F454294

General Info

Members Datasets Scaffolds Average Seq Length
492 320 984 210

Family's Representative Sequence

Representative Sequence 3300037312|Ga0395899_0016980|Ga0395899_0016980_4362_5063
Length 216
Sequence MLDLRWKHRAVARAGRPSFRFAALAVSALMLSGCGGGSMFGGTQASQDSPSLSSRFSQLFGSNSQPATTAVTIRSGASTYAVGAPGKEATGNDLRYQATIVRTARDCTLNDGQVTARIGIEGRVIVGPAGAPASVEVPLRIAVVQSGVGEEKTIFTKAYRTTVTMQGDSTMSFSLVAEDVVYPAPSAAVGDSYVFYIGFDPQALRPEPRRRSHRKR

Samples

Sample ID Description Type Environment
1 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
52 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
53 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
54 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
55 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
56 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
57 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
58 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
59 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
60 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
61 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
70 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
71 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
72 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
84 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
85 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
92 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
93 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
94 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
95 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
96 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
146 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
147 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
148 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
152 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
153 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
154 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
155 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
156 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
157 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
158 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
159 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
160 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
161 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
162 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
163 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
164 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
165 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
166 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
167 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
168 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
169 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
170 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
171 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
172 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
173 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
174 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
175 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
176 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
177 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
178 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
179 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
180 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
181 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
182 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
183 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
184 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
185 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
186 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
187 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
188 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
189 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
190 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
191 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
192 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
193 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
194 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
195 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
196 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
197 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
198 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
199 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
200 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
201 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
202 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
203 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
204 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
205 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
206 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
207 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
208 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
209 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
210 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
211 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
212 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
213 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
214 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
215 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
216 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
217 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
218 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
219 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
220 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
