070665_100521532 3300005548 Bacteria 1200
97 Ga0068855_100002929 3300005563 Bacteria 20890
98 Ga0068855_100016232 3300005563 Bacteria 8955
99 Ga0068855_100026613 3300005563 Bacteria 6920
100 Ga0068855_100698194 3300005563 Unclassified 1086
101 Ga0068855_100884616 3300005563 Bacteria 944
102 Ga0070664_100076806 3300005564 Unclassified 2871
103 Ga0070664_100577575 3300005564 Bacteria 1041
104 Ga0070664_100594217 3300005564 Bacteria 1026
105 Ga0068857_100358914 3300005577 Bacteria 1351
106 Ga0068857_100651302 3300005577 Bacteria 998
107 Ga0068854_100061147 3300005578 Unclassified 2727
108 Ga0068854_100094985 3300005578 Bacteria 2225
109 Ga0068856_100033276 3300005614 Bacteria 5047
110 Ga0068856_100859106 3300005614 Bacteria 926
111 Ga0068856_101175719 3300005614 Bacteria 784
112 Ga0070702_100064973 3300005615 Bacteria 2136
113 Ga0068852_100002674 3300005616 Bacteria 12316
114 Ga0068852_100094203 3300005616 Unclassified 2686
115 Ga0068852_100253275 3300005616 Bacteria 1688
116 Ga0068852_100294431 3300005616 Bacteria 1569
117 Ga0068852_100454428 3300005616 Unclassified 1269
118 Ga0068866_10575850 3300005718 Bacteria 756
119 Ga0068861_100326670 3300005719 Bacteria 1338
120 Ga0068861_101171396 3300005719 Bacteria 742
121 Ga0068851_10151404 3300005834 Bacteria 1268
122 Ga0068863_100174387 3300005841 Bacteria 2063
123 Ga0068863_100374239 3300005841 Bacteria 1390
124 Ga0068858_100181258 3300005842 Unclassified 1989
125 Ga0068858_101186595 3300005842 Bacteria 750
126 Ga0068860_100000103 3300005843 Bacteria 139076
127 Ga0070715_10148234 3300006163 Bacteria 1147
128 Ga0075366_10000267 3300006195 Bacteria 23116
129 Ga0075366_10002159 3300006195 Bacteria 10022
130 Ga0075366_10280698 3300006195 Bacteria 1018
131 Ga0097621_100417583 3300006237 Unclassified 1204
132 Ga0097621_100431744 3300006237 Unclassified 1184
133 Ga0097621_100945807 3300006237 Unclassified 804
134 Ga0068871_100048524 3300006358 Bacteria 3428
135 Ga0068871_100649874 3300006358 Unclassified 963
136 Ga0068871_101149623 3300006358 Bacteria 727
137 Ga0075429_100595884 3300006880 Bacteria 968
138 Ga0068865_100442794 3300006881 Bacteria 1073
139 Ga0105240_10031537 3300009093 Bacteria 6872
140 Ga0105240_10149391 3300009093 Bacteria 2785
141 Ga0111539_10162815 3300009094 Bacteria 2609
142 Ga0111539_11024817 3300009094 Bacteria 959
143 Ga0105241_10006659 3300009174 Bacteria 8501
144 Ga0105241_10557929 3300009174 Bacteria 1029
145 Ga0105242_10034759 3300009176 Bacteria 4041
146 Ga0105242_10096908 3300009176 Bacteria 2493
147 Ga0105242_10849262 3300009176 Bacteria 908
148 Ga0105248_10478351 3300009177 Bacteria 1404
149 Ga0105237_10034528 3300009545 Bacteria 5120
150 Ga0105239_10025624 3300010375 Bacteria 6494
151 Ga0105239_10088742 3300010375 Bacteria 3410
152 Ga0105239_10346824 3300010375 Bacteria 1676
153 Ga0105246_10131740 3300011119 Bacteria 1868
154 Ga0157373_10000715 3300013100 Bacteria 25990
155 Ga0157373_10000773 3300013100 Bacteria 24671
156 Ga0157373_10009211 3300013100 Bacteria 7301
157 Ga0157373_10013271 3300013100 Bacteria 6046
158 Ga0157373_10061230 3300013100 Bacteria 2666
159 Ga0157373_10137532 3300013100 Bacteria 1718
160 Ga0157373_10176881 3300013100 Bacteria 1502
161 Ga0157371_10000584 3300013102 Bacteria 43265
162 Ga0157371_10001101 3300013102 Bacteria 29303
163 Ga0157371_10001748 3300013102 Bacteria 22014
164 Ga0157371_10005044 3300013102 Bacteria 11291
165 Ga0157371_10038391 3300013102 Bacteria 3427
166 Ga0157371_10061701 3300013102 Unclassified 2658
167 Ga0157371_10125654 3300013102 Bacteria 1824
168 Ga0157371_10312601 3300013102 Bacteria 1139
169 Ga0157371_10336716 3300013102 Bacteria 1097
170 Ga0157370_10000821 3300013104 Bacteria 39240
171 Ga0157370_10003789 3300013104 Bacteria 17648
172 Ga0157370_10012968 3300013104 Bacteria 8614
173 Ga0157370_10067444 3300013104 Bacteria 3382
174 Ga0157370_10118858 3300013104 Bacteria 2468
175 Ga0157370_10126713 3300013104 Bacteria 2383
176 Ga0157370_10434975 3300013104 Bacteria 1206
177 Ga0157370_10475696 3300013104 Unclassified 1148
178 Ga0157369_10000403 3300013105 Bacteria 57592
179 Ga0157369_10003166 3300013105 Bacteria 19645
180 Ga0157369_10007205 3300013105 Bacteria 12816
181 Ga0157369_10045270 3300013105 Unclassified 4787
182 Ga0157369_10190657 3300013105 Bacteria 2154
183 Ga0157369_10452867 3300013105 Unclassified 1329
184 Ga0157369_10457844 3300013105 Bacteria 1321
185 Ga0157374_10090571 3300013296 Bacteria 2916
186 Ga0157374_10243555 3300013296 Bacteria 1768
187 Ga0157374_11183470 3300013296 Unclassified 785
188 Ga0157378_10005693 3300013297 Bacteria 10904
189 Ga0157378_10669740 3300013297 Bacteria 1055
190 Ga0163162_10000269 3300013306 Bacteria 47344
191 Ga0163162_10006296 3300013306 Bacteria 11495
192 Ga0163162_10037892 3300013306 Unclassified 4812
193 Ga0163162_10151838 3300013306 Bacteria 2435
194 Ga0163162_10276104 3300013306 Bacteria 1812
195 Ga0157372_10001337 3300013307 Bacteria 26657
196 Ga0157372_10008116 3300013307 Bacteria 11166
197 Ga0157372_10049206 3300013307 Bacteria 4687
198 Ga0157372_10050140 3300013307 Bacteria 4644
199 Ga0157372_10086712 3300013307 Bacteria 3552
200 Ga0157372_10113843 3300013307 Bacteria 3101
201 Ga0157372_10166304 3300013307 Bacteria 2551
202 Ga0157372_10225668 3300013307 Unclassified 2172
203 Ga0157372_10267520 3300013307 Bacteria 1986
204 Ga0157372_10410370 3300013307 Bacteria 1578
205 Ga0157372_10787987 3300013307 Unclassified 1105
206 Ga0157372_11760341 3300013307 Unclassified 713
207 Ga0157372_12005635 3300013307 Unclassified 665
208 Ga0157375_10069107 3300013308 Bacteria 3537
209 Ga0157375_10114919 3300013308 Bacteria 2794
210 Ga0157375_10208838 3300013308 Bacteria 2109
211 Ga0157375_11272453 3300013308 Bacteria 864
212 Ga0163163_10200698 3300014325 Unclassified 2043
213 Ga0157380_10170542 3300014326 Unclassified 1901
214 Ga0157380_10678250 3300014326 Bacteria 1032
215 Ga0157380_10929981 3300014326 Unclassified 898
216 Ga0157377_10099110 3300014745 Unclassified 1733
217 Ga0157377_10522961 3300014745 Unclassified 833
218 Ga0157379_10151750 3300014968 Bacteria 2090
219 Ga0157376_10100219 3300014969 Bacteria 2529
220 Ga0157376_10658249 3300014969 Bacteria 1048
221 Ga0157376_11406742 3300014969 Bacteria 729
222 Ga0182006_1015245 3300015261 Bacteria 3297
223 Ga0163161_10036180 3300017792 Bacteria 3536
224 Ga0163161_10396689 3300017792 Bacteria 1106
225 Ga0209257_1000008 3300025304 Bacteria 1294570
226 Ga0207682_10034226 3300025893 Bacteria 2047
227 Ga0207642_10760752 3300025899 Bacteria 614
228 Ga0207688_10046406 3300025901 Bacteria 2426
229 Ga0207680_10164704 3300025903 Bacteria 1489
230 Ga0207647_10073242 3300025904 Unclassified 2065
231 Ga0207647_10221644 3300025904 Unclassified 1090
232 Ga0207645_10034054 3300025907 Bacteria 3273
233 Ga0207645_10061658 3300025907 Unclassified 2396
234 Ga0207643_10140691 3300025908 Bacteria 1441
235 Ga0207643_10320118 3300025908 Bacteria 968
236 Ga0207705_10015359 3300025909 Bacteria 5493
237 Ga0207705_10042401 3300025909 Bacteria 3267
238 Ga0207705_10052154 3300025909 Unclassified 2944
239 Ga0207705_10250331 3300025909 Bacteria 1351
240 Ga0207705_10522677 3300025909 Bacteria 922
241 Ga0207705_10541175 3300025909 Bacteria 905
242 Ga0207705_10561211 3300025909 Bacteria 888
243 Ga0207654_10016950 3300025911 Unclassified 3802
244 Ga0207707_10035725 3300025912 Bacteria 4346
245 Ga0207707_10068590 3300025912 Bacteria 3090
246 Ga0207707_10226888 3300025912 Bacteria 1625
247 Ga0207707_10544497 3300025912 Unclassified 986
248 Ga0207707_10567092 3300025912 Bacteria 963
249 Ga0207695_10202691 3300025913 Bacteria 1897
250 Ga0207695_10208185 3300025913 Unclassified 1868
251 Ga0207695_10317856 3300025913 Bacteria 1447
252 Ga0207671_10004239 3300025914 Bacteria 13812
253 Ga0207671_10346423 3300025914 Bacteria 1178
254 Ga0207660_10046533 3300025917 Bacteria 3061
255 Ga0207660_10047899 3300025917 Bacteria 3024
256 Ga0207660_10537056 3300025917 Bacteria 950
257 Ga0207662_10025357 3300025918 Bacteria 3415
258 Ga0207657_10016002 3300025919 Bacteria 7241
259 Ga0207657_10023224 3300025919 Bacteria 5780