221 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
222 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
223 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
224 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
225 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
226 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
227 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
228 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
229 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
230 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
231 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
232 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
238 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
239 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
240 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
241 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
242 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
243 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
244 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
245 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
247 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
248 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
249 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
250 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
251 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
252 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
253 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
254 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
255 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
256 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
257 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
258 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
259 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
260 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
261 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
262 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
263 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
264 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
265 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
266 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
267 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
268 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
269 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
270 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
271 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
272 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
273 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
274 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
275 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
276 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
277 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
278 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
279 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
280 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
281 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
282 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
283 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
284 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
285 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
286 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
287 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
288 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
289 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
290 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
291 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
292 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
293 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
294 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
295 2791355199
296 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
297 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
298 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
299 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
300 2904699407
301 2906610324
302 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
303 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
304 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
305 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
306 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
307 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
308 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
309 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
310 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
311 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
312 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
313 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
314 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
315 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
316 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
317 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
318 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
319 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
320 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 93.66
Metatranscriptomes 0
Isolates 6.34

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.2
Nodule 6.1
Rhizoplane 5.69
Rhizosphere 68.9
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395899_0016980 3300037312 Bacteria 5547
2 JGI25153J46596_10003994 3300003215 Bacteria 8063
3 Ga0070658_10059664 3300005327 Bacteria 3107
4 Ga0070658_10231797 3300005327 Bacteria 1563
5 Ga0070683_100069952 3300005329 Bacteria 3273
6 Ga0070690_100060089 3300005330 Bacteria 2445
7 Ga0068869_100250776 3300005334 Bacteria 1413
8 Ga0068869_100332593 3300005334 Bacteria 1234