260 Ga0207657_10035971 3300025919 Bacteria 4435
261 Ga0207657_10048764 3300025919 Bacteria 3696
262 Ga0207657_10124824 3300025919 Bacteria 2115
263 Ga0207652_10000103 3300025921 Bacteria 91988
264 Ga0207652_10002216 3300025921 Bacteria 16580
265 Ga0207652_10098138 3300025921 Bacteria 2583
266 Ga0207652_10121463 3300025921 Bacteria 2324
267 Ga0207652_10253855 3300025921 Unclassified 1586
268 Ga0207652_10257070 3300025921 Bacteria 1575
269 Ga0207652_10394030 3300025921 Bacteria 1250
270 Ga0207652_10519489 3300025921 Bacteria 1071
271 Ga0207650_10125637 3300025925 Unclassified 2002
272 Ga0207650_10250600 3300025925 Bacteria 1433
273 Ga0207650_10782145 3300025925 Bacteria 808
274 Ga0207659_10442261 3300025926 Bacteria 1094
275 Ga0207659_10537890 3300025926 Bacteria 992
276 Ga0207659_10717334 3300025926 Bacteria 857
277 Ga0207644_10133843 3300025931 Bacteria 1901
278 Ga0207690_10128733 3300025932 Bacteria 1850
279 Ga0207690_10138474 3300025932 Bacteria 1790
280 Ga0207690_10393525 3300025932 Bacteria 1104
281 Ga0207706_10025883 3300025933 Bacteria 5254
282 Ga0207706_10309015 3300025933 Bacteria 1377
283 Ga0207686_10095357 3300025934 Bacteria 1974
284 Ga0207670_10699279 3300025936 Bacteria 839
285 Ga0207669_10135868 3300025937 Bacteria 1698
286 Ga0207704_10205299 3300025938 Bacteria 1446
287 Ga0207691_10058041 3300025940 Bacteria 3521
288 Ga0207691_10299610 3300025940 Unclassified 1381
289 Ga0207691_10316119 3300025940 Bacteria 1339
290 Ga0207691_11007321 3300025940 Bacteria 695
291 Ga0207689_10215436 3300025942 Bacteria 1587
292 Ga0207689_10450182 3300025942 Bacteria 1076
293 Ga0207689_10879480 3300025942 Bacteria 756
294 Ga0207661_10126202 3300025944 Bacteria 2186
295 Ga0207661_10370493 3300025944 Bacteria 1295
296 Ga0207667_10010940 3300025949 Bacteria 10574
297 Ga0207667_10147754 3300025949 Bacteria 2419
298 Ga0207667_10223496 3300025949 Bacteria 1929
299 Ga0207667_10465676 3300025949 Bacteria 1284
300 Ga0207667_10893091 3300025949 Bacteria 881
301 Ga0207667_11040786 3300025949 Bacteria 804
302 Ga0207651_10145319 3300025960 Bacteria 1838
303 Ga0207651_10168227 3300025960 Bacteria 1726
304 Ga0207712_10923977 3300025961 Bacteria 772
305 Ga0207640_10071303 3300025981 Unclassified 2340
306 Ga0207640_10107647 3300025981 Unclassified 1969
307 Ga0207703_10160187 3300026035 Bacteria 1970
308 Ga0207639_10050543 3300026041 Bacteria 3158
309 Ga0207639_10116674 3300026041 Bacteria 2186
310 Ga0207639_10168524 3300026041 Unclassified 1852
311 Ga0207678_10020096 3300026067 Bacteria 5866
312 Ga0207678_10448554 3300026067 Bacteria 1121
313 Ga0207702_10291757 3300026078 Bacteria 1545
314 Ga0207702_10697806 3300026078 Bacteria 1000
315 Ga0207702_10810299 3300026078 Bacteria 926
316 Ga0207641_10196924 3300026088 Bacteria 1855
317 Ga0207641_10217039 3300026088 Unclassified 1772
318 Ga0207641_11475271 3300026088 Bacteria 682
319 Ga0207648_10090349 3300026089 Bacteria 2676
320 Ga0207676_10103340 3300026095 Bacteria 2368
321 Ga0207674_10160942 3300026116 Bacteria 2199
322 Ga0207674_10194847 3300026116 Bacteria 1976
323 Ga0207675_100461791 3300026118 Bacteria 1260
324 Ga0207683_10061700 3300026121 Bacteria 3300
325 Ga0207683_10119901 3300026121 Bacteria 2361
326 Ga0207698_10210831 3300026142 Unclassified 1748
327 Ga0207698_10360050 3300026142 Bacteria 1377
328 Ga0207698_10440941 3300026142 Bacteria 1254
329 Ga0207698_10882300 3300026142 Bacteria 901
330 Ga0268264_10000013 3300028381 Bacteria 513859
331 Ga0307515_10001200 3300028794 Bacteria 59235
332 Ga0307515_10003151 3300028794 Bacteria 34898
333 Ga0265331_10039802 3300031250 Bacteria 2290
334 Ga0265327_10000090 3300031251 Bacteria 197158
335 Ga0307408_100122083 3300031548 Bacteria 2020
336 Ga0307516_10000750 3300031730 Bacteria 44208
337 Ga0307516_10108759 3300031730 Bacteria 2579
338 Ga0307413_10033480 3300031824 Bacteria 2927
339 Ga0307412_10000045 3300031911 Bacteria 165021
340 Ga0307412_10070427 3300031911 Bacteria 2384
341 Ga0307414_10010586 3300032004 Bacteria 5361
342 Ga0307414_10040587 3300032004 Bacteria 3145
343 Ga0307414_10065689 3300032004 Bacteria 2589
344 Ga0307414_10115768 3300032004 Bacteria 2051
345 Ga0307414_10263716 3300032004 Bacteria 1439
346 Ga0307414_10298692 3300032004 Unclassified 1361
347 Ga0307414_10303644 3300032004 Bacteria 1351
348 Ga0307414_10634199 3300032004 Unclassified 962
349 Ga0307414_10667733 3300032004 Unclassified 938
350 Ga0307414_11272229 3300032004 Bacteria 682
351 Ga0307411_10056388 3300032005 Unclassified 2590
352 Ga0307411_10272757 3300032005 Bacteria 1342
353 Ga0373934_0016371 3300035086 Unclassified 2819
354 Ga0373944_0007847 3300035089 Bacteria 2871
355 Ga0373956_0127892 3300035119 Unclassified 1188
356 Ga0373955_0004521 3300035172 Bacteria 6161
357 Ga0373931_0268863 3300035691 Bacteria 1043
358 Ga0373935_0301566 3300035692 Unclassified 1132
359 Ga0373937_0025749 3300036401 Bacteria 5312
360 Ga0395899_0001903 3300037312 Bacteria 17213
361 Ga0395899_0012217 3300037312 Bacteria 6576
362 Ga0395899_0041997 3300037312 Bacteria 3415
363 Ga0395899_0061562 3300037312 Bacteria 2764
364 Ga0395899_0442568 3300037312 Unclassified 852
365 Ga0395900_0013876 3300037418 Bacteria 8221
366 Ga0395900_0026980 3300037418 Bacteria 5879
367 Ga0395900_0090633 3300037418 Bacteria 3143
368 Ga0395900_0091633 3300037418 Bacteria 3123
369 Ga0395900_0115678 3300037418 Bacteria 2752
370 Ga0395900_0143693 3300037418 Bacteria 2442
371 Ga0395900_0301136 3300037418 Bacteria 1589
372 Ga0395900_0828972 3300037418 Unclassified 851
373 Ga0395898_0004173 3300037466 Bacteria 15834
374 Ga0395898_0009255 3300037466 Bacteria 10358
375 Ga0395898_0035789 3300037466 Bacteria 4933
376 Ga0395898_0167565 3300037466 Bacteria 2100
377 Ga0395898_0268033 3300037466 Bacteria 1628
378 Ga0395905_0042319 3300037471 Bacteria 4274
379 Ga0395905_0058304 3300037471 Bacteria 3611
380 Ga0395901_0003994 3300038443 Bacteria 14853
381 Ga0395901_0009401 3300038443 Bacteria 9917
382 Ga0436365_1894240 3300039437 Bacteria 1093
383 Ga0439449_0002155 3300042007 Bacteria 7733
384 Ga0439449_0103545 3300042007 Bacteria 1053
385 Ga0439457_011430 3300042014 Bacteria 2020
386 Ga0451577_0151015 3300042876 Bacteria 2090
387 Ga0451577_0771116 3300042876 Unclassified 869
388 Ga0451577_0787798 3300042876 Bacteria 859
389 Ga0453684_0032353 3300044712 Bacteria 7323
390 Ga0453684_0050912 3300044712 Bacteria 5439
391 Ga0453684_0053964 3300044712 Bacteria 5241
392 Ga0466957_0001781 3300044842 Bacteria 11334
393 Ga0466957_0002689 3300044842 Bacteria 9609
394 Ga0466958_0362497 3300045836 Bacteria 934
395 Ga0495627_004415 3300046453 Bacteria 5893
396 Ga0495592_0011274 3300046454 Bacteria 6760
397 Ga0495638_0016688 3300046460 Bacteria 4912
398 Ga0495651_0239135 3300046462 Unclassified 1246
399 Ga0495653_0042268 3300046463 Unclassified 3551
400 Ga0495607_0028541 3300046501 Bacteria 3443
401 Ga0495608_0025634 3300046511 Unclassified 4026
402 Ga0495616_0011798 3300046513 Bacteria 4987
403 Ga0495616_0019098 3300046513 Bacteria 3746
404 Ga0495618_0099137 3300046514 Bacteria 1865
405 Ga0495618_0100385 3300046514 Unclassified 1852
406 Ga0495628_0019796 3300046516 Bacteria 5559
407 Ga0495630_0007562 3300046517 Bacteria 7766
408 Ga0495648_0015092 3300046524 Bacteria 5624
409 Ga0495652_0186988 3300046529 Unclassified 1584
410 Ga0495586_0051333 3300046535 Unclassified 2232
411 Ga0495587_0057095 3300046536 Unclassified 2296
412 Ga0495633_0000004 3300046558 Bacteria 370781
413 Ga0495667_0197500 3300046559 Unclassified 1288
414 Ga0495668_0002355 3300046616 Bacteria 15721
415 Ga0495625_0000691 3300046660 Bacteria 48010
416 Ga0495625_0001578 3300046660 Bacteria 27104
417 Ga0495661_0001005 3300046665 Bacteria 25358
418 Ga0495661_0139314 3300046665 Bacteria 1321
419 Ga0495613_0063552 3300046689 Unclassified 2701
420 Ga0495660_0095480 3300046810 Bacteria 1538
421 Ga0495684_0079011 3300047471 Unclassified 2497
422 Ga0495686_0000587 3300047472 Bacteria 51313
423 Ga0495686_0001710 3300047472 Bacteria 22659
424 Ga0496114_0446753 3300048917 Bacteria 1145
425 Ga0496126_0026400 3300048929 Bacteria 5569