9 Ga0070682_100021957 3300005337 Bacteria 3773
10 Ga0070682_100423025 3300005337 Bacteria 1013
11 Ga0068868_100011153 3300005338 Bacteria 6543
12 Ga0068868_100088304 3300005338 Bacteria 2495
13 Ga0070660_100001273 3300005339 Bacteria 17200
14 Ga0070661_100065195 3300005344 Bacteria 2676
15 Ga0070661_100066992 3300005344 Bacteria 2639
16 Ga0070668_100249018 3300005347 Bacteria 1474
17 Ga0070668_100328877 3300005347 Bacteria 1288
18 Ga0070668_100378959 3300005347 Bacteria 1203
19 Ga0070669_100048887 3300005353 Bacteria 3088
20 Ga0070671_100523178 3300005355 Bacteria 1021
21 Ga0070671_100799545 3300005355 Bacteria 821
22 Ga0070674_100576186 3300005356 Bacteria 948
23 Ga0070673_100162224 3300005364 Bacteria 1902
24 Ga0070688_100523617 3300005365 Bacteria 898
25 Ga0070659_100252581 3300005366 Bacteria 1462
26 Ga0070659_100678093 3300005366 Bacteria 890
27 Ga0070703_10023738 3300005406 Bacteria 1808
28 Ga0070709_10195067 3300005434 Bacteria 1431
29 Ga0070700_100020038 3300005441 Bacteria 3868
30 Ga0070694_100075569 3300005444 Bacteria 2330
31 Ga0070663_100034674 3300005455 Bacteria 3496
32 Ga0070663_100184180 3300005455 Bacteria 1622
33 Ga0070663_100238823 3300005455 Bacteria 1433
34 Ga0070678_100015032 3300005456 Bacteria 4904
35 Ga0070678_100037737 3300005456 Bacteria 3395
36 Ga0070678_100122294 3300005456 Bacteria 2054
37 Ga0070678_100331057 3300005456 Bacteria 1303
38 Ga0070681_10002300 3300005458 Bacteria 17486
39 Ga0070681_10056597 3300005458 Bacteria 3902
40 Ga0068867_100085834 3300005459 Bacteria 2380
41 Ga0068867_100450451 3300005459 Bacteria 1096
42 Ga0070706_100700063 3300005467 Bacteria 940
43 Ga0070699_100071253 3300005518 Bacteria 3022
44 Ga0070679_100030870 3300005530 Bacteria 5294
45 Ga0070679_100158656 3300005530 Bacteria 2236
46 Ga0070684_100141140 3300005535 Bacteria 2179
47 Ga0070697_100067843 3300005536 Bacteria 2919
48 Ga0068853_100005373 3300005539 Bacteria 10031
49 Ga0068853_100036024 3300005539 Bacteria 4205
50 Ga0068853_100076145 3300005539 Bacteria 2929
51 Ga0068853_100641338 3300005539 Bacteria 1011
52 Ga0070672_100634354 3300005543 Bacteria 932
53 Ga0070686_100086379 3300005544 Bacteria 2088
54 Ga0070696_100073267 3300005546 Bacteria 2413
55 Ga0070693_100277185 3300005547 Bacteria 1122
56 Ga0070665_100048597 3300005548 Bacteria 4258
57 Ga0070665_100062798 3300005548 Bacteria 3724
58 Ga0070665_100070223 3300005548 Bacteria 3509
59 Ga0070665_100082821 3300005548 Bacteria 3213
60 Ga0070665_100140823 3300005548 Bacteria 2415
61 Ga0070665_100396164 3300005548 Bacteria 1388
62 Ga0068855_100005358 3300005563 Bacteria 15645
63 Ga0068855_100044590 3300005563 Bacteria 5248
64 Ga0070664_100183552 3300005564 Bacteria 1861
65 Ga0068854_100210869 3300005578 Bacteria 1532
66 Ga0070702_100080093 3300005615 Bacteria 1953
67 Ga0070702_100454386 3300005615 Bacteria 930
68 Ga0068852_100103263 3300005616 Bacteria 2578
69 Ga0068852_100145672 3300005616 Bacteria 2197
70 Ga0068859_100231938 3300005617 Bacteria 1934
71 Ga0068859_100427707 3300005617 Bacteria 1420
72 Ga0068864_100176927 3300005618 Bacteria 1948
73 Ga0068864_100202594 3300005618 Bacteria 1824
74 Ga0068864_100839496 3300005618 Bacteria 905
75 Ga0068866_10088355 3300005718 Bacteria 1682
76 Ga0068866_10098244 3300005718 Bacteria 1610
77 Ga0068861_100196198 3300005719 Bacteria 1691
78 Ga0068861_100665566 3300005719 Bacteria 963
79 Ga0068851_10009508 3300005834 Bacteria 4523
80 Ga0068851_10052276 3300005834 Bacteria 2077
81 Ga0068851_10374621 3300005834 Bacteria 833
82 Ga0068863_100545553 3300005841 Bacteria 1144
83 Ga0068858_100609314 3300005842 Bacteria 1059
84 Ga0068858_100776506 3300005842 Bacteria 934
85 Ga0068860_100169048 3300005843 Bacteria 2111
86 Ga0068860_100240872 3300005843 Bacteria 1759
87 Ga0068860_100340110 3300005843 Bacteria 1475
88 Ga0068862_100139939 3300005844 Bacteria 2147
89 Ga0068862_100170299 3300005844 Bacteria 1949
90 Ga0068862_100494017 3300005844 Bacteria 1160
91 Ga0068862_100710265 3300005844 Bacteria 974
92 Ga0081455_10010629 3300005937 Bacteria 9315
93 Ga0081455_10109991 3300005937 Bacteria 2192
94 Ga0081538_10009617 3300005981 Bacteria 8042
95 Ga0081538_10089241 3300005981 Bacteria 1601
96 Ga0081540_1001861 3300005983 Bacteria 17661
97 Ga0081540_1013564 3300005983 Bacteria 5289
98 Ga0075365_10197691 3300006038 Bacteria 1408
99 Ga0075365_10392852 3300006038 Bacteria 979
100 Ga0075363_100054319 3300006048 Bacteria 2142
101 Ga0075364_10107079 3300006051 Bacteria 1863
102 Ga0075364_10124416 3300006051 Bacteria 1728
103 Ga0070716_100104884 3300006173 Bacteria 1741
104 Ga0070716_100472786 3300006173 Bacteria 919
105 Ga0070712_100026520 3300006175 Bacteria 3861
106 Ga0075362_10091768 3300006177 Bacteria 1410
107 Ga0075367_10170484 3300006178 Bacteria 1356
108 Ga0075366_10072355 3300006195 Bacteria 2054
109 Ga0075366_10299535 3300006195 Bacteria 983
110 Ga0097621_100226381 3300006237 Bacteria 1631
111 Ga0075370_10053511 3300006353 Bacteria 2291
112 Ga0068871_100083955 3300006358 Bacteria 2642
113 Ga0075434_100174976 3300006871 Bacteria 2166
114 Ga0075429_100223331 3300006880 Bacteria 1650
115 Ga0068865_100015653 3300006881 Bacteria 4839
116 Ga0068865_100278115 3300006881 Bacteria 1332
117 Ga0068865_100560467 3300006881 Bacteria 961
118 Ga0097620_100231939 3300006931 Bacteria 1934
119 Ga0097620_100427693 3300006931 Bacteria 1420
120 Ga0099824_1015040 3300006942 Bacteria 7478
121 Ga0099822_1010518 3300006943 Bacteria 11468
122 Ga0075435_100021255 3300007076 Bacteria 4987
123 Ga0105250_10014308 3300009092 Bacteria 3263
124 Ga0105240_10320608 3300009093 Bacteria 1767
125 Ga0105245_10100772 3300009098 Bacteria 2672
126 Ga0105245_10506177 3300009098 Bacteria 1224
127 Ga0114129_10040150 3300009147 Bacteria 6597
128 Ga0114129_11227592 3300009147 Bacteria 932
129 Ga0105243_10027662 3300009148 Bacteria 4347
130 Ga0105243_10911253 3300009148 Bacteria 875
131 Ga0105242_10036976 3300009176 Bacteria 3920