426 Ga0495678_028959 3300049459 Unclassified 2330
427 Ga0501292_039786 3300049515 Bacteria 810
428 Ga0501297_001068 3300049520 Bacteria 2484
429 Ga0501298_000346 3300049521 Bacteria 6235
430 Ga0501299_045468 3300049522 Unclassified 893
431 Ga0501032_0184106 3300049569 Bacteria 1367
432 Ga0501033_0279448 3300049570 Unclassified 1179
433 Ga0501034_0111372 3300049571 Bacteria 2728
434 Ga0501034_0128350 3300049571 Unclassified 2520
435 Ga0501043_0339018 3300049579 Bacteria 1144
436 Ga0501047_0183121 3300049581 Bacteria 1961
437 Ga0501070_0027986 3300049586 Bacteria 4728
438 Ga0501198_001007 3300049649 Bacteria 3582
439 Ga0501201_000681 3300049651 Bacteria 3182
440 Ga0501202_000315 3300049652 Bacteria 6676
441 Ga0501206_007700 3300049653 Bacteria 1415
442 Ga0501207_003285 3300049654 Bacteria 2147
443 Ga0501217_001445 3300049661 Bacteria 4452
444 Ga0501222_009889 3300049662 Bacteria 1260
445 Ga0501223_000249 3300049663 Bacteria 13787
446 Ga0501223_000445 3300049663 Bacteria 9968
447 Ga0501223_055728 3300049663 Bacteria 769
448 Ga0501227_012996 3300049665 Bacteria 1829
449 Ga0501233_003190 3300049668 Bacteria 2942
450 Ga0501253_004210 3300049683 Bacteria 1798
451 Ga0501257_017430 3300049686 Bacteria 1671
452 Ga0501257_029647 3300049686 Bacteria 1315
453 Ga0501219_000018 3300049703 Bacteria 25770
454 Ga0501221_000242 3300049704 Bacteria 7912
455 Ga0501225_0000825 3300049705 Bacteria 9637
456 Ga0501225_0024564 3300049705 Unclassified 1659
457 Ga0501234_009583 3300049707 Bacteria 1512
458 Ga0501241_001740 3300049758 Bacteria 4326
459 Ga0501266_027792 3300049763 Bacteria 796
460 Ga0501268_043475 3300049765 Bacteria 852
461 Ga0501273_030021 3300049770 Bacteria 770
462 Ga0501275_013429 3300049772 Bacteria 917
463 Ga0501276_018010 3300049773 Bacteria 654
464 Ga0501035_0033880 3300049822 Unclassified 4643
465 Ga0501035_0161692 3300049822 Bacteria 1938
466 Ga0501035_0165947 3300049822 Bacteria 1910
467 Ga0501035_0414636 3300049822 Bacteria 1119
468 Ga0501044_0245633 3300049823 Bacteria 1733
469 Ga0501044_0731405 3300049823 Unclassified 873
470 Ga0501044_1035178 3300049823 Bacteria 692
471 Ga0501284_00010 3300050005 Bacteria 136120
472 nmdc:mga0k408_168_c2 3300050493 Bacteria 27329
473 nmdc:mga0k408_50701_c2 3300050493 Unclassified 1886
474 nmdc:mga0k408_83_c1 3300050493 Bacteria 44610
475 nmdc:mga09592_553549_c1 3300050508 Bacteria 988
476 nmdc:mga08y16_1338781_c1 3300050511 Bacteria 681
477 nmdc:mga08y16_224793_c1 3300050511 Bacteria 1942
478 nmdc:mga08y16_328190_c1 3300050511 Bacteria 1574
479 Ga0500646_0005478 3300053090 Bacteria 3210
480 Ga0500641_0000102 3300053096 Bacteria 33019
481 Ga0500561_0074546 3300053137 Unclassified 977
482 Ga0500622_0002517 3300053156 Bacteria 13158
483 Ga0500622_0003157 3300053156 Bacteria 11268
484 Ga0500637_0073082 3300053178 Bacteria 1974
485 Ga0500584_035009 3300053726 Bacteria 2322
486 Ga0466962_0062932 3300061719 Bacteria 1772
487 2587749304 2585428060 Bacteria 5304711
488 2588446690 2588253712 Bacteria 5403181
489 2738734554 2738541279 Bacteria 6149495
490 2738767313 2738541285 Bacteria 6150075
491 2739216136 2738543007 Bacteria 6149845
492 2910247339 2910245624 Bacteria 6935613
493 Ga0307415_100049326
494 rootH2_10059655
495 rootL2_10047565
496 rootL2_10060049
497 rootL2_10066252
498 rootL2_10119527
499 rootL2_10269286
500 rootH1_10068010
501 rootH1_10201698
502 Ga0055531_10000547
503 Ga0055543_1032052
504 Ga0065165_1000783
505 Ga0065714_10005223
506 Ga0065714_10141957
507 Ga0065704_10000434
508 Ga0065707_10279509
509 Ga0070658_10018091
510 Ga0070658_10073166
511 Ga0070658_10349552
512 Ga0070658_10493979
513 Ga0070658_10989651
514 Ga0070676_10160171
515 Ga0070683_100194082
516 Ga0070683_100238624
517 Ga0070683_100397718
518 Ga0070690_100004064
519 Ga0070690_100074283
520 Ga0070670_100067183
521 Ga0070670_100548416
522 Ga0070677_10029966
523 Ga0070677_10206131
524 Ga0068869_100025882
525 Ga0068869_100170529
526 Ga0070666_10086777
527 Ga0070666_10494669
528 Ga0070680_100044464
529 Ga0070680_100055428