132 Ga0105248_10102575 3300009177 Bacteria 3225
133 Ga0105248_10356795 3300009177 Bacteria 1646
134 Ga0105237_10020603 3300009545 Bacteria 6795
135 Ga0105237_10438618 3300009545 Bacteria 1312
136 Ga0105238_10004261 3300009551 Bacteria 14208
137 Ga0105238_10202754 3300009551 Bacteria 1959
138 Ga0105238_10269960 3300009551 Bacteria 1681
139 Ga0105238_10291049 3300009551 Bacteria 1615
140 Ga0105239_10320404 3300010375 Bacteria 1748
141 Ga0105239_10339080 3300010375 Bacteria 1696
142 Ga0105239_10671519 3300010375 Bacteria 1184
143 Ga0105246_10041285 3300011119 Bacteria 3117
144 Ga0105246_10200517 3300011119 Bacteria 1551
145 Ga0105246_10490969 3300011119 Bacteria 1041
146 Ga0157373_10066140 3300013100 Bacteria 2558
147 Ga0157370_10079923 3300013104 Bacteria 3079
148 Ga0157370_10117750 3300013104 Bacteria 2481
149 Ga0157370_10203042 3300013104 Bacteria 1838
150 Ga0157369_10019281 3300013105 Bacteria 7631
151 Ga0157369_10075325 3300013105 Bacteria 3619
152 Ga0157374_10031569 3300013296 Bacteria 4816
153 Ga0157374_11093085 3300013296 Bacteria 818
154 Ga0163162_10046887 3300013306 Bacteria 4332
155 Ga0163162_10052853 3300013306 Bacteria 4081
156 Ga0163162_11038605 3300013306 Bacteria 927
157 Ga0157372_11491101 3300013307 Bacteria 779
158 Ga0157372_11537174 3300013307 Bacteria 766
159 Ga0157375_10008463 3300013308 Bacteria 9010
160 Ga0163163_10155735 3300014325 Bacteria 2329
161 Ga0163163_10384082 3300014325 Bacteria 1462
162 Ga0163163_10425528 3300014325 Bacteria 1387
163 Ga0157380_10452792 3300014326 Bacteria 1233
164 Ga0157379_10107985 3300014968 Bacteria 2499
165 Ga0157379_10158744 3300014968 Bacteria 2041
166 Ga0157379_11074232 3300014968 Bacteria 770
167 Ga0157376_10005234 3300014969 Bacteria 9057
168 Ga0157376_10467364 3300014969 Bacteria 1234
169 Ga0163161_10054089 3300017792 Bacteria 2913
170 Ga0163161_10721588 3300017792 Bacteria 831
171 Ga0163161_10793793 3300017792 Bacteria 795
172 Ga0209758_1002609 3300025297 Bacteria 17979
173 Ga0209758_1019604 3300025297 Bacteria 3252
174 Ga0207653_10003808 3300025885 Bacteria 4748
175 Ga0207692_10448178 3300025898 Bacteria 812
176 Ga0207710_10063204 3300025900 Bacteria 1684
177 Ga0207688_10016649 3300025901 Bacteria 3991
178 Ga0207688_10074489 3300025901 Bacteria 1931
179 Ga0207680_10331433 3300025903 Bacteria 1066
180 Ga0207705_10088792 3300025909 Bacteria 2261
181 Ga0207705_10123193 3300025909 Bacteria 1925
182 Ga0207705_10335198 3300025909 Bacteria 1164
183 Ga0207654_10047544 3300025911 Bacteria 2452
184 Ga0207707_10001937 3300025912 Bacteria 18825
185 Ga0207695_10262880 3300025913 Bacteria 1623
186 Ga0207671_10415571 3300025914 Bacteria 1070
187 Ga0207693_10045819 3300025915 Bacteria 3436
188 Ga0207663_10011973 3300025916 Bacteria 4674
189 Ga0207660_10002941 3300025917 Bacteria 11135
190 Ga0207662_10340778 3300025918 Bacteria 1004
191 Ga0207657_10001268 3300025919 Bacteria 26929
192 Ga0207657_10006639 3300025919 Bacteria 11976
193 Ga0207657_10247785 3300025919 Bacteria 1421
194 Ga0207657_10301192 3300025919 Bacteria 1270
195 Ga0207649_10089883 3300025920 Bacteria 2008
196 Ga0207649_10158150 3300025920 Bacteria 1568
197 Ga0207652_10001009 3300025921 Bacteria 25962
198 Ga0207652_10182467 3300025921 Bacteria 1886
199 Ga0207652_10209178 3300025921 Bacteria 1756
200 Ga0207681_10297866 3300025923 Bacteria 1275
201 Ga0207694_10005039 3300025924 Bacteria 10219
202 Ga0207694_10149529 3300025924 Bacteria 1881
203 Ga0207694_10560006 3300025924 Bacteria 960
204 Ga0207687_10028927 3300025927 Bacteria 3725
205 Ga0207687_10049173 3300025927 Bacteria 2931
206 Ga0207687_10061296 3300025927 Bacteria 2656
207 Ga0207644_10822298 3300025931 Bacteria 777
208 Ga0207690_10162530 3300025932 Bacteria 1666
209 Ga0207706_10087558 3300025933 Bacteria 2739
210 Ga0207709_10070269 3300025935 Bacteria 2220
211 Ga0207709_10157456 3300025935 Bacteria 1580
212 Ga0207669_10004480 3300025937 Bacteria 6157
213 Ga0207669_10078473 3300025937 Bacteria 2104
214 Ga0207669_10475353 3300025937 Bacteria 995
215 Ga0207704_10546070 3300025938 Bacteria 941
216 Ga0207704_10626181 3300025938 Bacteria 884
217 Ga0207665_10031648 3300025939 Bacteria 3501
218 Ga0207691_10024728 3300025940 Bacteria 5647
219 Ga0207691_10505133 3300025940 Bacteria 1027
220 Ga0207711_10168389 3300025941 Bacteria 1987
221 Ga0207689_10237757 3300025942 Bacteria 1505
222 Ga0207689_10595226 3300025942 Bacteria 930
223 Ga0207661_10104970 3300025944 Bacteria 2380
224 Ga0207679_10074372 3300025945 Bacteria 2574
225 Ga0207667_10045105 3300025949 Bacteria 4669
226 Ga0207667_10056584 3300025949 Bacteria 4119
227 Ga0207667_10142266 3300025949 Bacteria 2470
228 Ga0207712_10034939 3300025961 Bacteria 3410
229 Ga0207668_10019194 3300025972 Bacteria 4315
230 Ga0207668_10037062 3300025972 Bacteria 3260
231 Ga0207640_10362842 3300025981 Bacteria 1168
232 Ga0207640_10714615 3300025981 Bacteria 860
233 Ga0207640_10873158 3300025981 Bacteria 784
234 Ga0207658_10298896 3300025986 Bacteria 1386
235 Ga0207658_10955506 3300025986 Bacteria 781
236 Ga0207677_10096423 3300026023 Bacteria 2164
237 Ga0207703_10092523 3300026035 Bacteria 2545
238 Ga0207703_10193062 3300026035 Bacteria 1805
239 Ga0207703_10269871 3300026035 Bacteria 1541
240 Ga0207639_10053848 3300026041 Bacteria 3072
241 Ga0207639_10239330 3300026041 Bacteria 1577
242 Ga0207639_10694017 3300026041 Bacteria 944
243 Ga0207639_10741678 3300026041 Bacteria 913
244 Ga0207678_10007923 3300026067 Bacteria 9364
245 Ga0207678_10008515 3300026067 Bacteria 9040
246 Ga0207678_10280032 3300026067 Bacteria 1431
247 Ga0207678_10483022 3300026067 Bacteria 1079
248 Ga0207708_10176170 3300026075 Bacteria 1696
249 Ga0207708_10564040 3300026075 Bacteria 961
250 Ga0207702_10618048 3300026078 Bacteria 1064
251 Ga0207648_10046685 3300026089 Bacteria 3797
252 Ga0207676_10158903 3300026095 Bacteria 1956
253 Ga0207676_11062121 3300026095 Bacteria 799
254 Ga0207674_10496087 3300026116 Bacteria 1180
255 Ga0207675_100158843 3300026118 Bacteria 2155
256 Ga0207675_100406629 3300026118 Bacteria 1342
257 Ga0207683_10104392 3300026121 Bacteria 2533
258 Ga0207698_10133900 3300026142 Bacteria 2123
259 Ga0209589_1000002 3300027357 Bacteria 708598
260 Ga0209489_100002 3300027361 Bacteria 708609
261 Ga0209700_100002 3300027363 Bacteria 708598
262 Ga0268266_10001826 3300028379 Bacteria 24057
263 Ga0268266_10042569 3300028379 Bacteria 3879
264 Ga0268266_10051078 3300028379 Bacteria 3548
265 Ga0268266_10149442 3300028379 Bacteria 2104
266 Ga0268265_10282669 3300028380 Bacteria 1485
267 Ga0268264_10225868 3300028381 Bacteria 1726
268 Ga0268264_10229068 3300028381 Bacteria 1715
269 Ga0307517_10000650 3300028786 Bacteria 59699
270 Ga0307517_10190184 3300028786 Bacteria 1305
271 Ga0307515_10090494 3300028794 Bacteria 3837
272 Ga0307515_10629050 3300028794 Bacteria 685
273 Ga0265332_10043774 3300031238 Bacteria 1932
274 Ga0265325_10008912 3300031241 Bacteria 5894
275 Ga0307513_10231157 3300031456 Bacteria 1662
276 Ga0307509_10206466 3300031507 Bacteria 1794
277 Ga0307408_100517154 3300031548 Bacteria 1048
278 Ga0265313_10149120 3300031595 Bacteria 1001
279 Ga0307508_10087687 3300031616 Bacteria 2696
280 Ga0265314_10126255 3300031711 Bacteria 1602
281 Ga0265342_10055031 3300031712 Bacteria 2363
282 Ga0307516_10059702 3300031730 Bacteria 3708
283 Ga0307516_10273394 3300031730 Bacteria 1374
284 Ga0307405_10690247 3300031731 Bacteria 844
285 Ga0307410_10315402 3300031852 Bacteria 1239
286 Ga0307406_10127287 3300031901 Bacteria 1782
287 Ga0307406_10402682 3300031901 Bacteria 1085
288 Ga0307407_10357235 3300031903 Bacteria 1036
289 Ga0307412_10201909 3300031911 Bacteria 1510
290 Ga0307412_10203947 3300031911 Bacteria 1504
291 Ga0307412_10509008 3300031911 Bacteria 1004
292 Ga0307416_100879882 3300032002 Bacteria 995
293 Ga0307414_10269950 3300032004 Bacteria 1424
294 Ga0307411_10175856 3300032005 Bacteria 1620
295 Ga0307415_100060993 3300032126 Bacteria 2609
296 Ga0307415_100126245 3300032126 Bacteria 1929
297 Ga0307415_100707134 3300032126 Bacteria 910
298 Ga0307510_10039331 3300033180 Bacteria 5212
299 Ga0307510_10290115 3300033180 Bacteria 1102
300 Ga0373933_0000290 3300035724 Bacteria 32568
301 Ga0373933_0163855 3300035724 Bacteria 1413
302 Ga0373947_0829454 3300035725 Bacteria 631
303 Ga0373925_0626541 3300037068 Bacteria 886
304 Ga0395900_0235024 3300037418 Bacteria 1841
305 Ga0395898_0102302 3300037466 Bacteria 2750
306 Ga0395898_0845117 3300037466 Bacteria 855
307 Ga0395905_0079778 3300037471 Bacteria 3068
308 Ga0395905_0104751 3300037471 Bacteria 2656
309 Ga0451787_624031 3300041441 Bacteria 854
310 Ga0451791_0831322 3300041451 Bacteria 1563
311 Ga0451793_1640344 3300041452 Bacteria 1021
312 Ga0451847_0907993 3300041503 Bacteria 1023
313 Ga0451849_0099554 3300041505 Bacteria 1054
314 Ga0495617_046180 3300046452 Bacteria 1451
315 Ga0495603_0027126 3300046455 Bacteria 3458
316 Ga0495590_0162903 3300046457 Bacteria 811
317 Ga0495591_051858 3300046458 Bacteria 1118
318 Ga0495629_0349937 3300046459 Bacteria 1008
319 Ga0495638_0276312 3300046460 Bacteria 914
320 Ga0495651_0515948 3300046462 Bacteria 763
321 Ga0495639_0141230 3300046475 Bacteria 1158
322 Ga0495639_0161775 3300046475 Bacteria 1084
323 Ga0495584_0127068 3300046491 Bacteria 1292
324 Ga0495584_0141331 3300046491 Bacteria 1222
325 Ga0495585_0186268 3300046492 Bacteria 1064
326 Ga0495596_0192302 3300046500 Bacteria 793
327 Ga0495616_0172402 3300046513 Bacteria 966
328 Ga0495620_0071966 3300046515 Bacteria 1412
329 Ga0495648_0001122 3300046524 Bacteria 27137
330 Ga0495640_0164664 3300046533 Bacteria 1419
331 Ga0495609_0232477 3300046538 Bacteria 763
332 Ga0495621_0009907 3300046539 Bacteria 2909
333 Ga0495597_0040364 3300046542 Bacteria 2086
334 Ga0495622_0035383 3300046557 Bacteria 2329
335 Ga0495633_0037623 3300046558 Bacteria 2314
336 Ga0495633_0274345 3300046558 Bacteria 767
337 Ga0495656_0035143 3300046615 Bacteria 2057
338 Ga0495656_0449735 3300046615 Bacteria 678
339 Ga0495668_0066300 3300046616 Bacteria 1986
340 Ga0495669_0200657 3300046684 Bacteria 953
341 Ga0495649_0358808 3300046694 Bacteria 736
342 Ga0495581_0049990 3300047315 Bacteria 2415
343 Ga0495683_0145512 3300047323 Bacteria 1107
344 Ga0495681_0099423 3300047470 Bacteria 1274
345 Ga0495686_0146670 3300047472 Bacteria 1388
346 Ga0495686_0375574 3300047472 Bacteria 768
347 Ga0495626_0119381 3300048091 Bacteria 1135
348 Ga0496100_0468920 3300048903 Bacteria 967
349 Ga0496101_0012874 3300048904 Bacteria 5595
350 Ga0496102_0001228 3300048905 Bacteria 23201
351 Ga0496102_0204378 3300048905 Bacteria 1862
352 Ga0496102_0385818 3300048905 Bacteria 1318
353 Ga0496102_0656436 3300048905 Bacteria 972
354 Ga0496103_0018583 3300048906 Bacteria 4170
355 Ga0496103_0404661 3300048906 Bacteria 877
356 Ga0496104_0040847 3300048907 Bacteria 4348
357 Ga0496104_0275264 3300048907 Bacteria 1596
358 Ga0496104_0486103 3300048907 Bacteria 1146
359 Ga0496106_0241652 3300048909 Bacteria 1443
360 Ga0496107_0054959 3300048910 Bacteria 2875
361 Ga0496107_0333063 3300048910 Bacteria 1129
362 Ga0496108_0597183 3300048911 Bacteria 962
363 Ga0496109_0007384 3300048912 Bacteria 9302
364 Ga0496109_0141907 3300048912 Bacteria 2246
365 Ga0496110_0070824 3300048913 Bacteria 3090
366 Ga0496110_0314531 3300048913 Bacteria 1426
367 Ga0496112_0057272 3300048915 Bacteria 3836
368 Ga0496113_0006192 3300048916 Bacteria 7557
369 Ga0496113_0134083 3300048916 Bacteria 1945
370 Ga0496115_0002636 3300048918 Bacteria 12885
371 Ga0496115_0728692 3300048918 Bacteria 777
372 Ga0496117_0285293 3300048920 Bacteria 882
373 Ga0496119_0311551 3300048922 Bacteria 773
374 Ga0496121_0097950 3300048924 Bacteria 2271
375 Ga0496121_0145335 3300048924 Bacteria 1753
376 Ga0496121_0193283 3300048924 Bacteria 1457
377 Ga0496124_0334132 3300048927 Bacteria 1079
378 Ga0496125_0291351 3300048928 Bacteria 1005
379 Ga0496125_0324592 3300048928 Bacteria 931