530 Ga0070680_100196788
531 Ga0070682_100042786
532 Ga0070682_100492581
533 Ga0068868_100078830
534 Ga0068868_100608702
535 Ga0070660_100023659
536 Ga0070660_100030483
537 Ga0070660_100032498
538 Ga0070660_100040290
539 Ga0070660_100489035
540 Ga0070660_100890760
541 Ga0070689_100255521
542 Ga0070661_100346230
543 Ga0070661_100666069
544 Ga0070668_100950148
545 Ga0070669_101279287
546 Ga0070675_100035329
547 Ga0070675_100106859
548 Ga0070675_100944169
549 Ga0070671_100056337
550 Ga0070674_100344086
551 Ga0070674_100714547
552 Ga0070673_100071639
553 Ga0070673_100239540
554 Ga0070659_100004616
555 Ga0070659_100040009
556 Ga0070667_100028100
557 Ga0070701_10066530
558 Ga0070700_100425656
559 Ga0070678_100020105
560 Ga0070678_100048430
561 Ga0070678_100850488
562 Ga0070681_10017834
563 Ga0070681_10053622
564 Ga0070681_10094742
565 Ga0070681_10170269
566 Ga0068867_100268461
567 Ga0068867_100832229
568 Ga0070685_10103462
569 Ga0070679_100008912
570 Ga0070679_100033073
571 Ga0070679_100038687
572 Ga0070679_100062854
573 Ga0070679_100127702
574 Ga0070679_100166661
575 Ga0070679_100667278
576 Ga0070684_100089178
577 Ga0068853_100084514
578 Ga0068853_100304675
579 Ga0068853_100682633
580 Ga0068853_100866113
581 Ga0070672_100202181
582 Ga0070672_100243346
583 Ga0070672_100593137
584 Ga0070686_100012608
585 Ga0070686_100107660
586 Ga0070686_100144421
587 Ga0070696_100991432
588 Ga0070665_100521532
589 Ga0068855_100002929
590 Ga0068855_100016232
591 Ga0068855_100026613
592 Ga0068855_100698194
593 Ga0068855_100884616
594 Ga0070664_100076806
595 Ga0070664_100577575
596 Ga0070664_100594217
597 Ga0068857_100358914
598 Ga0068857_100651302
599 Ga0068854_100061147
600 Ga0068854_100094985
601 Ga0068856_100033276
602 Ga0068856_100859106
603 Ga0068856_101175719
604 Ga0070702_100064973
605 Ga0068852_100002674
606 Ga0068852_100094203
607 Ga0068852_100253275
608 Ga0068852_100294431
609 Ga0068852_100454428
610 Ga0068866_10575850
611 Ga0068861_100326670
612 Ga0068861_101171396
613 Ga0068851_10151404
614 Ga0068863_100174387
615 Ga0068863_100374239
616 Ga0068858_100181258
617 Ga0068858_101186595
618 Ga0068860_100000103
619 Ga0070715_10148234
620 Ga0075366_10000267
621 Ga0075366_10002159
622 Ga0075366_10280698
623 Ga0097621_100417583
624 Ga0097621_100431744
625 Ga0097621_100945807
626 Ga0068871_100048524
627 Ga0068871_100649874
628 Ga0068871_101149623
629 Ga0075429_100595884
630 Ga0068865_100442794
631 Ga0105240_10031537
632 Ga0105240_10149391
633 Ga0111539_10162815
634 Ga0111539_11024817
635 Ga0105241_10006659
636 Ga0105241_10557929
637 Ga0105242_10034759
638 Ga0105242_10096908
639 Ga0105242_10849262
640 Ga0105248_10478351
641 Ga0105237_10034528
642 Ga0105239_10025624
643 Ga0105239_10088742
644 Ga0105239_10346824
645 Ga0105246_10131740
646 Ga0157373_10000715
647 Ga0157373_10000773
648 Ga0157373_10009211
649 Ga0157373_10013271
650 Ga0157373_10061230
651 Ga0157373_10137532
652 Ga0157373_10176881
653 Ga0157371_10000584
654 Ga0157371_10001101
655 Ga0157371_10001748
656 Ga0157371_10005044
657 Ga0157371_10038391
658 Ga0157371_10061701
659 Ga0157371_10125654
660 Ga0157371_10312601
661 Ga0157371_10336716
662 Ga0157370_10000821
663 Ga0157370_10003789
664 Ga0157370_10012968
665 Ga0157370_10067444
666 Ga0157370_10118858
667 Ga0157370_10126713
668 Ga0157370_10434975
669 Ga0157370_10475696
670 Ga0157369_10000403
671 Ga0157369_10003166
672 Ga0157369_10007205
673 Ga0157369_10045270
674 Ga0157369_10190657
675 Ga0157369_10452867
676 Ga0157369_10457844
677 Ga0157374_10090571
678 Ga0157374_10243555
679 Ga0157374_11183470
680 Ga0157378_10005693
681 Ga0157378_10669740
682 Ga0163162_10000269
683 Ga0163162_10006296
684 Ga0163162_10037892
685 Ga0163162_10151838
686 Ga0163162_10276104
687 Ga0157372_10001337
688 Ga0157372_10008116
689 Ga0157372_10049206
690 Ga0157372_10050140
691 Ga0157372_10086712
692 Ga0157372_10113843
693 Ga0157372_10166304
694 Ga0157372_10225668
695 Ga0157372_10267520
696 Ga0157372_10410370
697 Ga0157372_10787987
698 Ga0157372_11760341
699 Ga0157372_12005635