380 Ga0496126_0008705 3300048929 Bacteria 10897
381 Ga0496126_0008925 3300048929 Bacteria 10735
382 Ga0496126_0012601 3300048929 Bacteria 8655
383 Ga0496126_0134975 3300048929 Bacteria 2129
384 Ga0496126_0248527 3300048929 Bacteria 1483
385 Ga0496126_0573574 3300048929 Bacteria 892
386 Ga0501032_0119528 3300049569 Bacteria 1742
387 Ga0501033_0061539 3300049570 Bacteria 2766
388 Ga0501033_0116363 3300049570 Bacteria 1942
389 Ga0501033_0140304 3300049570 Bacteria 1747
390 Ga0501034_0234973 3300049571 Bacteria 1781
391 Ga0501038_0224618 3300049574 Bacteria 1497
392 Ga0501046_0276309 3300049580 Bacteria 1231
393 Ga0501048_0062560 3300049582 Bacteria 2634
394 Ga0501067_0018214 3300049583 Bacteria 3889
395 Ga0501068_0066887 3300049584 Bacteria 2189
396 Ga0501071_0174250 3300049587 Bacteria 1611
397 Ga0501073_0016592 3300049589 Bacteria 5336
398 Ga0501074_0161187 3300049590 Bacteria 1602
399 Ga0501076_0177663 3300049592 Bacteria 1735
400 Ga0501079_0050138 3300049741 Bacteria 3223
401 Ga0501044_0072579 3300049823 Bacteria 3499
402 Ga0501044_0113202 3300049823 Bacteria 2720
403 Ga0501044_0508932 3300049823 Bacteria 1104
404 Ga0501044_1074398 3300049823 Bacteria 675
405 Ga0501045_0066892 3300049824 Bacteria 2638
406 nmdc:mga03683_132544_c1 3300050489 Bacteria 1116
407 nmdc:mga03683_158864_c1 3300050489 Bacteria 1023
408 nmdc:mga03n38_162530_c1 3300050490 Bacteria 1132
409 nmdc:mga03n38_319178_c1 3300050490 Bacteria 838
410 nmdc:mga00v17_211218_c1 3300050491 Bacteria 1256
411 nmdc:mga0yw44_255003_c1 3300050492 Bacteria 1168
412 nmdc:mga0yw44_6437_c1 3300050492 Bacteria 5677
413 nmdc:mga0k408_47483_c1 3300050493 Bacteria 2482
414 nmdc:mga06z11_14975_c1 3300050494 Bacteria 3450
415 nmdc:mga06z11_244557_c1 3300050494 Bacteria 1055
416 nmdc:mga07m45_102738_c1 3300050496 Bacteria 1642
417 nmdc:mga07m45_383958_c1 3300050496 Bacteria 816
418 nmdc:mga07m45_47905_c1 3300050496 Bacteria 2403
419 nmdc:mga05p37_100536_c1 3300050507 Bacteria 3562
420 nmdc:mga0qj67_1009807_c1 3300050509 Bacteria 652
421 nmdc:mga0n895_75518_c1 3300050512 Bacteria 3350
422 nmdc:mga0rr50_138245_c1 3300050513 Bacteria 1957
423 Ga0500610_0160935 3300053079 Bacteria 1117
424 Ga0500635_0007315 3300053080 Bacteria 2991
425 Ga0495655_0074096 3300053083 Bacteria 958
426 Ga0495655_0111726 3300053083 Bacteria 822
427 Ga0500651_0035523 3300053093 Bacteria 3141
428 Ga0500566_0000056 3300053094 Bacteria 53974
429 Ga0500640_000018 3300053095 Bacteria 24576
430 Ga0500641_0147811 3300053096 Bacteria 1015
431 Ga0500554_000460 3300053102 Bacteria 8536
432 Ga0500562_045173 3300053108 Bacteria 1174
433 Ga0500569_178149 3300053109 Bacteria 722
434 Ga0500572_000779 3300053111 Bacteria 10210
435 Ga0500591_023145 3300053115 Bacteria 3013
436 Ga0500594_0014012 3300053118 Bacteria 1915
437 Ga0500595_000476 3300053119 Bacteria 24760
438 Ga0500595_012514 3300053119 Bacteria 3278
439 Ga0500608_002139 3300053122 Bacteria 7093
440 Ga0500614_000537 3300053123 Bacteria 9752
441 Ga0500655_046255 3300053133 Bacteria 861
442 Ga0500658_0367184 3300053134 Bacteria 660
443 Ga0500559_0146462 3300053136 Bacteria 1107
444 Ga0500589_081666 3300053147 Bacteria 1442
445 Ga0500589_101049 3300053147 Bacteria 1252
446 Ga0500590_112289 3300053148 Bacteria 1291
447 Ga0500590_142522 3300053148 Bacteria 1093
448 Ga0500603_000072 3300053150 Bacteria 23238
449 Ga0500603_000078 3300053150 Bacteria 22308
450 Ga0500603_125678 3300053150 Bacteria 780
451 Ga0500630_002405 3300053159 Bacteria 9058
452 Ga0500634_0082107 3300053161 Bacteria 1658
453 Ga0500638_001417 3300053162 Bacteria 7498
454 Ga0500639_000093 3300053163 Bacteria 41781
455 Ga0500637_0000753 3300053178 Bacteria 12967
456 Ga0500637_0001580 3300053178 Bacteria 9750
457 Ga0500596_000938 3300053735 Bacteria 5815
458 Ga0500601_002313 3300053737 Bacteria 2050
459 2513694441 2513237101 Bacteria 7952346
460 2513917416 2513237145 Bacteria 8979722
461 2517888037 2517572143 Bacteria 9484767
462 2524535587 2524023228 Bacteria 10118060
463 2671121171 2667528175 Bacteria 7532676
464 2723849071 2721755755 Bacteria 8322773
465 2728753940 2728368998 Bacteria 8720350
466 2793073302 2791355197 Bacteria 8420563
467 2793079793
468 2874607030 2874604998 Bacteria 7834745
469 2879117138 2879110137 Bacteria 8907982
470 2889034871 2889033259 Bacteria 9099371
471 2904695640 2904690495 Bacteria 9412302
472 2904707962
473 2906612970
474 2906641089 2906635258 Bacteria 8601019
475 2906665645 2906660503 Bacteria 8595048
476 2908746127 2908739725 Bacteria 8628932
477 2908764108 2908756301 Bacteria 8864324
478 2922364701 2922361189 Bacteria 7436256
479 2922391836 2922386360 Bacteria 7017218
480 2935634992 2935630451 Bacteria 8169952
481 2941511729 2941507105 Bacteria 8166816
482 2941519288 2941515067 Bacteria 8166720
483 2941527588 2941523033 Bacteria 8169134
484 8006935482 8006933436 Bacteria 10410654
485 8006965029 8006964411 Bacteria 8966052
486 8006975410 8006973647 Bacteria 10679141
487 8006988516 8006984368 Bacteria 9651211
488 8006995276 8006994254 Bacteria 8309700
489 8019563319 8019555841 Bacteria 9642137
490 8019573398 8019565922 Bacteria 9639779
491 8056679229 8056673599 Bacteria 7871253
492 8056694656 8056689827 Bacteria 6712655
493 Ga0395899_0016980
494 JGI25153J46596_10003994
495 Ga0070658_10059664
496 Ga0070658_10231797
497 Ga0070683_100069952
498 Ga0070690_100060089
499 Ga0068869_100250776
500 Ga0068869_100332593
501 Ga0070682_100021957
502 Ga0070682_100423025
503 Ga0068868_100011153
504 Ga0068868_100088304
505 Ga0070660_100001273
506 Ga0070661_100065195
507 Ga0070661_100066992
508 Ga0070668_100249018
509 Ga0070668_100328877
510 Ga0070668_100378959
511 Ga0070669_100048887
512 Ga0070671_100523178
513 Ga0070671_100799545
514 Ga0070674_100576186
515 Ga0070673_100162224
516 Ga0070688_100523617
517 Ga0070659_100252581
518 Ga0070659_100678093
519 Ga0070703_10023738
520 Ga0070709_10195067
521 Ga0070700_100020038
522 Ga0070694_100075569
523 Ga0070663_100034674
524 Ga0070663_100184180
525 Ga0070663_100238823
526 Ga0070678_100015032
527 Ga0070678_100037737
528 Ga0070678_100122294
529 Ga0070678_100331057
530 Ga0070681_10002300
531 Ga0070681_10056597
532 Ga0068867_100085834
533 Ga0068867_100450451
534 Ga0070706_100700063
535 Ga0070699_100071253
536 Ga0070679_100030870
537 Ga0070679_100158656
538 Ga0070684_100141140
539 Ga0070697_100067843
540 Ga0068853_100005373
541 Ga0068853_100036024
542 Ga0068853_100076145
543 Ga0068853_100641338
544 Ga0070672_100634354
545 Ga0070686_100086379
546 Ga0070696_100073267
547 Ga0070693_100277185
548 Ga0070665_100048597
549 Ga0070665_100062798
550 Ga0070665_100070223
551 Ga0070665_100082821
552 Ga0070665_100140823
553 Ga0070665_100396164
554 Ga0068855_100005358
555 Ga0068855_100044590
556 Ga0070664_100183552
557 Ga0068854_100210869
558 Ga0070702_100080093
559 Ga0070702_100454386
560 Ga0068852_100103263
561 Ga0068852_100145672
562 Ga0068859_100231938
563 Ga0068859_100427707
564 Ga0068864_100176927
565 Ga0068864_100202594
566 Ga0068864_100839496
567 Ga0068866_10088355
568 Ga0068866_10098244
569 Ga0068861_100196198
570 Ga0068861_100665566
571 Ga0068851_10009508
572 Ga0068851_10052276
573 Ga0068851_10374621
574 Ga0068863_100545553
575 Ga0068858_100609314
576 Ga0068858_100776506
577 Ga0068860_100169048
578 Ga0068860_100240872
579 Ga0068860_100340110
580 Ga0068862_100139939
581 Ga0068862_100170299
582 Ga0068862_100494017
583 Ga0068862_100710265
584 Ga0081455_10010629
585 Ga0081455_10109991
586 Ga0081538_10009617
587 Ga0081538_10089241
588 Ga0081540_1001861
589 Ga0081540_1013564
590 Ga0075365_10197691
591 Ga0075365_10392852
592 Ga0075363_100054319
593 Ga0075364_10107079
594 Ga0075364_10124416
595 Ga0070716_100104884
596 Ga0070716_100472786
597 Ga0070712_100026520
598 Ga0075362_10091768
599 Ga0075367_10170484
600 Ga0075366_10072355
601 Ga0075366_10299535
602 Ga0097621_100226381
603 Ga0075370_10053511
604 Ga0068871_100083955
605 Ga0075434_100174976
606 Ga0075429_100223331
607 Ga0068865_100015653
608 Ga0068865_100278115
609 Ga0068865_100560467
610 Ga0097620_100231939
611 Ga0097620_100427693
612 Ga0099824_1015040
613 Ga0099822_1010518
614 Ga0075435_100021255
615 Ga0105250_10014308
616 Ga0105240_10320608
617 Ga0105245_10100772
618 Ga0105245_10506177
619 Ga0114129_10040150
620 Ga0114129_11227592
621 Ga0105243_10027662
622 Ga0105243_10911253
623 Ga0105242_10036976
624 Ga0105248_10102575
625 Ga0105248_10356795
626 Ga0105237_10020603
627 Ga0105237_10438618
628 Ga0105238_10004261
629 Ga0105238_10202754
630 Ga0105238_10269960
631 Ga0105238_10291049
632 Ga0105239_10320404
633 Ga0105239_10339080
634 Ga0105239_10671519
635 Ga0105246_10041285
636 Ga0105246_10200517
637 Ga0105246_10490969
638 Ga0157373_10066140
639 Ga0157370_10079923
640 Ga0157370_10117750
641 Ga0157370_10203042
642 Ga0157369_10019281
643 Ga0157369_10075325
644 Ga0157374_10031569
645 Ga0157374_11093085
646 Ga0163162_10046887
647 Ga0163162_10052853
648 Ga0163162_11038605
649 Ga0157372_11491101
650 Ga0157372_11537174
651 Ga0157375_10008463
652 Ga0163163_10155735
653 Ga0163163_10384082
654 Ga0163163_10425528
655 Ga0157380_10452792
656 Ga0157379_10107985
657 Ga0157379_10158744
658 Ga0157379_11074232
659 Ga0157376_10005234
660 Ga0157376_10467364
661 Ga0163161_10054089
662 Ga0163161_10721588
663 Ga0163161_10793793
664 Ga0209758_1002609
665 Ga0209758_1019604
666 Ga0207653_10003808
667 Ga0207692_10448178
668 Ga0207710_10063204
669 Ga0207688_10016649
670 Ga0207688_10074489
671 Ga0207680_10331433
672 Ga0207705_10088792
673 Ga0207705_10123193
674 Ga0207705_10335198
675 Ga0207654_10047544
676 Ga0207707_10001937
677 Ga0207695_10262880
678 Ga0207671_10415571
679 Ga0207693_10045819
680 Ga0207663_10011973
681 Ga0207660_10002941
682 Ga0207662_10340778
683 Ga0207657_10001268
684 Ga0207657_10006639
685 Ga0207657_10247785
686 Ga0207657_10301192
687 Ga0207649_10089883
688 Ga0207649_10158150
689 Ga0207652_10001009
690 Ga0207652_10182467
691 Ga0207652_10209178
692 Ga0207681_10297866
693 Ga0207694_10005039
694 Ga0207694_10149529
695 Ga0207694_10560006
696 Ga0207687_10028927
697 Ga0207687_10049173
698 Ga0207687_10061296
699 Ga0207644_10822298
700 Ga0207690_10162530
701 Ga0207706_10087558
702 Ga0207709_10070269
703 Ga0207709_10157456
704 Ga0207669_10004480
705 Ga0207669_10078473
706 Ga0207669_10475353
707 Ga0207704_10546070
708 Ga0207704_10626181
709 Ga0207665_10031648
710 Ga0207691_10024728
711 Ga0207691_10505133
712 Ga0207711_10168389
713 Ga0207689_10237757
714 Ga0207689_10595226
715 Ga0207661_10104970
716 Ga0207679_10074372
717 Ga0207667_10045105
718 Ga0207667_10056584
719 Ga0207667_10142266
720 Ga0207712_10034939
721 Ga0207668_10019194
722 Ga0207668_10037062
723 Ga0207640_10362842
724 Ga0207640_10714615
725 Ga0207640_10873158
726 Ga0207658_10298896
727 Ga0207658_10955506
728 Ga0207677_10096423
729 Ga0207703_10092523
730 Ga0207703_10193062
731 Ga0207703_10269871
732 Ga0207639_10053848
733 Ga0207639_10239330
734 Ga0207639_10694017
735 Ga0207639_10741678
736 Ga0207678_10007923
737 Ga0207678_10008515
738 Ga0207678_10280032
739 Ga0207678_10483022
740 Ga0207708_10176170
741 Ga0207708_10564040
742 Ga0207702_10618048
743 Ga0207648_10046685
744 Ga0207676_10158903
745 Ga0207676_11062121
746 Ga0207674_10496087
747 Ga0207675_100158843
748 Ga0207675_100406629
749 Ga0207683_10104392
750 Ga0207698_10133900
751 Ga0209589_1000002
752 Ga0209489_100002
753 Ga0209700_100002
754 Ga0268266_10001826
755 Ga0268266_10042569
756 Ga0268266_10051078
757 Ga0268266_10149442
758 Ga0268265_10282669
759 Ga0268264_10225868
760 Ga0268264_10229068
761 Ga0307517_10000650
762 Ga0307517_10190184
763 Ga0307515_10090494
764 Ga0307515_10629050
765 Ga0265332_10043774
766 Ga0265325_10008912
767 Ga0307513_10231157
768 Ga0307509_10206466
769 Ga0307408_100517154
770 Ga0265313_10149120
771 Ga0307508_10087687
772 Ga0265314_10126255
773 Ga0265342_10055031
774 Ga0307516_10059702
775 Ga0307516_10273394