700 Ga0157375_10069107
701 Ga0157375_10114919
702 Ga0157375_10208838
703 Ga0157375_11272453
704 Ga0163163_10200698
705 Ga0157380_10170542
706 Ga0157380_10678250
707 Ga0157380_10929981
708 Ga0157377_10099110
709 Ga0157377_10522961
710 Ga0157379_10151750
711 Ga0157376_10100219
712 Ga0157376_10658249
713 Ga0157376_11406742
714 Ga0182006_1015245
715 Ga0163161_10036180
716 Ga0163161_10396689
717 Ga0209257_1000008
718 Ga0207682_10034226
719 Ga0207642_10760752
720 Ga0207688_10046406
721 Ga0207680_10164704
722 Ga0207647_10073242
723 Ga0207647_10221644
724 Ga0207645_10034054
725 Ga0207645_10061658
726 Ga0207643_10140691
727 Ga0207643_10320118
728 Ga0207705_10015359
729 Ga0207705_10042401
730 Ga0207705_10052154
731 Ga0207705_10250331
732 Ga0207705_10522677
733 Ga0207705_10541175
734 Ga0207705_10561211
735 Ga0207654_10016950
736 Ga0207707_10035725
737 Ga0207707_10068590
738 Ga0207707_10226888
739 Ga0207707_10544497
740 Ga0207707_10567092
741 Ga0207695_10202691
742 Ga0207695_10208185
743 Ga0207695_10317856
744 Ga0207671_10004239
745 Ga0207671_10346423
746 Ga0207660_10046533
747 Ga0207660_10047899
748 Ga0207660_10537056
749 Ga0207662_10025357
750 Ga0207657_10016002
751 Ga0207657_10023224
752 Ga0207657_10035971
753 Ga0207657_10048764
754 Ga0207657_10124824
755 Ga0207652_10000103
756 Ga0207652_10002216
757 Ga0207652_10098138
758 Ga0207652_10121463
759 Ga0207652_10253855
760 Ga0207652_10257070
761 Ga0207652_10394030
762 Ga0207652_10519489
763 Ga0207650_10125637
764 Ga0207650_10250600
765 Ga0207650_10782145
766 Ga0207659_10442261
767 Ga0207659_10537890
768 Ga0207659_10717334
769 Ga0207644_10133843
770 Ga0207690_10128733
771 Ga0207690_10138474
772 Ga0207690_10393525
773 Ga0207706_10025883
774 Ga0207706_10309015
775 Ga0207686_10095357
776 Ga0207670_10699279
777 Ga0207669_10135868
778 Ga0207704_10205299
779 Ga0207691_10058041
780 Ga0207691_10299610
781 Ga0207691_10316119
782 Ga0207691_11007321
783 Ga0207689_10215436
784 Ga0207689_10450182
785 Ga0207689_10879480
786 Ga0207661_10126202
787 Ga0207661_10370493
788 Ga0207667_10010940
789 Ga0207667_10147754
790 Ga0207667_10223496
791 Ga0207667_10465676
792 Ga0207667_10893091
793 Ga0207667_11040786
794 Ga0207651_10145319
795 Ga0207651_10168227
796 Ga0207712_10923977
797 Ga0207640_10071303
798 Ga0207640_10107647
799 Ga0207703_10160187
800 Ga0207639_10050543
801 Ga0207639_10116674
802 Ga0207639_10168524
803 Ga0207678_10020096
804 Ga0207678_10448554
805 Ga0207702_10291757
806 Ga0207702_10697806
807 Ga0207702_10810299
808 Ga0207641_10196924
809 Ga0207641_10217039
810 Ga0207641_11475271
811 Ga0207648_10090349
812 Ga0207676_10103340
813 Ga0207674_10160942
814 Ga0207674_10194847
815 Ga0207675_100461791
816 Ga0207683_10061700
817 Ga0207683_10119901
818 Ga0207698_10210831
819 Ga0207698_10360050
820 Ga0207698_10440941
821 Ga0207698_10882300
822 Ga0268264_10000013
823 Ga0307515_10001200
824 Ga0307515_10003151
825 Ga0265331_10039802
826 Ga0265327_10000090
827 Ga0307408_100122083
828 Ga0307516_10000750
829 Ga0307516_10108759
830 Ga0307413_10033480
831 Ga0307412_10000045
832 Ga0307412_10070427
833 Ga0307414_10010586
834 Ga0307414_10040587
835 Ga0307414_10065689
836 Ga0307414_10115768
837 Ga0307414_10263716
838 Ga0307414_10298692
839 Ga0307414_10303644
840 Ga0307414_10634199
841 Ga0307414_10667733
842 Ga0307414_11272229
843 Ga0307411_10056388
844 Ga0307411_10272757
845 Ga0373934_0016371
846 Ga0373944_0007847
847 Ga0373956_0127892
848 Ga0373955_0004521
849 Ga0373931_0268863
850 Ga0373935_0301566
851 Ga0373937_0025749
852 Ga0395899_0001903
853 Ga0395899_0012217
854 Ga0395899_0041997
855 Ga0395899_0061562
856 Ga0395899_0442568
857 Ga0395900_0013876
858 Ga0395900_0026980
859 Ga0395900_0090633
860 Ga0395900_0091633
861 Ga0395900_0115678
862 Ga0395900_0143693
863 Ga0395900_0301136
864 Ga0395900_0828972
865 Ga0395898_0004173
866 Ga0395898_0009255
867 Ga0395898_0035789
868 Ga0395898_0167565
869 Ga0395898_0268033
870 Ga0395905_0042319
871 Ga0395905_0058304
872 Ga0395901_0003994
873 Ga0395901_0009401
874 Ga0436365_1894240
875 Ga0439449_0002155