776 Ga0307405_10690247
777 Ga0307410_10315402
778 Ga0307406_10127287
779 Ga0307406_10402682
780 Ga0307407_10357235
781 Ga0307412_10201909
782 Ga0307412_10203947
783 Ga0307412_10509008
784 Ga0307416_100879882
785 Ga0307414_10269950
786 Ga0307411_10175856
787 Ga0307415_100060993
788 Ga0307415_100126245
789 Ga0307415_100707134
790 Ga0307510_10039331
791 Ga0307510_10290115
792 Ga0373933_0000290
793 Ga0373933_0163855
794 Ga0373947_0829454
795 Ga0373925_0626541
796 Ga0395900_0235024
797 Ga0395898_0102302
798 Ga0395898_0845117
799 Ga0395905_0079778
800 Ga0395905_0104751
801 Ga0451787_624031
802 Ga0451791_0831322
803 Ga0451793_1640344
804 Ga0451847_0907993
805 Ga0451849_0099554
806 Ga0495617_046180
807 Ga0495603_0027126
808 Ga0495590_0162903
809 Ga0495591_051858
810 Ga0495629_0349937
811 Ga0495638_0276312
812 Ga0495651_0515948
813 Ga0495639_0141230
814 Ga0495639_0161775
815 Ga0495584_0127068
816 Ga0495584_0141331
817 Ga0495585_0186268
818 Ga0495596_0192302
819 Ga0495616_0172402
820 Ga0495620_0071966
821 Ga0495648_0001122
822 Ga0495640_0164664
823 Ga0495609_0232477
824 Ga0495621_0009907
825 Ga0495597_0040364
826 Ga0495622_0035383
827 Ga0495633_0037623
828 Ga0495633_0274345
829 Ga0495656_0035143
830 Ga0495656_0449735
831 Ga0495668_0066300
832 Ga0495669_0200657
833 Ga0495649_0358808
834 Ga0495581_0049990
835 Ga0495683_0145512
836 Ga0495681_0099423
837 Ga0495686_0146670
838 Ga0495686_0375574
839 Ga0495626_0119381
840 Ga0496100_0468920
841 Ga0496101_0012874
842 Ga0496102_0001228
843 Ga0496102_0204378
844 Ga0496102_0385818
845 Ga0496102_0656436
846 Ga0496103_0018583
847 Ga0496103_0404661
848 Ga0496104_0040847
849 Ga0496104_0275264
850 Ga0496104_0486103
851 Ga0496106_0241652
852 Ga0496107_0054959
853 Ga0496107_0333063
854 Ga0496108_0597183
855 Ga0496109_0007384
856 Ga0496109_0141907
857 Ga0496110_0070824
858 Ga0496110_0314531
859 Ga0496112_0057272
860 Ga0496113_0006192
861 Ga0496113_0134083
862 Ga0496115_0002636
863 Ga0496115_0728692
864 Ga0496117_0285293
865 Ga0496119_0311551
866 Ga0496121_0097950
867 Ga0496121_0145335
868 Ga0496121_0193283
869 Ga0496124_0334132
870 Ga0496125_0291351
871 Ga0496125_0324592
872 Ga0496126_0008705
873 Ga0496126_0008925
874 Ga0496126_0012601
875 Ga0496126_0134975
876 Ga0496126_0248527
877 Ga0496126_0573574
878 Ga0501032_0119528
879 Ga0501033_0061539
880 Ga0501033_0116363
881 Ga0501033_0140304
882 Ga0501034_0234973
883 Ga0501038_0224618
884 Ga0501046_0276309
885 Ga0501048_0062560
886 Ga0501067_0018214
887 Ga0501068_0066887
888 Ga0501071_0174250
889 Ga0501073_0016592
890 Ga0501074_0161187
891 Ga0501076_0177663
892 Ga0501079_0050138
893 Ga0501044_0072579
894 Ga0501044_0113202
895 Ga0501044_0508932
896 Ga0501044_1074398
897 Ga0501045_0066892
898 nmdc:mga03683_132544_c1
899 nmdc:mga03683_158864_c1
900 nmdc:mga03n38_162530_c1
901 nmdc:mga03n38_319178_c1
902 nmdc:mga00v17_211218_c1
903 nmdc:mga0yw44_255003_c1
904 nmdc:mga0yw44_6437_c1
905 nmdc:mga0k408_47483_c1
906 nmdc:mga06z11_14975_c1
907 nmdc:mga06z11_244557_c1
908 nmdc:mga07m45_102738_c1
909 nmdc:mga07m45_383958_c1
910 nmdc:mga07m45_47905_c1
911 nmdc:mga05p37_100536_c1
912 nmdc:mga0qj67_1009807_c1
913 nmdc:mga0n895_75518_c1
914 nmdc:mga0rr50_138245_c1
915 Ga0500610_0160935
916 Ga0500635_0007315
917 Ga0495655_0074096
918 Ga0495655_0111726
919 Ga0500651_0035523
920 Ga0500566_0000056
921 Ga0500640_000018
922 Ga0500641_0147811
923 Ga0500554_000460
924 Ga0500562_045173
925 Ga0500569_178149
926 Ga0500572_000779
927 Ga0500591_023145
928 Ga0500594_0014012
929 Ga0500595_000476
930 Ga0500595_012514
931 Ga0500608_002139
932 Ga0500614_000537
933 Ga0500655_046255
934 Ga0500658_0367184
935 Ga0500559_0146462
936 Ga0500589_081666
937 Ga0500589_101049
938 Ga0500590_112289
939 Ga0500590_142522
940 Ga0500603_000072
941 Ga0500603_000078
942 Ga0500603_125678
943 Ga0500630_002405
944 Ga0500634_0082107
945 Ga0500638_001417
946 Ga0500639_000093
947 Ga0500637_0000753
948 Ga0500637_0001580
949 Ga0500596_000938
950 Ga0500601_002313
951 2513694441
952 2513917416
953 2517888037
954 2524535587
955 2671121171
956 2723849071
957 2728753940
958 2793073302
959 2793079793
960 2874607030
961 2879117138
962 2889034871
963 2904695640
964 2904707962
965 2906612970
966 2906641089
967 2906665645
968 2908746127
969 2908764108
970 2922364701
971 2922391836
972 2935634992
973 2941511729
974 2941519288
975 2941527588
976 8006935482
977 8006965029
978 8006975410
979 8006988516
980 8006995276
981 8019563319
982 8019573398
983 8056679229
984 8056694656

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
5t9g-assembly2.cif.gz_B crystal structure of bugh2cwt in complex with galactoisofagomine 0.7174 97 179
8e72-assembly1.cif.gz_B treponema lecithinolyticum beta-glucuronidase in complex with a ciprofloxacin-glucuronide conjugate 0.6875 92 194
5t99-assembly1.cif.gz_A crystal structure of bugh2awt in complex with galactoisofagomine 0.6862 97 178
5t9g-assembly1.cif.gz_A crystal structure of bugh2cwt in complex with galactoisofagomine 0.664 97 179
5t9a-assembly3.cif.gz_C crystal structure of bugh2cwt 0.6628 97 179
ID Description Score Start End Superfamily
af_A0A1D6M373_288_408_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.7134 92 190 2.60.40.10
5c71D02 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.6832 92 190 2.60.40.10
af_P84634_1455_1536_3.30.160.20 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.6403 96 122 3.30.160.20
af_Q93324_214_323_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.6236 92 192 2.60.40.10
af_Q8VC04_24_251_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.6039 92 175 2.60.40.10
ID Description Score Start End GO Terms
AF-A0A2E9U9N8-F1-model_v4 Uncharacterized protein 0.8886 66 193
AF-A0A327K241-F1-model_v4 deleted 0.8685 49 209
AF-A0A399R858-F1-model_v4 Tat pathway signal sequence domain protein 0.861 62 193
AF-A0A327K241-F1-model_v4 deleted 0.8582 49 209
AF-A0A1M3AA06-F1-model_v4 deleted 0.8563 62 193

Map