876 Ga0439449_0103545
877 Ga0439457_011430
878 Ga0451577_0151015
879 Ga0451577_0771116
880 Ga0451577_0787798
881 Ga0453684_0032353
882 Ga0453684_0050912
883 Ga0453684_0053964
884 Ga0466957_0001781
885 Ga0466957_0002689
886 Ga0466958_0362497
887 Ga0495627_004415
888 Ga0495592_0011274
889 Ga0495638_0016688
890 Ga0495651_0239135
891 Ga0495653_0042268
892 Ga0495607_0028541
893 Ga0495608_0025634
894 Ga0495616_0011798
895 Ga0495616_0019098
896 Ga0495618_0099137
897 Ga0495618_0100385
898 Ga0495628_0019796
899 Ga0495630_0007562
900 Ga0495648_0015092
901 Ga0495652_0186988
902 Ga0495586_0051333
903 Ga0495587_0057095
904 Ga0495633_0000004
905 Ga0495667_0197500
906 Ga0495668_0002355
907 Ga0495625_0000691
908 Ga0495625_0001578
909 Ga0495661_0001005
910 Ga0495661_0139314
911 Ga0495613_0063552
912 Ga0495660_0095480
913 Ga0495684_0079011
914 Ga0495686_0000587
915 Ga0495686_0001710
916 Ga0496114_0446753
917 Ga0496126_0026400
918 Ga0495678_028959
919 Ga0501292_039786
920 Ga0501297_001068
921 Ga0501298_000346
922 Ga0501299_045468
923 Ga0501032_0184106
924 Ga0501033_0279448
925 Ga0501034_0111372
926 Ga0501034_0128350
927 Ga0501043_0339018
928 Ga0501047_0183121
929 Ga0501070_0027986
930 Ga0501198_001007
931 Ga0501201_000681
932 Ga0501202_000315
933 Ga0501206_007700
934 Ga0501207_003285
935 Ga0501217_001445
936 Ga0501222_009889
937 Ga0501223_000249
938 Ga0501223_000445
939 Ga0501223_055728
940 Ga0501227_012996
941 Ga0501233_003190
942 Ga0501253_004210
943 Ga0501257_017430
944 Ga0501257_029647
945 Ga0501219_000018
946 Ga0501221_000242
947 Ga0501225_0000825
948 Ga0501225_0024564
949 Ga0501234_009583
950 Ga0501241_001740
951 Ga0501266_027792
952 Ga0501268_043475
953 Ga0501273_030021
954 Ga0501275_013429
955 Ga0501276_018010
956 Ga0501035_0033880
957 Ga0501035_0161692
958 Ga0501035_0165947
959 Ga0501035_0414636
960 Ga0501044_0245633
961 Ga0501044_0731405
962 Ga0501044_1035178
963 Ga0501284_00010
964 nmdc:mga0k408_168_c2
965 nmdc:mga0k408_50701_c2
966 nmdc:mga0k408_83_c1
967 nmdc:mga09592_553549_c1
968 nmdc:mga08y16_1338781_c1
969 nmdc:mga08y16_224793_c1
970 nmdc:mga08y16_328190_c1
971 Ga0500646_0005478
972 Ga0500641_0000102
973 Ga0500561_0074546
974 Ga0500622_0002517
975 Ga0500622_0003157
976 Ga0500637_0073082
977 Ga0500584_035009
978 Ga0466962_0062932
979 2587749304
980 2588446690
981 2738734554
982 2738767313
983 2739216136
984 2910247339

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00027

cNMP_binding

Cyclic nucleotide-binding domain

48

137

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3dn7-assembly1.cif.gz_A cyclic nucleotide binding regulatory protein from cytophaga hutchinsonii. 0.9554 1 137
3dn7-assembly1.cif.gz_A cyclic nucleotide binding regulatory protein from cytophaga hutchinsonii. 0.8925 1 137
3i54-assembly2.cif.gz_C crystal structure of mtbcrp in complex with camp 0.8878 20 192
5cvr-assembly1.cif.gz_A-2 crystal structure of fnr of a. fischeri in a partially degraded form 0.8725 28 192
4cyd-assembly2.cif.gz_A glxr bound to camp 0.8704 8 192
ID Description Score Start End Superfamily
3dn7A00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9574 3 137 2.60.120.10
3dn7A00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8931 3 137 2.60.120.10
af_P9WQK5_226_324_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8882 28 115 2.60.120.10
5cvrA01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8754 28 147 2.60.120.10
3i54C01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8563 20 147 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A173MGJ9-F1-model_v4 cAMP-binding domain of CRP or a regulatory subunit of cAMP-dependent protein kinases 0.983 2 192 GO:0016301
AF-A0A1I5KK45-F1-model_v4 cAMP-binding domain of CRP or a regulatory subunit of cAMP-dependent protein kinases 0.9827 2 188 GO:0016301
AF-A0A0F9NUW1-F1-model_v4 Cyclic nucleotide-binding domain-containing protein 0.9821 1 187
AF-A0A318VBC8-F1-model_v4 deleted 0.9818 15 187
AF-A0A4U1BWR1-F1-model_v4 Crp/Fnr family transcriptional regulator 0.9816 1 192

Map